| Clone Name | FLbaf123d17 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g01530:12005.t00054:unspliced-genomic expressed protein| Length = 1082 Score = 73.5 bits (154), Expect(4) = 3e-32 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 / +1 Query: 304 WKCFDCQGFGMRKCPTCGKGGLTPEQRGER*KK 402 ++CFDCQGFG++ CP+CGK GLTPEQRGER* K Sbjct: 700 FRCFDCQGFGLKSCPSCGKEGLTPEQRGER*NK 798 Score = 50.1 bits (103), Expect(4) = 3e-32 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +1 / +3 Query: 202 VASGCKTCRGKGAVECEGCK 261 V++GCKTCRGKGAVEC GCK Sbjct: 363 VSAGCKTCRGKGAVECPGCK 422 Score = 45.5 bits (93), Expect(4) = 3e-32 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 / +1 Query: 259 KGTGRNKKNGNIFERWK 309 +GTGRNKKNGNIFERWK Sbjct: 511 QGTGRNKKNGNIFERWK 561 Score = 29.9 bits (59), Expect(4) = 3e-32 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 / +2 Query: 88 VSLRASTATNRSCFLCRQPVTPKTRMLPAMASKSGARL 201 +SL TAT + + + RM P MASK GA++ Sbjct: 125 LSLITFTATGAAAAFTSPKIKRRMRMAPTMASKPGAKV 238 Score = 66.6 bits (139), Expect(3) = 2e-18 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 / -1 Query: 398 FYLSPLCSGVRPPLPQVGHFLIPNPWQSKHFH 303 FYLSPLCSGV P LPQ+G L PNPWQSKH + Sbjct: 794 FYLSPLCSGVSPSLPQLGQLLSPNPWQSKHLN 699 Score = 38.2 bits (77), Expect(3) = 2e-18 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -1 / -2 Query: 248 HSTAPFPLHVLQPEATSLA 192 HSTAPFPLHVLQP T A Sbjct: 409 HSTAPFPLHVLQPAETCSA 353 Score = 28.6 bits (56), Expect(3) = 2e-18 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -1 / -3 Query: 200 SLAPDLDAMAGSILVL 153 +LAP LDAM G+IL+L Sbjct: 237 TLAPGLDAMVGAILIL 190 Score = 53.3 bits (110), Expect(3) = 3e-13 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = +3 / +3 Query: 303 MEVLRLPGVWDEEVPHLWQGRPHAGAERRKVEE 401 ++VLRLP VW +E+ LWQGR H GAER K+E+ Sbjct: 699 VQVLRLPRVWAQELS*LWQGRAHTGAER*KIEQ 797 Score = 36.3 bits (73), Expect(3) = 3e-13 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +3 / +3 Query: 261 GDWQEQEERQHLREMEV 311 G W+EQEE QH+REMEV Sbjct: 513 GHWKEQEEWQHIREMEV 563 Score = 26.3 bits (51), Expect(3) = 3e-13 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 210 RLQDMQGEGCSGMRRLQGDW 269 RLQD+Q +G M RLQG + Sbjct: 371 RLQDVQRKGSCRMPRLQGKY 430 Score = 39.1 bits (79), Expect = 0.033 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -3 / -3 Query: 402 FLLPFSSLLRREASLATGGALPHPKPLAVEA 310 F+L F+SLLR E LAT PKPLA+EA Sbjct: 798 FVLSFTSLLRCEPFLATARTALEPKPLAIEA 706
>LOC_Os04g33680:12004.t03044:unspliced-genomic electron transporter, putative, expressed| Length = 1749 Score = 40.9 bits (83), Expect = 0.009 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 / +2 Query: 214 CKTCRGKGAVECEGCKGTGRNKKNGNIFERWKCFDCQGFGMRKCPTC 354 C C G V C C G+ + + +G E +C +C G+ +CP C Sbjct: 1373 CAGCAGVRFVMCRDCNGSRKVRVDGERKETVQCGECNENGLVRCPIC 1513
>LOC_Os01g32120:12001.t02791:unspliced-genomic calmodulin, putative, expressed| Length = 1021 Score = 40.9 bits (83), Expect = 0.009 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -2 / -2 Query: 241 LHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAA 137 + PSP +S SL PVS T + WP + WAS AA Sbjct: 711 MRPSPSVSASLIMPVSSLTVSAWPSLAMEWASSAA 607
>LOC_Os01g64840:12001.t05850:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative, expressed| Length = 1849 Score = 39.1 bits (79), Expect = 0.033 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 / -3 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWPEASWS 155 PL P PC C L+ P +W PWP+ + S Sbjct: 248 PLSPPPCWLCPLEELPPPCSWPPWPDGTRS 159
>LOC_Os01g08440:12001.t00722:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative, expressed| Length = 1815 Score = 38.2 bits (77), Expect = 0.063 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -2 / +3 Query: 232 SPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYG 116 SPC + + PP SP TPW W A T S G Sbjct: 708 SPCSAAATDPPCSPTRSTPWSPRPWRRCGSTASTSSPSG 824
>LOC_Os12g19870:12012.t01830:unspliced-genomic hypothetical protein| Length = 2247 Score = 37.7 bits (76), Expect = 0.087 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = -3 / +1 Query: 159 GLGRHWLPTQEAATVRGSGCSQGDQTSTSRLHG 61 G G WL Q A RG + GD TST R HG Sbjct: 1897 GKGAGWLADQLEAAARGQMATAGDDTSTERRHG 1995
>LOC_Os11g38949:12011.t03437:unspliced-genomic 40S ribosomal protein S9, putative, expressed| Length = 2625 Score = 37.3 bits (75), Expect = 0.12 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = -3 / +3 Query: 192 PGLGRHGRKHPGLGRHWLPTQEAATVRGSGCSQGDQTSTSRLHGCCCCL 46 P +G G + R W + ATVR S S S R G CC+ Sbjct: 81 PAIGGGGDAGEAVRRRWFTSASTATVRSSSSSSSPSLSRPRTAGLSCCV 227
>LOC_Os10g42960:12010.t03519:unspliced-genomic urea active transporter, putative, expressed| Length = 2725 Score = 37.3 bits (75), Expect = 0.12 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 / +2 Query: 205 PPVSPRTWTPWPEASWSWASLAADTRSSYGSW 110 PP PR W P P SWAS A S SW Sbjct: 1394 PPRQPRAWCPRPPQQRSWASPAPSCYSPCSSW 1489
>LOC_Os09g02850:12009.t00184:unspliced-genomic hypothetical protein| Length = 844 Score = 37.3 bits (75), Expect = 0.12 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 / -2 Query: 211 LKPPVSPRTWTPWPEASWSWASLAADTR 128 L P SP TW+ W +A SW S +D+R Sbjct: 819 LHPEFSPPTWSCWSDARCSWLSFCSDSR 736
