| Clone Name | FLbaf128j07 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g27100:12005.t02362:unspliced-genomic expressed protein| Length = 3156 Score = 79.0 bits (166), Expect(2) = 5e-20 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +2 / +2 Query: 59 LTKATTVQATGVASNLVEAIQGVGFKLQTLSLSFEDFDK 175 LTK TTVQATGVASNLVEAIQG GFKLQTLSLSF+DF++ Sbjct: 2579 LTKETTVQATGVASNLVEAIQGAGFKLQTLSLSFDDFNE 2695 Score = 40.9 bits (83), Expect(2) = 5e-20 Identities = 16/21 (76%), Positives = 21/21 (100%) Frame = +2 / +2 Query: 2 MDGVSDLEVLVEEGIGSVVLT 64 ++GVSDLEVL+EEGIGSVV++ Sbjct: 452 VEGVSDLEVLIEEGIGSVVVS 514 Score = 69.3 bits (145), Expect(2) = 4e-16 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 / +1 Query: 58 VNEGDNGPSYRGGLKPGGSHPGSWFQAANS*PQ 156 V++GD+G SYRGGLKPG SHPGSW QAAN+*PQ Sbjct: 2578 VDKGDDGASYRGGLKPGRSHPGSWLQAANT*PQ 2676 Score = 37.3 bits (75), Expect(2) = 4e-16 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = +3 / +3 Query: 3 WMASVTWRCSSKKASEVLC*RR 68 W TWRCSS+KASEVL * R Sbjct: 453 WRG*ATWRCSSRKASEVLW*AR 518 Score = 63.8 bits (133), Expect(2) = 3e-15 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -2 / -1 Query: 141 CSLKPTPWMASTRFEATPVAWTVVAFVN 58 CSLKP PWMASTRFEATPVA TVV+FVN Sbjct: 2661 CSLKPAPWMASTRFEATPVACTVVSFVN 2578 Score = 40.0 bits (81), Expect(2) = 3e-15 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 / -3 Query: 76 RCRLR*HNTSDAFFDEHLQVTDAIH 2 R R HNTSDAF DEHLQV +H Sbjct: 526 RSRRAYHNTSDAFLDEHLQVAHPLH 452 Score = 68.4 bits (143), Expect(2) = 1e-14 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 / +3 Query: 60 *RRRQRSKLPGWPQTWWKPSRELVSSCKLLASAS 161 *+RR+R KLPGWPQTW KPSREL SSCK LASAS Sbjct: 2580 *QRRRRCKLPGWPQTW*KPSRELASSCKHLASAS 2681 Score = 33.6 bits (67), Expect(2) = 1e-14 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +1 / +1 Query: 19 PGGARRRRHRKCC 57 PGGA R RHRKCC Sbjct: 469 PGGAHRGRHRKCC 507 Score = 62.5 bits (130), Expect(2) = 7e-12 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 / -3 Query: 175 LVEVLEAEAKSLQLETNSLDGFHQV*GHPGSLDR 74 L++++EAEAK LQLE +SLDGF+QV*GHPGSL R Sbjct: 2695 LIKIVEAEAKCLQLEASSLDGFYQV*GHPGSLHR 2594 Score = 29.9 bits (59), Expect(2) = 7e-12 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 / -2 Query: 56 QHFRCLLRRAPPG 18 QHFRCL R APPG Sbjct: 506 QHFRCLPR*APPG 468
>LOC_Os12g24260:12012.t02155:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8284 Score = 39.6 bits (80), Expect = 0.013 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 / -2 Query: 3 WMASVTWRCSSKKASEVLC*RRRQRSKLPGWPQTWWKPSR 122 W V WRC++ KA+ + RRR+ W W+ +R Sbjct: 4419 WRGGVAWRCAAAKAAALAWRRRRRHGAASSWRDVSWRAAR 4300
>LOC_Os02g55340:12002.t05110:unspliced-genomic HEAT repeat family protein, expressed| Length = 7931 Score = 29.5 bits (58), Expect(2) = 0.074 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +3 / +3 Query: 117 SRELVSSCKLLASASRTSTRPMXXXXXXXXSQEKEQTSKPASELTSSARN 266 SR +SC +SA+ S+ P S + +S PAS TS N Sbjct: 210 SRPRTTSCSSRSSAAAASSSPSAASTTRGCSSSRSTSSAPASPSTSR*EN 359 Score = 24.9 bits (48), Expect(2) = 0.074 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 / +2 Query: 10 RQ*PGGARRRRHRK 51 R+ PGG RRRR R+ Sbjct: 107 REEPGGERRRRRRR 148
>LOC_Os10g28060:12010.t02161:unspliced-genomic fatty acid elongase, putative, expressed| Length = 5131 Score = 30.9 bits (61), Expect(2) = 0.10 Identities = 17/61 (27%), Positives = 24/61 (39%) Frame = +3 / +1 Query: 75 RSKLPGWPQTWWKPSRELVSSCKLLASASRTSTRPMXXXXXXXXSQEKEQTSKPASELTS 254 RS P +WW P+R + + A +S S S TS+P S +S Sbjct: 4357 RSASPSPRSSWWSPARPSRPTSQPSAPSSSPSPSSSASSPPSSSSASSAPTSRPTSRTSS 4536 Query: 255 S 257 S Sbjct: 4537 S 4539 Score = 23.1 bits (44), Expect(2) = 0.10 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 / +2 Query: 19 PGGARRRRHRK 51 PGG RRRR R+ Sbjct: 4334 PGGGRRRRGRR 4366