>LOC_Os03g04590:12003.t00336:unspliced-genomic 60S ribosomal protein L23, putative, expressed| Length = 2802 Score = 37.3 bits (75), Expect = 0.12 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +3 / +3 Query: 192 GETGGFRLQDMQGEGCSGMRRLQGDWQEQEERQHLRE 302 G GG ++ D+ G C G L+G + QE HLRE Sbjct: 171 GRVGGEQVPDVAGSACGGDGELRGQHRGQEPLHHLRE 281
>LOC_Os02g30320:12002.t02725:unspliced-genomic drought-induced protein 1, putative, expressed| Length = 1193 Score = 37.3 bits (75), Expect = 0.12 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 / +2 Query: 208 SGCKTCRGKGAVECEGCKGTGRNK 279 SGC+TC G G + C C G+G + Sbjct: 470 SGCRTCAGSGRMPCRSCGGSGTGR 541 Score = 24.4 bits (47), Expect(2) = 7.3 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +1 / +2 Query: 310 CFDCQGFGMRKCPTCGKGG 366 C C G G C +CG G Sbjct: 476 CRTCAGSGRMPCRSCGGSG 532 Score = 24.0 bits (46), Expect(2) = 7.3 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 / +2 Query: 214 CKTCRGKGAVEC 249 C TC G G V+C Sbjct: 407 CATCGGSGRVDC 442
>LOC_Os06g04280:12006.t00317:unspliced-genomic 3-phosphoshikimate 1-carboxyvinyltransferase, chloroplast| precursor, putative, expressed Length = 3623 Score = 29.5 bits (58), Expect(2) = 0.19 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 / -2 Query: 235 PSPCMSCSLKPPVSPRTWTPW 173 P+P PP PR WTPW Sbjct: 160 PTPPRPGPGTPPPQPRRWTPW 98 Score = 24.4 bits (47), Expect(2) = 0.19 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -3 / -3 Query: 189 GLGRHGRKH 163 G+GRHGR+H Sbjct: 114 GVGRHGRRH 88
>LOC_Os07g07880:12007.t00667:unspliced-genomic expressed protein| Length = 1914 Score = 24.0 bits (46), Expect(3) = 0.20 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 / -3 Query: 84 TSTSRLHGCCCC 49 +S R GCCCC Sbjct: 133 SSGGRGRGCCCC 98 Score = 23.1 bits (44), Expect(3) = 0.20 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 / -3 Query: 60 CCCCLPQKLSKFYSPM 13 CCCC LS + P+ Sbjct: 106 CCCC*SPPLSSPFPPL 59 Score = 22.6 bits (43), Expect(3) = 0.20 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 / -3 Query: 181 TPWPEASWSWASLAADTRSSYG 116 +PW AS SW S A + G Sbjct: 181 SPWTCASLSWTSSPAPSSGGRG 116
>LOC_Os02g31290:12002.t02821:unspliced-genomic mei2-like protein, putative, expressed| Length = 8305 Score = 24.0 bits (46), Expect(3) = 0.22 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -3 / +2 Query: 60 CCCCLPQKLSK 28 CCCC+P L + Sbjct: 230 CCCCVPLGLGR 262 Score = 23.1 bits (44), Expect(3) = 0.22 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / +1 Query: 195 RPGLGRHGRKHPGLGRHW 142 RPG G H + G G W Sbjct: 130 RPGSGEHLEEEEGEGGEW 183 Score = 22.1 bits (42), Expect(3) = 0.22 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 / +2 Query: 111 GSGCSQGDQTSTSRLHGCCCC 49 G+G + ++ + R CCCC Sbjct: 176 GNGERRPEEGARRRCCCCCCC 238
>LOC_Os12g41270:12012.t03804:unspliced-genomic protein kinase domain containing protein| Length = 5340 Score = 36.3 bits (73), Expect = 0.22 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -2 / -1 Query: 247 IPLHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTR 128 +PLH S S SL PP SP P EA+ SW + TR Sbjct: 2967 LPLHISS*TSKSLSPPPSPSPSPPAAEAAGSWHQPMSSTR 2848
>LOC_Os06g44450:12006.t04133:unspliced-genomic CONSTANS-like protein CO6, putative, expressed| Length = 1570 Score = 36.3 bits (73), Expect = 0.22 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = -2 / +3 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQ 107 P P PC S S P PR W P S + S + T S +W+ Sbjct: 378 PWPPRPCCSASPPPGPRPRRWRIRPRPSTTTTSSGSSTARSTSTWR 515
>LOC_Os10g11150:12010.t00916:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1440 Score = 34.5 bits (69), Expect(2) = 0.26 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +1 / +3 Query: 100 ASTATNRSCFLCRQPVTPKTRMLPAMASKSGARLVASGCKTCR 228 AST + +C CR+ V P TR+ A+ RL C CR Sbjct: 195 ASTTSPPACLRCRRVVPPPTRLAYYAAAVGRLRLHRPACLRCR 323 Score = 22.1 bits (42), Expect(2) = 0.26 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 / +1 Query: 404 IKHPSIHGSTRQMHSPMS 457 + H ++HG R H P S Sbjct: 529 VGHTTVHGRPRLHHRPAS 582
>LOC_Os03g30092:12003.t02621:unspliced-genomic expressed protein| Length = 1728 Score = 29.9 bits (59), Expect(2) = 0.27 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 / +2 Query: 214 CKTCRGKGAVECEGCKGTGRNKKNG 288 CK C V C CKG G +K G Sbjct: 1328 CKKCGDLRIVACSQCKGVGSVRKGG 1402 Score = 23.5 bits (45), Expect(2) = 0.27 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +1 / +2 Query: 310 CFDCQGFGMRKCPTCGK 360 C +C+ G CP C K Sbjct: 1478 CTNCRSKGRLLCPECSK 1528
>LOC_Os10g32980:12010.t02606:unspliced-genomic CESA7 - cellulose synthase, expressed| Length = 4662 Score = 35.9 bits (72), Expect = 0.31 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -2 / +1 Query: 190 RTWTPWPEASWSWASLAADTRSSYGSWQWMLSR 92 RTWT WP + + AS AA RS S +W SR Sbjct: 1345 RTWTGWPSGTSATASRAAWPRSISSSARWTRSR 1443
>LOC_Os03g13600:12003.t01154:unspliced-genomic zinc finger protein 7, putative, expressed| Length = 2775 Score = 35.9 bits (72), Expect = 0.31 Identities = 19/70 (27%), Positives = 27/70 (38%) Frame = +1 / +2 Query: 97 RASTATNRSCFLCRQPVTPKTRMLPAMASKSGARLVASGCKTCRGKGAVECEGCKGTGRN 276 RA+ RS CR P P R LP S++ A G + R + GC Sbjct: 1832 RATPPPARSASTCRSPSPPPPRRLPPPPSRAPRTAAARGRRRRRRRRRASRRGCSRATTA 2011 Query: 277 KKNGNIFERW 306 + + + RW Sbjct: 2012 RGSSSARRRW 2041