>LOC_Os04g39080:12004.t03478:unspliced-genomic F-box domain containing protein, expressed| Length = 2093 Score = 33.6 bits (67), Expect(2) = 0.14 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 / +1 Query: 19 PGGARRRRHRKCCVNEGDNGPSYRGGLKPGGSHPGS 126 P AR RR R+ G GP+ R P G HPG+ Sbjct: 145 PAEARPRRRRRRRRRGGGGGPAERSAGLPPGGHPGA 252 Score = 22.6 bits (43), Expect(2) = 0.14 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 / +3 Query: 207 SQEKEQTSKPASELTSSA 260 +Q KE+TSK +S SSA Sbjct: 1644 TQSKEKTSKCSSSTLSSA 1697
>LOC_Os01g64960:12001.t05862:unspliced-genomic photosystem II 22 kDa protein, chloroplast precursor, putative,| expressed Length = 2975 Score = 29.0 bits (57), Expect(2) = 0.20 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 / +1 Query: 132 SSCKLLASASRTSTRPMXXXXXXXXSQEKEQTSKPASELTSSARN 266 +SC S S S P + + TS+PAS T S+R+ Sbjct: 2416 TSCSSAGSRSSASPSPSSARSSPARAPSRSSTSRPASPSTRSSRS 2550 Score = 27.2 bits (53), Expect(2) = 0.20 Identities = 12/34 (35%), Positives = 12/34 (35%) Frame = +1 / +2 Query: 19 PGGARRRRHRKCCVNEGDNGPSYRGGLKPGGSHP 120 PG R GD P RGG P HP Sbjct: 2150 PG*GHHREGNPGAAEPGDGDPDLRGGAPPPLLHP 2251
>LOC_Os07g27760:12007.t02469:unspliced-genomic expressed protein| Length = 10188 Score = 35.4 bits (71), Expect = 0.22 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +1 / +1 Query: 22 GGARRRRHRKCCVNEGDNGPSYRGGLKPGGSH 117 GG+ R R CCV +G G S RGGL G H Sbjct: 472 GGSGRVLVRSCCVRDGTLGESCRGGLGGGILH 567
>LOC_Os10g39110:12010.t03153:unspliced-genomic alpha-expansin 7 precursor, putative| Length = 1225 Score = 35.0 bits (70), Expect = 0.30 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 / -3 Query: 21 WRCSSKKASEVLC*RRRQRSKLPGWPQTWWKPSR 122 WR S A+ RRR R P W T W PSR Sbjct: 848 WRGQSAPAAGCTSRRRRGRGPPPSWAGTGWSPSR 747
>LOC_Os03g61570:12003.t05387:unspliced-genomic expressed protein| Length = 1458 Score = 29.9 bits (59), Expect(2) = 0.35 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +1 / +1 Query: 25 GARRRRHRKCCVNEGDNGPSYRGGLKPGGSHPG 123 GARRRR R+ E + RGG G H G Sbjct: 814 GARRRRGRRGAAGEEEEQEGERGGGDHGAPHGG 912 Score = 24.4 bits (47), Expect(2) = 0.35 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +1 / +1 Query: 268 CSDCWGSIFLQIFLFSCHTLAPSNFSSC 351 CS C S + +FL SC+ + +C Sbjct: 1255 CSSCCSSCYCYLFLPSCNVTSSVFSRAC 1338
>LOC_Os02g56860:12002.t05258:unspliced-genomic acyltransferase, putative, expressed| Length = 2026 Score = 27.6 bits (54), Expect(2) = 0.49 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 / -2 Query: 34 RRRHRKCCVNEGDNGPSYRGGLKPG 108 RRR R+C G PS+R PG Sbjct: 831 RRRGRRCARARGSGAPSWRATGTPG 757 Score = 24.0 bits (46), Expect(2) = 0.49 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 / -2 Query: 4 GWRQ*PGGARRRRHRK 51 G R+ P GARRRR R+ Sbjct: 873 GGRRRPRGARRRRGRR 826
>LOC_Os03g31480:12003.t02744:unspliced-genomic alpha-expansin 15 precursor, putative, expressed| Length = 1015 Score = 34.1 bits (68), Expect = 0.57 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 / -1 Query: 36 KKASEVLC*RRRQRSKLPGWPQTWWKPSR 122 + A+ C RR+RS P W T W PSR Sbjct: 457 RSAAAAGCTTRRRRSGAPSWAGTGWSPSR 371
>LOC_Os02g50120:12002.t04596:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1150 Score = 31.3 bits (62), Expect(2) = 0.67 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 / +3 Query: 22 GGARRRRHRKCCVNEGDNGPSYRGGLKPG 108 GG+ RR R+ D G S RGG +PG Sbjct: 21 GGSPHRRGRRRPATRSDGGRSTRGGRRPG 107 Score = 21.7 bits (41), Expect(2) = 0.67 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = +3 / +1 Query: 387 KMLHLPIKNREGKKKK 434 +M PI+ +EGK+K+ Sbjct: 928 RMGQRPIRKKEGKRKR 975
>LOC_Os11g17160:12011.t01494:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4207 Score = 33.6 bits (67), Expect = 0.79 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 / +1 Query: 63 RRRQRSKLPGWPQTWWKPSR 122 RRRQ S W TWW+P+R Sbjct: 1630 RRRQTSVPSSWHATWWRPTR 1689
>LOC_Os07g38090:12007.t03477:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 2969 Score = 33.6 bits (67), Expect = 0.79 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 / +3 Query: 69 RQRSKLPGWPQTWWKPSRELVSSCKLLASASRTSTRP 179 R+R+ PGW + WW + S+ L +A ST P Sbjct: 753 RRRTAAPGWSRCWWASAVASTSTVALEPTAPPRSTAP 863
>LOC_Os12g25450:12012.t02265:unspliced-genomic O-methyltransferase ZRP4, putative, expressed| Length = 2551 Score = 33.6 bits (67), Expect = 0.80 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 / +1 Query: 1 DGWRQ*PGGARRRRHRKCCVNEGDNGPSYRGGLKPGGS 114 DG RQ PG RRR+ + CV E R G + GG+ Sbjct: 559 DGLRQPPGDGRRRQGARRCVPEDQLAGGRRRGPRHGGA 672
>LOC_Os07g40640:12007.t03723:unspliced-genomic expressed protein| Length = 1270 Score = 33.6 bits (67), Expect = 0.80 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 / -1 Query: 37 RRHRKCCVNEGDNGPSYRGGLKPGGSHPGSW 129 RR R C + + PS G + GGS PGSW Sbjct: 934 RRPRPHCCSTPPSSPSAPGKRRTGGSAPGSW 842
>LOC_Os10g25280:12010.t01949:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3168 Score = 28.1 bits (55), Expect(2) = 0.85 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 / +1 Query: 129 VSSCKLLASASRTSTRPMXXXXXXXXSQEKEQTSKPASE 245 +SSCK+ SA +T + + ++KEQ + P S+ Sbjct: 568 LSSCKVFLSAMKTPSPKVQQSHIPIRDKDKEQGATPISD 684 Score = 22.6 bits (43), Expect(2) = 0.85 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 / +2 Query: 298 QIFLFSCHTLAPSNFSSCT 354 QI L TL P+N SCT Sbjct: 680 QIDLLG*STLIPTNHHSCT 736
>LOC_Os08g25380:12008.t02306:unspliced-genomic serine/threonine-protein kinase BRI1-like 1 precursor, putative,| expressed Length = 3990 Score = 33.1 bits (66), Expect = 1.1 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 / -3 Query: 25 GARRRRHRKCCVNEGDNGPSYRGGLKPGG 111 GAR RR R+C G P RGG + GG Sbjct: 367 GARGRRGRRCRGGRGAGAPRARGGRRGGG 281
>LOC_Os07g34070:12007.t03084:unspliced-genomic nodulin-like protein, putative, expressed| Length = 2206 Score = 33.1 bits (66), Expect = 1.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 / +2 Query: 13 Q*PGGARRRRHRKCCVNEGDNGPSYRGG 96 Q PGG RRRR R+C G +RGG Sbjct: 1748 QEPGGTRRRRRRRCRRWHRRRGEGWRGG 1831
>LOC_Os05g02520:12005.t00151:unspliced-genomic legumin-like protein, putative, expressed| Length = 3140 Score = 33.1 bits (66), Expect = 1.1 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 / -2 Query: 135 LKPTPWMASTRFEATPVAWT 76 L P+ W++STRF + P WT Sbjct: 2248 LPPSTWVSSTRFPSAPTTWT 2189
>LOC_Os11g27170:12011.t02332:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6165 Score = 27.2 bits (53), Expect(2) = 1.1 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 / +3 Query: 129 VSSCKLLASASRTSTRPMXXXXXXXXSQEKEQTSKPASE 245 +SSCK+ SA +T + ++KEQ + P S+ Sbjct: 4533 LSSCKVFLSAMKTPPPKVQQSHIPIRDEDKEQGATPFSD 4649 Score = 23.1 bits (44), Expect(2) = 1.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 298 QIFLFSCHTLAPSNFSSCTF 357 QI L T P+N SCTF Sbjct: 4645 QIDLLG*STSIPTNHQSCTF 4704
>LOC_Os09g36976:12009.t03174:unspliced-genomic hematopoietic stem/progenitor cells 176, putative, expressed| Length = 2002 Score = 27.6 bits (54), Expect(2) = 1.2 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 / -1 Query: 7 WRQ*PGGARRRRHRKC 54 W *P G RRRR R C Sbjct: 178 WVS*PDGRRRRRRRSC 131 Score = 22.6 bits (43), Expect(2) = 1.2 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 / -1 Query: 63 RRRQRSKLPGWPQTWW 110 RRR+ LPGW W Sbjct: 148 RRRRSCFLPGWRGDLW 101
>LOC_Os03g01100:12003.t00010:unspliced-genomic DNA repair endonuclease UVH1, putative, expressed| Length = 5393 Score = 30.9 bits (61), Expect(2) = 1.5 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +1 / -3 Query: 22 GGARRRRHRKCCVNEGDNGPSYRGGLKPGGSHPGS 126 GG RRR R+C + G G RG + GG GS Sbjct: 498 GGEPRRRRRRCRRSGGRRGGGGRGRGRGGGGR*GS 394 Score = 23.1 bits (44), Expect(2) = 1.5 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = +3 / -2 Query: 105 WWKPSRELVSSCKLLASASRTSTRP 179 WWK R + + T+TRP Sbjct: 181 WWKSWRRTADAREATGRPHETTTRP 107