>LOC_Os10g26500:12010.t02062:unspliced-genomic homeodomain-leucine zipper transcription factor TaHDZipI-2,| putative Length = 1274 Score = 30.9 bits (61), Expect(2) = 0.31 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 / -1 Query: 190 RTWTPWPEASWSW 152 R W PWP +WSW Sbjct: 140 RWWPPWPPWAWSW 102 Score = 25.4 bits (49), Expect(2) = 0.31 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 / -3 Query: 235 PSPCMSCSLKPPVSP 191 P P SCSL PP P Sbjct: 861 PPPACSCSLLPPPPP 817
>LOC_Os04g57760:12004.t05242:unspliced-genomic expressed protein| Length = 1598 Score = 27.2 bits (53), Expect(3) = 0.32 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 / +3 Query: 244 PLHPSPCMSCSLKPPVSPRTWTP 176 P +PC S S P +P WTP Sbjct: 912 PRPSTPCPSSSPPSPPNPARWTP 980 Score = 23.5 bits (45), Expect(3) = 0.32 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 / +3 Query: 396 LPFSSLLRREASLATGGALPHP 331 LP SLL R S AT P P Sbjct: 729 LPRRSLLSRSTSPATASPAPRP 794 Score = 23.5 bits (45), Expect(3) = 0.32 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 / +3 Query: 187 TWTPWPEASWSWASLAADTRSSYGSW 110 T P P + S A+ TRSS SW Sbjct: 1107 TGCPTPSTACSGRRCASATRSSGASW 1184
>LOC_Os10g40950:12010.t03334:unspliced-genomic H+/hexose cotransporter, putative, expressed| Length = 1022 Score = 33.6 bits (67), Expect(2) = 0.34 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 / +1 Query: 161 GCFRPWRPSPGRDWWLQAARHAGGRVQW 244 G R W PSP WW AR G +W Sbjct: 844 GTTRRWPPSPSLWWWRSRARSPSGSGRW 927 Score = 22.1 bits (42), Expect(2) = 0.34 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 / +1 Query: 104 PLPRTVAASCVGSQ*RPRPGC 166 P P A+ G + RP P C Sbjct: 493 PAPSAATAAVRGRRWRPSPAC 555
>LOC_Os09g29980:12009.t02676:unspliced-genomic RNA recognition motif family protein, expressed| Length = 4509 Score = 24.0 bits (46), Expect(3) = 0.42 Identities = 9/29 (31%), Positives = 10/29 (34%) Frame = -3 / -1 Query: 135 TQEAATVRGSGCSQGDQTSTSRLHGCCCC 49 T T G C G + CCCC Sbjct: 405 TPGMCTFSGCRCGGGGGSEGGACSCCCCC 319 Score = 22.1 bits (42), Expect(3) = 0.42 Identities = 6/14 (42%), Positives = 6/14 (42%) Frame = -2 / -1 Query: 193 PRTWTPWPEASWSW 152 P W P P W W Sbjct: 552 PWRWKPSPPPGWIW 511 Score = 22.1 bits (42), Expect(3) = 0.42 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = -3 / -1 Query: 63 GCCCC 49 GCCCC Sbjct: 258 GCCCC 244
>LOC_Os12g28820:12012.t02592:unspliced-genomic hypothetical protein| Length = 792 Score = 35.4 bits (71), Expect = 0.42 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -3 / +2 Query: 126 AATVRGSGCSQGDQTSTSRLHGCCCC 49 A+T RGSG + +S R GCCCC Sbjct: 410 ASTRRGSGSGRRRPSSVERSGGCCCC 487
>LOC_Os10g30150:12010.t02349:unspliced-genomic ethylene-responsive protein, putative, expressed| Length = 956 Score = 35.0 bits (70), Expect = 0.58 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 / +3 Query: 187 TWTPWPEASWSWASLAADTRSSYGSWQWMLSRRP 86 T TPW A SWA+ A R++ + W SR P Sbjct: 633 TRTPWRRAGRSWAASATTARTARAARSWSSSRLP 734
>LOC_Os02g40600:12002.t03696:unspliced-genomic hypothetical protein| Length = 735 Score = 29.0 bits (57), Expect(2) = 0.61 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 337 RKCPTCGKGGLTPEQRGER*KKHQASI 417 R CPTCG G P+ R*+ ++ Sbjct: 494 RSCPTCGAAGWRPQGSTSR*RSRPPAV 574 Score = 25.4 bits (49), Expect(2) = 0.61 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 / +3 Query: 170 RPWRPSPGRDWWLQAARHAGGRVQ 241 R RP PGRD +A HAG V+ Sbjct: 219 RRLRPRPGRDG**RAGSHAGPGVR 290
>LOC_Os06g21530:12006.t01970:unspliced-genomic ABC-type Co2+ transport system, permease component, putative,| expressed Length = 648 Score = 23.1 bits (44), Expect(3) = 0.69 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / -3 Query: 141 LPTQEAATVRGSGCS 97 LP AA VRG+ CS Sbjct: 262 LPPWTAAAVRGAACS 218 Score = 22.6 bits (43), Expect(3) = 0.69 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -3 / -3 Query: 111 GSGCSQGDQTSTSRLHGCC 55 GS CS G + GCC Sbjct: 157 GSSCSCGRGRGAAGARGCC 101 Score = 22.1 bits (42), Expect(3) = 0.69 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 / -3 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWP 170 P P S S PP SPR P P Sbjct: 358 PTPPPAASSGSSPPPGSPRPSPPPP 284
>LOC_Os09g19560:12009.t01691:unspliced-genomic protein arginine N-methyltransferase 1, putative, expressed| Length = 3485 Score = 31.8 bits (63), Expect(2) = 0.76 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 / +1 Query: 82 SLVSLRASTATNRSCFLCRQPVTP 153 SLVSL + A + CF RQP+TP Sbjct: 52 SLVSLSKTLAFSFPCFAARQPITP 123 Score = 24.4 bits (47), Expect(2) = 0.76 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +1 / +2 Query: 577 QAECCEEINWFLHVLTG 627 Q +CC + N+F+ ++ G Sbjct: 1145 QTKCCRDANYFIVLIAG 1195
>LOC_Os11g06020:12011.t00493:unspliced-genomic BEL1-like homeodomain transcription factor, putative, expressed| Length = 6529 Score = 34.5 bits (69), Expect = 0.80 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -2 / -2 Query: 235 PSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRS 125 P+PC S +PP PRT P P ++ A AA S Sbjct: 3294 PAPCTSSPTRPPPPPRTTPPPPASAGGTACTAAPPAS 3184