>LOC_Os01g56610:12001.t05071:unspliced-genomic homocysteine S-methyltransferase 4, putative, expressed| Length = 1818 Score = 32.7 bits (65), Expect = 1.5 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +3 / +1 Query: 3 WMASVTWRCSSKKASEVLC*RRRQRSKLPGWPQTWWKPSRELVSSCKLLASAS 161 W+A TW + R R GWP++W + +R ++S A++S Sbjct: 226 WVAGATWTARRARCGGSCGKREGARWWTAGWPRSWRRTARTCMTSSGAPAASS 384
>LOC_Os02g19200:12002.t01713:unspliced-genomic F-box domain containing protein, expressed| Length = 5446 Score = 32.7 bits (65), Expect = 1.5 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +1 / +1 Query: 19 PGGARRRRHRKCCVNEGDNGPSYRGGLKPGGSHPGSW 129 P G R R R V+ GD G GGL+ GG SW Sbjct: 658 PRGRWRWRWRCRGVHRGDPGEQRAGGLRQGGEDLASW 768
>LOC_Os05g02690:12005.t00168:unspliced-genomic SRR1-like protein, putative, expressed| Length = 1027 Score = 32.2 bits (64), Expect = 2.0 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 / +1 Query: 57 C*RRRQRSKLPGWPQTWWKPSRELVSSCKLLASASRTSTR 176 C R+RS +P P T P +S+C ASA+ S R Sbjct: 580 CHTARRRSTMPSSPPTGSHPRSSAMSACSATASATTRSRR 699
>LOC_Os03g25640:12003.t02261:unspliced-genomic F-box domain containing protein, expressed| Length = 2262 Score = 32.2 bits (64), Expect = 2.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 / -1 Query: 63 RRRQRSKLPGWPQTWWKPSRELVSSCK 143 RRR+RS+ P P WW +R +C+ Sbjct: 1932 RRRRRSRAPTSPSCWWPGARPRRRACR 1852
>LOC_Os11g43030:12011.t03833:unspliced-genomic protein binding protein, putative, expressed| Length = 2940 Score = 32.2 bits (64), Expect = 2.1 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 / -3 Query: 25 GARRRRHRKCCVNEGDNGPSYRGGLKPG 108 G R RR R+C G + P GG +PG Sbjct: 2029 GVRARRRRRCPRRRGSSSPRRPGGRRPG 1946
>LOC_Os01g04840:12001.t00371:unspliced-genomic vacuolar sorting protein 4b, putative| Length = 3527 Score = 32.2 bits (64), Expect = 2.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 / -2 Query: 19 PGGARRRRHRKCCVNEGDNGPSYRGG 96 P +RRRR R+ C + G G RGG Sbjct: 265 PARSRRRRRRRRCAHRGPRGSPRRGG 188
>LOC_Os04g47150:12004.t04242:unspliced-genomic subtilisin-like protease precursor, putative, expressed| Length = 2896 Score = 28.1 bits (55), Expect(2) = 2.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 / +3 Query: 105 WWKPSRELVSSCKLLASASRTSTRP 179 W PSR +SC+ ++ SR +T P Sbjct: 948 WTTPSRTASTSCRCRSATSRPATSP 1022 Score = 24.0 bits (46), Expect(2) = 2.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 / +3 Query: 19 PGGARRRRHRKCCVNEGDNGPSYR 90 P RRRR R+C G + P+ R Sbjct: 390 PPA*RRRRWRRCPRTTGSSAPTRR 461
>LOC_Os03g12260:12003.t01025:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 2021 Score = 31.8 bits (63), Expect = 2.8 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +3 / -1 Query: 93 WPQTWWKPSRELVSSCKLLASASRTSTRP 179 WP +W K +R+++S+ K +++ R+ RP Sbjct: 674 WPGSWSKATRQMLSNAKRSSASWRSMARP 588
>LOC_Os01g67030:12001.t06060:unspliced-genomic dopamine beta-monooxygenase, putative, expressed| Length = 1700 Score = 31.8 bits (63), Expect = 2.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 / +3 Query: 6 MASVTWRCSSKKASEVLC*RRRQRSKLPGWPQT 104 MAS WR S+ A RR R++ WP+T Sbjct: 585 MASAAWRSSTSWAGRARAAARRTRARCRWWPRT 683
>LOC_Os10g02490:12010.t00140:unspliced-genomic NAD(P)H-dependent oxidoreductase, putative, expressed| Length = 3196 Score = 27.2 bits (53), Expect(2) = 3.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 / -2 Query: 93 WPQTWWKPSRELVSSCKLLASASRTSTRPM 182 WP +P+ C+ ASA RTS P+ Sbjct: 420 WPAAGARPTGTTRCPCRRAASACRTSAPPL 331 Score = 24.9 bits (48), Expect(2) = 3.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 / -1 Query: 3 WMASVTWRCSSKKAS 47 W S TWRCS+ S Sbjct: 3103 WPGSWTWRCSASTTS 3059
>LOC_Os05g33560:12005.t02951:unspliced-genomic expressed protein| Length = 5400 Score = 26.3 bits (51), Expect(2) = 3.6 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 / -1 Query: 28 ARRRRHRKCCVNEGDNGPSYRGGLKPGGS 114 ARRRR RK + RGG + GG+ Sbjct: 2397 ARRRRRRKAATHGAAAPGRRRGGFEGGGA 2311 Score = 22.1 bits (42), Expect(2) = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 / -3 Query: 4 GWRQ*PGGARRRR 42 GWR+ P RRRR Sbjct: 2530 GWRRRPRKGRRRR 2492