>LOC_Os10g21090:12010.t01600:unspliced-genomic ATP binding protein, putative, expressed| Length = 2694 Score = 34.5 bits (69), Expect = 0.80 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -3 / -1 Query: 171 RKHPGLGRHWLPTQEAATVRGSGCSQGDQTSTSRLHGCCCC 49 R+ + + W + + G+G GD+ S H CCCC Sbjct: 399 RRGESVRKSWWCWRRRRS*GGTGMGGGDRRSVRHRHSCCCC 277
>LOC_Os07g45410:12007.t04179:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 9379 Score = 34.5 bits (69), Expect = 0.80 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 / -2 Query: 135 TQEAATVRGSGCSQGDQTSTSRLHGC 58 ++E ATVRG GCS D+ +T+R C Sbjct: 6465 SEEGATVRGRGCSTSDEGATARGSPC 6388
>LOC_Os03g63910:12003.t05609:unspliced-genomic salt-inducible protein, putative, expressed| Length = 4587 Score = 34.5 bits (69), Expect = 0.80 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = -2 / +2 Query: 205 PPVSPRTWTPWPEASWSWASLAADTRSSYGS 113 PPVSP T +P P +S A+ A+ TR S GS Sbjct: 644 PPVSPSTTSPTPPSSPPPAAAASSTRPSSGS 736
>LOC_Os03g48970:12003.t04247:unspliced-genomic nuclear transcription factor Y subunit A-1, putative, expressed| Length = 4124 Score = 34.5 bits (69), Expect = 0.80 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -3 / +1 Query: 180 RHGRKHPGLGRHWLPTQEAATVRGSGCSQGDQTSTSR 70 R GR PG GR P+ VRGS C G +T+R Sbjct: 1210 RGGRPPPGSGRCRPPSWRRGAVRGSACRAGMAAATTR 1320
>LOC_Os03g46530:12003.t04021:unspliced-genomic F-box domain containing protein| Length = 2783 Score = 34.5 bits (69), Expect = 0.80 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -3 / +2 Query: 135 TQEAATVRGSGCSQGDQTSTSRLHGCCCCLPQKLSKFYSP 16 ++ AA+ R + + TS++ CCCC P+ S+ SP Sbjct: 1319 SRRAASPRAAASASHGATSSTTAACCCCCAPRSSSRARSP 1438
>LOC_Os03g44050:12003.t03796:unspliced-genomic OsWAK27 - OsWAK receptor-like protein kinase, expressed| Length = 4237 Score = 34.5 bits (69), Expect = 0.80 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -2 / -2 Query: 241 LHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTR 128 L SPC+S + R W PWPE S +S A R Sbjct: 3864 LQSSPCLSAARNAVDRDRFWPPWPEQEASSSSYTAFLR 3751
>LOC_Os04g40490:12004.t03611:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 4074 Score = 27.6 bits (54), Expect(2) = 0.84 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 / +3 Query: 247 IPLHPSPCMSCSLKPPVSP 191 +PLH S C CS PP P Sbjct: 18 LPLHFSCCYCCSRSPPPPP 74 Score = 24.0 bits (46), Expect(2) = 0.84 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 / +3 Query: 190 RTWTPWPEASWSWASLAADTRS 125 RTW+PW + A+L R+ Sbjct: 171 RTWSPWRRRACRAAALGTSRRA 236
>LOC_Os02g51370:12002.t04721:unspliced-genomic glutaredoxin family protein, expressed| Length = 1707 Score = 26.3 bits (51), Expect(2) = 0.89 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +1 / +2 Query: 172 AMASKSGARLVASGCKTCRGKGAVECEGCKGT 267 A + +G + C C G V CE C G+ Sbjct: 1280 APPAAAGKGIALDACSGCGGVRFVPCEECSGS 1375 Score = 25.4 bits (49), Expect(2) = 0.89 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 / +2 Query: 307 KCFDCQGFGMRKCPTCGK 360 +C DC G+ +CP C K Sbjct: 1412 RCPDCNENGLVRCPLC*K 1465
>LOC_Os01g40550:12001.t03579:unspliced-genomic hsp20/alpha crystallin family protein, expressed| Length = 1354 Score = 29.5 bits (58), Expect(2) = 0.91 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 / -1 Query: 187 TWTPWPEASWSWASLAADTRSSYGSW 110 +W+P P W WA+ R S SW Sbjct: 691 SWSPSPPPDWPWAAGRRRRRLSPASW 614 Score = 22.1 bits (42), Expect(2) = 0.91 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 / -3 Query: 118 GSWQWMLSRRP 86 GSW + SRRP Sbjct: 548 GSWNTLFSRRP 516
>LOC_Os12g34350:12012.t03124:unspliced-genomic expressed protein| Length = 4351 Score = 34.1 bits (68), Expect = 1.1 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 / -3 Query: 208 KPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQWMLSRR 89 + P P+ +PWP +S S +S + + W+W L R Sbjct: 188 RTPARPKNRSPWPASSSSSSSSHQEEGGARQGWRWRLGER 69
>LOC_Os12g05050:12012.t00393:unspliced-genomic stem-specific protein TSJT1, putative, expressed| Length = 3617 Score = 34.1 bits (68), Expect = 1.1 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = -3 / -3 Query: 189 GLGRHGRKHPGLGRHWLPTQEAATVRGSGCSQGDQTSTSRLHGC 58 GLG HG + G GR T+ A RGSG S++ GC Sbjct: 360 GLGWHGSRRGGRGRRAARTRPARRRRGSG*PAPTPASSATASGC 229
>LOC_Os02g43940:12002.t03979:unspliced-genomic transcriptional factor TINY, putative, expressed| Length = 1418 Score = 34.1 bits (68), Expect = 1.1 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = -2 / -3 Query: 193 PRTWTPWPEASWSWASLAADTRSSYGSWQWMLSR 92 P WTP P W W R+ G W+ L R Sbjct: 711 PTRWTPPPRRRWRWRRRRQRRRTRIGRWRLQLRR 610
>LOC_Os02g15900:12002.t01383:unspliced-genomic 50S ribosomal protein L21, chloroplast precursor, putative,| expressed Length = 2300 Score = 34.1 bits (68), Expect = 1.1 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 / +3 Query: 104 PLPRTVAASCVGSQ*RPRPGCFRPWRPSPGRDW 202 P PR A+ GS PR PWRP P R W Sbjct: 144 PSPRPRPAAAGGSSLPPRSRRPHPWRPRPRRRW 242
>LOC_Os02g14730:12002.t01267:unspliced-genomic UBP15, putative, expressed| Length = 8109 Score = 34.1 bits (68), Expect = 1.1 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +1 / +3 Query: 151 PKTRMLPAMASKSGARLVASGCKTCRGKGAVECEGCK 261 P R +P M S AR C TC G C CK Sbjct: 1212 PSLRPMPYMRSAPSARPEYHECATCHGPAKTRCSRCK 1322
>LOC_Os06g41200:12006.t03814:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 2699 Score = 32.7 bits (65), Expect(2) = 1.1 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 / -1 Query: 153 GRHWLPTQEAATVRGSGCSQGDQTSTS 73 GR ++E ATVRG GCS D+ +T+ Sbjct: 497 GRGCSTSKEGATVRGRGCSTSDEGATA 417 Score = 22.6 bits (43), Expect(2) = 1.1 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = -1 / -2 Query: 632 SNPVNTCRNQLISSQHSACFSNQLCVSP 549 +NP N+C N ++ + C + + SP Sbjct: 2656 ANPDNSCNNSKLNMLAANCRESGIDASP 2573 Score = 32.7 bits (65), Expect = 2.9 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 / -1 Query: 129 EAATVRGSGCSQGDQTSTSRLHGC 58 E ATVRG GCS + +T R GC Sbjct: 515 EGATVRGRGCSTSKEGATVRGRGC 444
>LOC_Os02g57710:12002.t05342:unspliced-genomic signal peptide peptidase-like 2B, putative, expressed| Length = 5739 Score = 29.5 bits (58), Expect(2) = 1.2 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -2 / -2 Query: 202 PVSPRTWTPWPEASWSWASLAADTRSSYGSWQW 104 P SP +W PWP S L+A W W Sbjct: 170 PPSPASWCPWPPDLSSSTLLSAARDGWGWGWGW 72 Score = 26.7 bits (52), Expect(2) = 1.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 / -3 Query: 362 PLPQVGHFLIPNPWQSKH 309 P P +GH I +P+ SKH Sbjct: 3742 PNPSIGHPAINSPYNSKH 3689
>LOC_Os04g06110:12004.t00491:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4521 Score = 29.9 bits (59), Expect(2) = 1.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 / -3 Query: 224 HVLQPEATSLAPDLDAMAGSILVLGVTGCRHKK 126 H + AT PD DA+ G L++ + GCR K Sbjct: 2275 HTIDVPATFPTPDGDAVDGLPLIVSLPGCRR*K 2177 Score = 25.8 bits (50), Expect(2) = 1.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -3 / -1 Query: 66 HGCCCC 49 HGCCCC Sbjct: 900 HGCCCC 883
>LOC_Os02g09750:12002.t00822:unspliced-genomic lycopene beta cyclase, chloroplast precursor, putative, expressed| Length = 1820 Score = 29.5 bits (58), Expect(2) = 1.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 / -2 Query: 164 CFRPWRPSPGRDWWLQAAR 220 C+RPWR GR W A R Sbjct: 1387 CWRPWRRGRGRTWRAPARR 1331 Score = 24.9 bits (48), Expect(2) = 1.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 / -2 Query: 354 WQGRPHAGAERRKVEETSSIHPSMAAPGR 440 W GR +G R + + P+ AAP R Sbjct: 196 WSGRGRSGGGRGRAARGVTAGPATAAPRR 110
>LOC_Os10g41230:12010.t03359:unspliced-genomic homeobox-leucine zipper protein HAT1, putative, expressed| Length = 1533 Score = 33.6 bits (67), Expect = 1.5 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -2 / -2 Query: 196 SPRTWTPWPEASWSWASLAADTRSSYGSWQWMLSRR 89 +P T P P A+ WA A R S W W+ RR Sbjct: 1244 TPTTSAPPPAATGGWAPAARGRRRSCCGWWWLRRRR 1137
>LOC_Os07g28850:12007.t02575:unspliced-genomic argonaute-like protein, putative, expressed| Length = 6576 Score = 33.6 bits (67), Expect = 1.5 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 / +3 Query: 170 RPWRPSPGRDWWLQAAR 220 RPWR S GR WWL+ R Sbjct: 318 RPWRLSRGRRWWLRTRR 368
>LOC_Os04g31630:12004.t02844:unspliced-genomic hypothetical protein| Length = 1469 Score = 33.6 bits (67), Expect = 1.5 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 / +1 Query: 187 SGARLVASGCKTCRGKGAVECEGCKGTGRNKK 282 S AR SGC+ C G C C G+G ++ Sbjct: 217 SDARGDCSGCRACAGTRRAPCRSCGGSGTGRR 312
>LOC_Os01g73220:12001.t06604:unspliced-genomic peroxidase 12 precursor, putative, expressed| Length = 1654 Score = 33.6 bits (67), Expect = 1.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 / +3 Query: 217 CSLKPPVSPRTWTPWPEAS 161 C +PP R WTPWP +S Sbjct: 918 CRRRPPPCRRCWTPWPRSS 974
>LOC_Os06g50100:12006.t04694:unspliced-genomic protein kinase APK1B, chloroplast precursor, putative, expressed| Length = 3280 Score = 28.1 bits (55), Expect(2) = 1.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 / -2 Query: 214 SLKPPVSPRTWTPWPEASWSW 152 S +P +P TW P P + SW Sbjct: 570 SARPTSAPATWPPTPPPAGSW 508 Score = 22.6 bits (43), Expect(2) = 1.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 / -1 Query: 244 PLHPSPCMSCSLKPPVS 194 P PSP +S LKP V+ Sbjct: 727 PKPPSPILSARLKPLVA 677
>LOC_Os02g06350:12002.t00533:unspliced-genomic hypothetical protein| Length = 3058 Score = 26.3 bits (51), Expect(2) = 1.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 / +1 Query: 253 GCKGTGRNKKNGNIFERW 306 GC GTGR +K+G + W Sbjct: 286 GCGGTGRWRKSGGENDMW 339 Score = 24.4 bits (47), Expect(2) = 1.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 / +1 Query: 107 LPRTVAASCVGSQ*RPRPGCFRPW 178 LPR A G Q R PGC W Sbjct: 166 LPRAATAGQGGGQCRRWPGCGGGW 237
>LOC_Os11g08600:12011.t00752:unspliced-genomic hypothetical protein| Length = 2349 Score = 28.1 bits (55), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 / -2 Query: 247 IPLHPSPCMSCSLKPPVSPRT 185 IPL +PC S S+ P SP T Sbjct: 1145 IPLATAPCRSASVHAPPSPST 1083 Score = 22.6 bits (43), Expect(2) = 1.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 / -2 Query: 196 SPRTWTPWPEASWSWASLAADTRS 125 +P W P+ EA SLA TR+ Sbjct: 1037 APPPWPPFTEAPGLPPSLAVPTRA 966