>LOC_Os02g29340:12002.t02628:unspliced-genomic heat shock transcription factor like protein, putative, expressed| Length = 3347 Score = 24.4 bits (47), Expect(2) = 3.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 / -1 Query: 63 RRRQRSKLPGWPQTWWKPSR 122 RRR+RS P P T PSR Sbjct: 236 RRRRRSTTPPRPSTGRPPSR 177 Score = 24.0 bits (46), Expect(2) = 3.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 / -1 Query: 4 GWRQ*PGGARRRRHRK 51 G R+ PGG+RRR R+ Sbjct: 278 GGRRTPGGSRRRSSRR 231
>LOC_Os03g16334:12003.t01418:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 4996 Score = 31.3 bits (62), Expect = 3.9 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +3 / -1 Query: 63 RRRQRSKLPGWPQTWW 110 RRR+R + PGWP++ W Sbjct: 310 RRRRRQETPGWPRSAW 263
>LOC_Os01g43740:12001.t03889:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 2846 Score = 31.3 bits (62), Expect = 3.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 / +1 Query: 66 RRQRSKLPGWPQTWWKPSRELVSSCKLLASASRTSTRP 179 RR + PGWP+++ SR VSS +R+S RP Sbjct: 349 RRATTLSPGWPRSFRTSSRSTVSSMHKGNCFNRSSGRP 462
>LOC_Os01g38140:12001.t03352:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10891 Score = 31.3 bits (62), Expect = 3.9 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 / +3 Query: 63 RRRQRSKLPGWPQTWWKPSRELVSSCKLLASASRTSTRP 179 RRR+R + WP T W+ S C A++ +++RP Sbjct: 7641 RRRRRRRRRRWPITCWQNSCGGAPPCACCATSRSSASRP 7757
>LOC_Os11g14850:12011.t01316:unspliced-genomic hypothetical protein| Length = 2009 Score = 31.3 bits (62), Expect = 3.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 / +3 Query: 22 GGARRRRHRKCCVNEGDNGPSYRGGLKPG 108 GG+ RR R+ D G S RGG +PG Sbjct: 171 GGSPHRRGRRRPATRSDGGRSTRGGRRPG 257
>LOC_Os10g33370:12010.t02637:unspliced-genomic acyltransferase, putative, expressed| Length = 7408 Score = 31.3 bits (62), Expect = 3.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 / -2 Query: 28 ARRRRHRKCCVNEGDNGPSYRGG 96 +RRRR R+C G G ++RGG Sbjct: 6189 SRRRRRRRCGCGRGGGGGAWRGG 6121
>LOC_Os07g17270:12007.t01587:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6981 Score = 31.3 bits (62), Expect = 3.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 / +2 Query: 4 GWRQ*PGGARRRRHRKCC 57 GW + GG RRHR CC Sbjct: 5552 GWSRTAGGCTSRRHRPCC 5605
>LOC_Os03g44930:12003.t03877:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1826 Score = 31.3 bits (62), Expect = 3.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 / -3 Query: 25 GARRRRHRKCCVNEGDNGPSYRGGLKPGGSH 117 G +RRRH + + + G GG +PGG H Sbjct: 93 GGQRRRHGRPSLAAREGGAGGTGGQRPGGLH 1
>LOC_Os01g72310:12001.t06519:unspliced-genomic CW-type Zinc Finger family protein, expressed| Length = 5673 Score = 31.3 bits (62), Expect = 3.9 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +1 / +1 Query: 4 GWRQ*PGGARRRRHRKCCVNEGDNGPSYRGGLKPGGSHP 120 G R+ G R RR R CC PS RGG G + P Sbjct: 520 GGREEEGMGRWRRGRWCCSTCTSPSPSGRGGSSRGPARP 636
>LOC_Os10g30054:12010.t02340:unspliced-genomic ENT domain containing protein, expressed| Length = 9476 Score = 25.4 bits (49), Expect(2) = 4.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 / +2 Query: 64 EGDNGPSYRGGLKPGGSHPGS 126 +G P +RGG PGG G+ Sbjct: 629 QGPRRPGHRGGGGPGGGRRGA 691 Score = 22.6 bits (43), Expect(2) = 4.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 / +1 Query: 4 GWRQ*PGGARRRRHRKC 54 GWR+ G + RR R C Sbjct: 556 GWRRCCGASPRRSRRAC 606
>LOC_Os03g09310:12003.t00784:unspliced-genomic ABI3-interacting protein 2, putative, expressed| Length = 4556 Score = 30.9 bits (61), Expect = 5.3 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 / +3 Query: 63 RRRQRSKLPGWPQTWWKPSRELVSSCKLLASASR 164 R R R P P +WW P+R S + ASA+R Sbjct: 294 RCRTRPCRPSTPPSWWPPTRGAWCSPRRRASAAR 395
>LOC_Os07g19110:12007.t01768:unspliced-genomic conserved hypothetical protein| Length = 456 Score = 30.9 bits (61), Expect = 5.4 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 / +2 Query: 4 GWRQ*PGGARRRRHRKCCVNEGDNGPSYRGG 96 GWR G RRRR + G+ G +GG Sbjct: 68 GWRPGGGDDRRRRRARVAAAHGETGKERKGG 160
>LOC_Os04g13230:12004.t01144:unspliced-genomic hypothetical protein| Length = 2607 Score = 30.9 bits (61), Expect = 5.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 / +1 Query: 37 RRHRKCCVNEGDNGPSYRGGLKP 105 RR + CVN GD RGGL+P Sbjct: 2245 RRQNQLCVNPGDARARRRGGLEP 2313
>LOC_Os02g40840:12002.t03719:unspliced-genomic oxidoreductase, putative, expressed| Length = 5464 Score = 30.9 bits (61), Expect = 5.4 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +1 / +1 Query: 25 GARRRRHRKCCVNEGDNGPSYRGGLKPGGSH 117 G RRRHR+ + G G R G GG H Sbjct: 3697 GGVRRRHRRLRLRRGRGGRGARRGRPQGGGH 3789
>LOC_Os01g68500:12001.t06206:unspliced-genomic expressed protein| Length = 1024 Score = 30.9 bits (61), Expect = 5.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 / +3 Query: 31 RRRRHRKCCVNEGDNGPSYRGGLKPGGSHPGS 126 RRRR +CC G G S R G + G+ G+ Sbjct: 189 RRRRRTRCCGRTGCRGGSCRRGSRISGTTKGA 284
>LOC_Os01g42350:12001.t03754:unspliced-genomic PDR5-like ABC transporter, putative| Length = 8375 Score = 30.9 bits (61), Expect = 5.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 / +2 Query: 253 AVHVTCSDCWGSIFLQIFLFSCHTLA 330 A H TCS WG LQ L +C T++ Sbjct: 7502 ASHKTCSTPWGQCMLQCCLLAC*TVS 7579
>LOC_Os05g41390:12005.t03677:unspliced-genomic cyclin-A1, putative, expressed| Length = 3254 Score = 28.6 bits (56), Expect(2) = 5.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 / -3 Query: 78 SKLPGWPQTWWKP 116 S LPGWP +W P Sbjct: 1998 SSLPGWPSSWGSP 1960 Score = 22.6 bits (43), Expect(2) = 5.5 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 / -3 Query: 381 PLKMLHLPIKNR 416 PL++ HLPI+ R Sbjct: 993 PLRLQHLPIRRR 958
>LOC_Os04g45640:12004.t04098:unspliced-genomic hypothetical protein| Length = 886 Score = 26.3 bits (51), Expect(2) = 5.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +3 / +2 Query: 102 TWWKPSRELVSSCKL 146 TWW+PSR +VS L Sbjct: 578 TWWEPSRCIVSYLSL 622 Score = 23.1 bits (44), Expect(2) = 5.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 / +1 Query: 305 FSLVVIHSLLAIFQAARFT 361 F+ VIH +LAI +FT Sbjct: 664 FTTFVIHDVLAIVPVGQFT 720
>LOC_Os08g18894:12008.t004307:unspliced-genomic expressed protein| Length = 918 Score = 25.4 bits (49), Expect(2) = 6.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 63 RRRQRSKLPGWPQT 104 RRR+RS + GWP T Sbjct: 330 RRRRRSGVGGWPVT 371 Score = 24.0 bits (46), Expect(2) = 6.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 / +1 Query: 265 TCSDCWGSIFLQIFLFSC 318 +CS GS LQ+F F C Sbjct: 547 SCSSRSGSPLLQLFFFRC 600
>LOC_Os04g21060:12004.t01840:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2643 Score = 29.0 bits (57), Expect(2) = 6.3 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 / +3 Query: 31 RRRRHRKCCVNEGDNGPSYRGGLKPGGSH 117 RR RHR+ +EGD G +G L P H Sbjct: 2343 RRWRHRRPESSEGDRGEQGQGPLGPRSRH 2429 Score = 21.7 bits (41), Expect(2) = 6.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 / +1 Query: 10 RQ*PGGARRRRHRK 51 R+ GG RRR HR+ Sbjct: 2281 RRRDGGRRRRSHRR 2322
>LOC_Os01g70080:12001.t06309:unspliced-genomic NB-ARC domain containing protein, expressed| Length = 5355 Score = 29.5 bits (58), Expect(2) = 6.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 / -2 Query: 4 GWRQ*PGGARRRRHRKCC 57 GW P G RRRR R+ C Sbjct: 4511 GWWTSPAGCRRRRRRRAC 4458 Score = 22.1 bits (42), Expect(2) = 6.4 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 / -3 Query: 37 RRHRKCCVNEGDNGPSYRGGLKPGGSHPGS 126 RR R+ G G RGG +PG G+ Sbjct: 418 RRSRRGAS*SGGCGRRGRGGARPGRRSAGA 329