>LOC_Os01g67330:12001.t06089:unspliced-genomic nucleotide-sugar transporter/ sugar porter, putative, expressed| Length = 5949 Score = 31.8 bits (63), Expect(2) = 1.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 / -1 Query: 198 SRPGLGRHGRKHPGLGRHW 142 SR G GRHG + PG G W Sbjct: 108 SRRGGGRHGERRPGEGEEW 52 Score = 24.0 bits (46), Expect(2) = 1.6 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -1 / -3 Query: 620 NTCRNQLISSQHSACFSNQLC 558 N Q ++ QHS C+S++ C Sbjct: 4720 NKIYGQSMTKQHSRCYSSKDC 4658
>LOC_Os12g02130:12012.t00110:unspliced-genomic expressed protein| Length = 6000 Score = 28.1 bits (55), Expect(2) = 1.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 / -1 Query: 376 EQRGER*KKHQASIHPWQHQADA 444 E+ GER ++ + PWQH DA Sbjct: 441 EELGERPEEDEREHQPWQHGGDA 373 Score = 27.6 bits (54), Expect(2) = 1.6 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 / -3 Query: 310 CFDCQGFGMRKCPTCGKGG 366 C C G R C CG GG Sbjct: 652 CCSCGSGGWRSCGACGAGG 596
>LOC_Os11g02190:12011.t00113:unspliced-genomic expressed protein| Length = 6120 Score = 28.1 bits (55), Expect(2) = 1.7 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 / -3 Query: 376 EQRGER*KKHQASIHPWQHQADA 444 E+ GER ++ + PWQH DA Sbjct: 493 EELGERPEEDEREHQPWQHGGDA 425 Score = 27.6 bits (54), Expect(2) = 1.7 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 / -2 Query: 310 CFDCQGFGMRKCPTCGKGG 366 C C G R C CG GG Sbjct: 704 CCSCGSGGWRSCGACGAGG 648
>LOC_Os06g13080:12006.t01183:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 1939 Score = 25.4 bits (49), Expect(3) = 1.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 / -1 Query: 244 PLHPSPCMSCSLKPPVSPRTWT 179 P P P + S PP R+WT Sbjct: 1117 PSPPPPRRAASAPPPACARSWT 1052 Score = 24.9 bits (48), Expect(3) = 1.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 / -3 Query: 75 SRLHGCCCCLPQKL 34 SRL CCCC L Sbjct: 566 SRLASCCCCTRSSL 525 Score = 21.7 bits (41), Expect(3) = 1.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 / -2 Query: 375 RREASLATGGALPHPKPLAVEALP 304 RRE L GGA +P A A P Sbjct: 1386 RRERGLDAGGAREPSEPQAPPAHP 1315
>LOC_Os12g02120:12012.t00109:unspliced-genomic dual-specificity protein-like phosphatase 3, putative, expressed| Length = 6939 Score = 28.1 bits (55), Expect(2) = 1.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 / +2 Query: 376 EQRGER*KKHQASIHPWQHQADA 444 E+ GER ++ + PWQH DA Sbjct: 875 EELGERPEEDEREHQPWQHGGDA 943 Score = 27.6 bits (54), Expect(2) = 1.9 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 / +1 Query: 310 CFDCQGFGMRKCPTCGKGG 366 C C G R C CG GG Sbjct: 664 CCSCGSGGWRSCGACGAGG 720
>LOC_Os06g08820:12006.t00761:unspliced-genomic RING-H2 finger protein ATL2C, putative| Length = 1335 Score = 30.4 bits (60), Expect(2) = 1.9 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 / +3 Query: 342 VPHLWQGRPHAGAERRKVEETSSIHPSMAAPGR 440 VPHL + RP RR+ +HP AA R Sbjct: 480 VPHLPRQRPRRRRRRRRRRRLVGVHPGSAARAR 578 Score = 23.1 bits (44), Expect(2) = 1.9 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +1 / +2 Query: 154 KTRMLPAMASKSGARLVASGCKTCRGKGAVECEGCKGTG 270 +TR A +S S + +S C + C GC G G Sbjct: 59 RTR*ARASSSSSPSSPSSSSSSACSTC*SRTCSGCAGRG 175
>LOC_Os02g36414:12002.t03278:unspliced-genomic sugar transport protein 5, putative, expressed| Length = 7360 Score = 29.9 bits (59), Expect(2) = 2.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 / +2 Query: 113 RTVAASCVGSQ*RPRPGCFRPWRPSP 190 R A+SC GS RP P C P P Sbjct: 5966 RPTASSCAGSSTRPAPRCAASAEPPP 6043 Score = 25.8 bits (50), Expect(2) = 2.0 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = +2 / +2 Query: 170 RPWRPSPGRDWWLQAARHAGGRVQW 244 R WR GR W A R +W Sbjct: 6386 RAWRGRTGRGWGATAGRRCRAGTRW 6460
>LOC_Os07g30210:12007.t02711:unspliced-genomic integral membrane protein, putative, expressed| Length = 3568 Score = 25.8 bits (50), Expect(2) = 2.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 / -2 Query: 189 RGETGGFRLQDMQGEGCSGMRRLQGD 266 RG GG LQD G+G + GD Sbjct: 1143 RGGGGGGALQDAHGDGAGEAQHRPGD 1066 Score = 24.4 bits (47), Expect(2) = 2.1 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 / -1 Query: 152 PRPGCFRPWRPSPGR 196 PRPG R RPSP R Sbjct: 1234 PRPGGTRTRRPSPPR 1190
>LOC_Os10g05300:12010.t00408:unspliced-genomic conserved hypothetical protein| Length = 3545 Score = 28.1 bits (55), Expect(2) = 2.1 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = -2 / +2 Query: 196 SPRTWTPWPEASWSWASLAADTRSSYGSWQW 104 +P + PWP +S + + R+ SW+W Sbjct: 167 TPWRFMPWPPSSTATRTKILQNRAIAASWKW 259 Score = 22.1 bits (42), Expect(2) = 2.1 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -1 / +3 Query: 251 SHSTAPFP 228 +HSTAPFP Sbjct: 69 NHSTAPFP 92
>LOC_Os11g40450:12011.t03586:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 12498 Score = 33.1 bits (66), Expect = 2.1 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 / -3 Query: 135 TQEAATVRGSGCSQGDQTSTSRLHGC 58 + E ATVRG G S ++ +T R HGC Sbjct: 2704 SMEGATVRGRGFSTSEEGATVRGHGC 2627 Score = 32.7 bits (65), Expect = 2.9 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = -3 / -3 Query: 153 GRHWLPTQEAATVRGSGCSQGDQTSTS 73 GR + ++E ATVRG GCS ++ +T+ Sbjct: 2680 GRGFSTSEEGATVRGHGCSTSEEGATA 2600
>LOC_Os11g36930:12011.t03237:unspliced-genomic expressed protein| Length = 5370 Score = 33.1 bits (66), Expect = 2.1 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +2 / -1 Query: 440 MHSPMSYLSCSTLLEF*LLSRSKYQPESPNKYRKPNMVIHIIGLRNKQNV 589 MHSP+ +CS L F +S + + P + +P+ ++G+ N Q V Sbjct: 3399 MHSPLLKFNCSESLFFPFISCNAFSP*ATENSSQPSNTKGLLGIHNVQLV 3250