>LOC_Os08g30080:12008.t02761:unspliced-genomic 1-aminocyclopropane-1-carboxylate oxidase, putative, expressed| Length = 1531 Score = 26.3 bits (51), Expect(2) = 6.9 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 / +2 Query: 87 PGWPQTWWKPSRELVSSCKLLASAS 161 P WP WW S S C+ S + Sbjct: 863 PRWPARWW*TSATSSSWCRTAGSGA 937 Score = 23.5 bits (45), Expect(2) = 6.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 / +2 Query: 24 RCSSKKASEVLC*RRRQRSKLPG 92 RCS ++ RRR+R PG Sbjct: 371 RCSRRRGGSTSSPRRRRRPTTPG 439
>LOC_Os08g02500:12008.t00145:unspliced-genomic ACR8, putative| Length = 2181 Score = 26.3 bits (51), Expect(2) = 7.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 / +3 Query: 46 RKCCVNEGDNGPSYRGG 96 R+CCV +GD P GG Sbjct: 63 RQCCVLDGDARPGMYGG 113 Score = 24.0 bits (46), Expect(2) = 7.0 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +3 / +1 Query: 87 PGWPQTWWKPSRELVSSCKLLASASRT 167 P W W+P+R ++ +S+S T Sbjct: 598 PTWTAPSWRPARGRTAAASAASSSSAT 678
>LOC_Os10g13960:12010.t01119:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4466 Score = 29.0 bits (57), Expect(2) = 7.2 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 / +1 Query: 25 GARRRRHRKCC 57 GARRR HR+CC Sbjct: 1762 GARRRSHRRCC 1794 Score = 22.1 bits (42), Expect(2) = 7.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 / +1 Query: 111 KPSRELVSSCKLLASASRTSTRP 179 +PSR L + +LAS T++ P Sbjct: 3988 RPSRRLSRASFVLASTGHTASSP 4056
>LOC_Os09g32370:12009.t02852:unspliced-genomic expressed protein| Length = 2273 Score = 30.4 bits (60), Expect = 7.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 / +2 Query: 63 RRRQRSKLPGWPQTWWKPSRELVSSCKLLASASRTSTRP 179 RRR R + PGWP P SSC+ +A +R + P Sbjct: 1967 RRR*RRRSPGWPW*AASPRTSSRSSCRTMAW*TRRRSWP 2083
>LOC_Os04g53930:12004.t04866:unspliced-genomic organic cation transporter protein, putative, expressed| Length = 3366 Score = 30.4 bits (60), Expect = 7.3 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +3 / +1 Query: 63 RRRQRSKLPGWPQTWWKPSRELVSSCKLLASASRTST 173 RRR+R P W + WW S C ++S S+ Sbjct: 2650 RRRRRRWAPSWRRWWWCSGSACRSRCSACRASSAGSS 2760
>LOC_Os03g14254:12003.t005762:unspliced-genomic expressed protein| Length = 1018 Score = 30.4 bits (60), Expect = 7.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 63 RRRQRSKLPGWPQTWWKPSREL 128 RRR+RS+ GWP PSR L Sbjct: 459 RRRRRSRFGGWPPPPASPSRRL 524
>LOC_Os01g24810:12001.t02200:unspliced-genomic cytochrome P450 89A2, putative| Length = 1575 Score = 30.4 bits (60), Expect = 7.3 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = +3 / +2 Query: 63 RRRQRSKLPGWPQTWWKPSRELVSSCKLLASASRTS 170 RR + +++ WP WW S S C + R S Sbjct: 512 RRPRETRVAAWPWPWWTASSSPCSRCSRTCALVRGS 619
>LOC_Os06g46910:12006.t04377:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 3171 Score = 30.4 bits (60), Expect = 7.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 / +1 Query: 19 PGGARRRRHRKCCVNEGDNGPS 84 P +RRRR R+ C G GPS Sbjct: 556 PARSRRRRRRRRCAGRGARGPS 621
>LOC_Os06g28390:12006.t02543:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6594 Score = 30.4 bits (60), Expect = 7.4 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 / +3 Query: 22 GGARRRRHRKCCVNEGDNGPSYRG 93 GGA RRRHR+C G P +G Sbjct: 483 GGAVRRRHRRCAPRSGCLRPQRQG 554
>LOC_Os06g07780:12006.t00660:unspliced-genomic vesicle-associated membrane protein 712, putative, expressed| Length = 2816 Score = 30.4 bits (60), Expect = 7.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 / +2 Query: 19 PGGARRRRHRKCCVNEGDNGPSYRGGLKPGGS 114 P G+RRR R+ GD P GG + GG+ Sbjct: 89 PHGSRRREARRGEARGGDGDPVRGGGARDGGA 184
>LOC_Os02g50550:12002.t04639:unspliced-genomic dynamin-2B, putative, expressed| Length = 9681 Score = 30.4 bits (60), Expect = 7.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 / -2 Query: 67 GDNGPSYRGGLKPGGSHPGSWFQAA 141 G P RG +PGG PG+W + A Sbjct: 197 GAGWPRRRGRRRPGGRRPGAWTRRA 123
>LOC_Os01g58459:12001.t06823:unspliced-genomic expressed protein| Length = 3811 Score = 30.4 bits (60), Expect = 7.4 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +1 / -2 Query: 1 DGWRQ*PGGARRRRHRKCCVNEGDNGPSYRGGLKPGGSHPGSW 129 DG R+ P GARR R + V G +GP G G W Sbjct: 3444 DGARRRPSGARRTREQAAGVVCGRSGPPVARSGAGGDEAHGEW 3316