>LOC_Os09g25150:12009.t02195:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 3187 Score = 33.1 bits (66), Expect = 2.1 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = -2 / +2 Query: 235 PSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSS 122 P+ C + P +P WTP +WS S A T SS Sbjct: 671 PARCAGWCSRRPSAPSPWTPTAAPTWSSTSPAGATSSS 784
>LOC_Os07g14530:12007.t01317:unspliced-genomic expressed protein| Length = 4396 Score = 33.1 bits (66), Expect = 2.1 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -2 / +1 Query: 238 HPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRS 125 HPSP S S PP PR TP P + +S ++ T S Sbjct: 322 HPSPPRSSSSPPPPPPRPRTPSPPTPTTPSSRSSTTTS 435
>LOC_Os04g03920:12004.t00280:unspliced-genomic expressed protein| Length = 1584 Score = 33.1 bits (66), Expect = 2.1 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 / -1 Query: 113 RTVAASCVGSQ*RPRPGCFRPWRPSPGRDWWLQAARHAG 229 R AA G++ R G PWR + GRD W AR G Sbjct: 645 RRAAAGTRGARRRGGGGGGAPWRRAGGRDRWAARARRRG 529
>LOC_Os03g20450:12003.t01803:unspliced-genomic ATP binding protein, putative, expressed| Length = 5067 Score = 33.1 bits (66), Expect = 2.1 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 / -1 Query: 444 CICLVLPWMDGCLMFLLPFSSLLRRE 367 C+C P + GCL++L+PFS L + E Sbjct: 3363 CLCEHSPTVAGCLLWLVPFSLLFQLE 3286
>LOC_Os02g50460:12002.t04630:unspliced-genomic immediate-early fungal elicitor protein CMPG1, putative, expressed| Length = 1621 Score = 33.1 bits (66), Expect = 2.1 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -3 / +2 Query: 192 PGLGRHGRKHPGLGRHWLPTQEAATVRGSGCSQGDQTSTSR 70 PGLGR GR+ G+ W P +A R + TSR Sbjct: 548 PGLGRSGRRASGIAGAWRPPAPSARSRSRSLVSPRRPPTSR 670
>LOC_Os01g44430:12001.t03952:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 6230 Score = 33.1 bits (66), Expect = 2.1 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 / +1 Query: 187 TWTPWPEASWSWASLAADTRSSYGSWQWMLSRR 89 +W + WSW +S Y W+W L RR Sbjct: 4099 SWR*YRSEGWSWC*RKCKCKSWYRCWRWYLGRR 4197 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -2 / +1 Query: 187 TWTPWPEASWSWASLAADTRSSYGSWQWMLSRR 89 +W + WSW +S Y W W L RR Sbjct: 2203 SWR*YRSEGWSWC*RECKCKSWYRCWCWYLGRR 2301
>LOC_Os01g29760:12001.t02660:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4616 Score = 33.1 bits (66), Expect = 2.1 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -2 / +2 Query: 460 IRHWRVHLPGAAMDGWMLDVSSTFLLSAPA*GLPCHRW 347 + HWR +L G W S FLL +P H W Sbjct: 2966 VHHWRAYLWGRTFTVWTNSYSLKFLLDQHLFTIPQHHW 3079
>LOC_Os01g17170:12001.t01564:unspliced-genomic magnesium-protoporphyrin IX monomethyl ester cyclase,chloroplast| precursor, putative, expressed Length = 2626 Score = 33.1 bits (66), Expect = 2.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 / +3 Query: 247 IPLHPSPCMSCSLKPPVSPRTWTPWPEASWS 155 IP H P L PP R T WP WS Sbjct: 27 IPAHHLPSPKTLLPPPAPARCLTKWPPPPWS 119
>LOC_Os02g04290:12002.t00328:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3024 Score = 26.7 bits (52), Expect(2) = 2.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +2 Query: 194 RDWWLQAARHAGG 232 R WW +AARH G Sbjct: 1982 RPWWRRAARHTAG 2020 Score = 23.5 bits (45), Expect(2) = 2.1 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 / +2 Query: 170 RPWRPSPGRDW 202 RPW P GR W Sbjct: 1856 RPWPPRTGRCW 1888
>LOC_Os12g43530:12012.t04021:unspliced-genomic no apical meristem protein| Length = 2031 Score = 25.4 bits (49), Expect(2) = 2.1 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 / -1 Query: 81 STSRLHGCCCCLPQKLSKFYSPMQ 10 + S +HGCCC L ++P++ Sbjct: 1608 ANSLVHGCCCRRRPALGVGHAPLE 1537 Score = 24.9 bits (48), Expect(2) = 2.1 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 / -2 Query: 190 RTWTPWPEASWSW 152 R W PWP + SW Sbjct: 1694 RWWWPWPSWTTSW 1656
>LOC_Os06g48880:12006.t04574:unspliced-genomic expressed protein| Length = 2216 Score = 31.8 bits (63), Expect(2) = 2.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 / +1 Query: 223 MSCSLKPPVSPRTWTPWPEASWS 155 +SCS+ PP P WP +SW+ Sbjct: 1045 VSCSIHPPSRPVEQPTWPPSSWT 1113 Score = 22.1 bits (42), Expect(2) = 2.3 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 / +3 Query: 390 FSSLLRREASLATGGALPHPKPLAVEALP 304 F+SLL REAS P +A ALP Sbjct: 42 FASLLPREASPNRRARATPPILIAPSALP 128
>LOC_Os07g12320:12007.t01104:unspliced-genomic small nucleolar ribonucleoprotein complex subunit, putative,| expressed Length = 2237 Score = 29.5 bits (58), Expect(2) = 2.3 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 / +2 Query: 375 RREASLATGGALPHPKPLAVEALPSL 298 R +L GGA P P PL +ALP L Sbjct: 104 RHLQALLPGGAEPRPPPLRPQALPPL 181 Score = 24.4 bits (47), Expect(2) = 2.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 / +1 Query: 205 PPVSPRTWTPWPEASWSWASLAADTRSS 122 PP + TP P A+ S +S A TRSS Sbjct: 499 PPRPASSATPSPAATRSTSSPPATTRSS 582
>LOC_Os05g11500:12005.t00982:unspliced-genomic hypothetical protein| Length = 774 Score = 25.8 bits (50), Expect(2) = 2.3 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +1 / -3 Query: 220 TCRGKGAVECEGCKGTGRNKKNGNIFERWKCFDCQGFG 333 TCRG + G G G + +RW+ QG G Sbjct: 370 TCRGVPEADARGAHGGGATSEAAARRQRWR*CQEQGPG 257 Score = 24.4 bits (47), Expect(2) = 2.3 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 / -3 Query: 354 WQGRPHAGAERRKVEE 401 W+GR H G R+V++ Sbjct: 214 WRGRWHRGGRHRRVDD 167