>LOC_Os12g40300:12012.t03709:unspliced-genomic skp1 family, dimerisation domain containing protein, expressed| Length = 3292 Score = 28.1 bits (55), Expect(2) = 7.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / +3 Query: 4 GWRQ*PGGARRRRHRKCCVN 63 GWR+ G RRRR CC + Sbjct: 90 GWRRRRRGRRRRRRGLCCAS 149 Score = 22.6 bits (43), Expect(2) = 7.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 / +3 Query: 308 SLVVIHSLLAIFQAARFTFRHNYVP 382 S +I SLL I+ + F +RH+ P Sbjct: 1230 SFQIIPSLLLIWFNSLFKYRHHLKP 1304
>LOC_Os10g11570:12010.t00952:unspliced-genomic hypothetical protein| Length = 1744 Score = 27.6 bits (54), Expect(2) = 7.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 / +2 Query: 4 GWRQ*PGGARRRRHRKCCVNEGDNGPSYR 90 GWR P RRRR + + GD G +R Sbjct: 197 GWRATPRRRRRRRRHRPTL*RGDRGD*WR 283 Score = 22.1 bits (42), Expect(2) = 7.9 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +1 / +2 Query: 76 GPSYRGGLKPGGSHPGSW 129 GP GG + GG G W Sbjct: 896 GPKGGGGEREGGGKRGLW 949
>LOC_Os02g37654:12002.t03402:unspliced-genomic 1-O-acylceramide synthase precursor, putative, expressed| Length = 10594 Score = 26.7 bits (52), Expect(2) = 8.5 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 / -2 Query: 31 RRRRHRKCCVNEGDNGPSYRGGLKPGGSHPGS 126 R R C +G +R G +PG S PGS Sbjct: 477 RSRSWAPGCRRRAGSGTRWRRGRRPGPSAPGS 382 Score = 25.4 bits (49), Expect(2) = 8.5 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / -2 Query: 22 GGARRRRHR 48 GGARRRRHR Sbjct: 6645 GGARRRRHR 6619
>LOC_Os12g38200:12012.t03501:unspliced-genomic expressed protein| Length = 1431 Score = 26.3 bits (51), Expect(2) = 8.8 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 / -3 Query: 4 GWRQ*PGGARRRRHRK 51 G R+ PG RRRRHR+ Sbjct: 1231 GTRRRPGRRRRRRHRR 1184 Score = 23.1 bits (44), Expect(2) = 8.8 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +3 / -3 Query: 63 RRRQRSKLPGWPQTWW 110 RRR+ P W WW Sbjct: 961 RRRRSRWWPSWRWRWW 914
>LOC_Os10g15180:12010.t01183:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2871 Score = 27.2 bits (53), Expect(2) = 8.9 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 / +3 Query: 25 GARRRRHRKCCVNEGDNGPSYR 90 GAR RR R+ C N PS+R Sbjct: 1617 GARLRRRRRWCHRR*TNAPSWR 1682 Score = 23.1 bits (44), Expect(2) = 8.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +3 / +2 Query: 78 SKLPGWPQTWWK 113 S+ P W WWK Sbjct: 2603 SRWPNWRGLWWK 2638
>LOC_Os04g46940:12004.t04222:unspliced-genomic copper-transporting ATPase 3, putative, expressed| Length = 5763 Score = 27.6 bits (54), Expect(2) = 9.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 / +2 Query: 7 WRQ*PGGARRRRHRKCCVNEGDNGPSYR 90 WR+ P G RRRR +C G P R Sbjct: 278 WRRRPWGRRRRRRWRCSRCPG*RAPRAR 361 Score = 23.5 bits (45), Expect(2) = 9.1 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 / +1 Query: 275 IVGVQYFFRYFSLVVIHSLLAIF 343 IVG + RYF++VV S +++F Sbjct: 1774 IVGHETNQRYFNIVVAWSCISLF 1842
>LOC_Os05g37030:12005.t03247:unspliced-genomic expressed protein| Length = 843 Score = 24.9 bits (48), Expect(2) = 9.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 / -3 Query: 63 RRRQRSKLPGWPQTWWKPSRELVSSCKLLASASRTSTRP 179 RRR+R LPG P T S S+ ++S + + P Sbjct: 214 RRRRRRPLPGSPPTTRTSSAATPSTTTTTTASSASCSLP 98 Score = 22.1 bits (42), Expect(2) = 9.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 / -3 Query: 10 RQ*PGGARRRRHRK 51 R+ PG RRRR R+ Sbjct: 370 RRRPGAGRRRRQRR 329 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 146,965,967 Number of extensions: 2023345 Number of successful extensions: 14712 Number of sequences better than 10.0: 74 Length of query: 145 Length of database: 55,613,886 Length adjustment: 47 Effective length of query: 98 Effective length of database: 52,968,820 Effective search space: 5190944360 Effective search space used: 5190944360 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)