>LOC_Os03g53640:12003.t04684:unspliced-genomic expressed protein| Length = 1667 Score = 31.8 bits (63), Expect(2) = 2.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 / -2 Query: 235 PSPCMSCSLKPPVSPRTWTPWPEASWSWAS 146 P P + PP SP + TPW S +W+S Sbjct: 592 PPPATPGASAPPPSPPSGTPWATPSPTWSS 503 Score = 21.7 bits (41), Expect(2) = 2.4 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -3 / -2 Query: 72 RLHGCCCCL 46 R+ CCCCL Sbjct: 244 RMCCCCCCL 218
>LOC_Os12g39620:12012.t03641:unspliced-genomic disease resistance protein, putative, expressed| Length = 4844 Score = 32.2 bits (64), Expect(2) = 2.5 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -2 / -3 Query: 205 PPVSPRTWTPWPEASWSWASLAADTRSSYGSWQWMLSRRP 86 PP PWP + W WA+ G W+ + R P Sbjct: 885 PPCPWSVAYPWPSSPWPWAAEVVGGERRGGRWRGVEGRWP 766 Score = 22.6 bits (43), Expect(2) = 2.5 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / -2 Query: 627 PSQYVQKPVDFLTTFC 580 P V KPV +T FC Sbjct: 4039 PGTSVYKPVQVITLFC 3992
>LOC_Os04g39560:12004.t03525:unspliced-genomic expressed protein| Length = 6992 Score = 27.6 bits (54), Expect(2) = 2.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 / +3 Query: 428 CHGWMDA*CFFY 393 C GWMD CFF+ Sbjct: 663 CAGWMDLGCFFF 698 Score = 27.6 bits (54), Expect(2) = 2.5 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 / +3 Query: 111 GSGCSQGDQTSTSRLHGCCCC 49 G+G + T HGCCCC Sbjct: 804 GAGYAALSSTLGCLTHGCCCC 866
>LOC_Os11g34420:12011.t02995:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3224 Score = 27.6 bits (54), Expect(2) = 2.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / +1 Query: 194 RDWWLQAARHAGGRVQ 241 R WW +AARH G Q Sbjct: 1984 RPWWRRAARHTAGTPQ 2031 Score = 22.1 bits (42), Expect(2) = 2.8 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +2 / +1 Query: 131 CVGSQ*RPRPGCFRPWRPSPGRDW 202 C+ R R RPW P R W Sbjct: 1819 CLPLPHRARSPSCRPWPPQTPRCW 1890
>LOC_Os05g03860:12005.t00283:unspliced-genomic ocs element-binding factor 1, putative, expressed| Length = 1452 Score = 26.7 bits (52), Expect(2) = 2.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 / +1 Query: 192 PGLGRHGRKHPGLGRHWLPTQEAATVRG 109 P GR R+HPG R AA VRG Sbjct: 874 PPGGRRARRHPGDPRRPAAPPMAAAVRG 957 Score = 26.3 bits (51), Expect(2) = 2.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 / +3 Query: 238 HPSPCMSCSLKPPVSP 191 HPS C +L+PP SP Sbjct: 9 HPSNCAPYALEPPESP 56
>LOC_Os11g36760:12011.t03220:unspliced-genomic conserved hypothetical protein| Length = 2550 Score = 27.2 bits (53), Expect(2) = 2.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 / +2 Query: 184 WTPWPEASWS 155 WTPW ASWS Sbjct: 389 WTPWWRASWS 418 Score = 22.6 bits (43), Expect(2) = 2.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 / +3 Query: 168 KHPGLGRHWLPTQEAATVRGSG 103 +HPG+ R L + VRG G Sbjct: 417 RHPGVAREPLLRRRDPCVRGEG 482
>LOC_Os10g33710:12010.t02671:unspliced-genomic expressed protein| Length = 14840 Score = 32.7 bits (65), Expect = 2.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 / -1 Query: 247 IPLHPSPCMSCSLKPPVSPRTWTPWPEA 164 +P PS +SC L PP+ P W EA Sbjct: 13535 LPFDPSDSISCELSPPLPPSLSLKW*EA 13452
>LOC_Os09g25590:12009.t02238:unspliced-genomic tsi1-interacting protein TSIP1, putative, expressed| Length = 2399 Score = 32.7 bits (65), Expect = 2.9 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 / +2 Query: 214 CKTCRGKGAVECEGCKGTG 270 C +C+ G VEC+ C GTG Sbjct: 1616 CSSCQSAGHVECKWCTGTG 1672
>LOC_Os07g34740:12007.t03149:unspliced-genomic pre-rRNA processing protein ESF1, putative, expressed| Length = 5040 Score = 32.7 bits (65), Expect = 2.9 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -2 / -1 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYGS 113 P HPS SC PP T T P A W +S A + S S Sbjct: 333 PCHPSCGASCRACPPAPTTTRTSGPSACW*TSSRAPPSPPSAAS 202
>LOC_Os05g04070:12005.t04639:unspliced-genomic expressed protein| Length = 2588 Score = 32.7 bits (65), Expect = 2.9 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = +3 / -1 Query: 300 EMEVLRLPGVWDEEVPHLWQGRPHAGAERRKVEETSSIHPSMAAP 434 E E+ + G W P W GR G+ RR+ T P A P Sbjct: 413 EEELKKSLG*WSLSPPPSWHGRRRGGSRRRRRARTRGHPPPTATP 279
>LOC_Os04g43650:12004.t03905:unspliced-genomic L-allo-threonine aldolase, putative, expressed| Length = 4036 Score = 32.7 bits (65), Expect = 2.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 / +2 Query: 178 PWPEASWSWASLAADTRSSYGSWQWMLSR 92 PWP +W+ SLA + W+W SR Sbjct: 1529 PWPPRTWTTTSLAPTRPRTASRWRWRGSR 1615
>LOC_Os04g22580:12004.t01987:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3177 Score = 32.7 bits (65), Expect = 2.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 / -3 Query: 224 HVLQPEATSLAPDLDAMAGSILVLGVTGCRHKKQ 123 H + AT PD DA+ G L++ + GCR +Q Sbjct: 913 HTIDVPATFPTPDRDAVDGLPLIVSIPGCRR*RQ 812
>LOC_Os03g19410:12003.t01707:unspliced-genomic secreted protein, putative, expressed| Length = 7657 Score = 32.7 bits (65), Expect = 2.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 / -3 Query: 94 LRASTATNRSCFLCRQPVTPKTRMLPAMASK 186 +RA T S +LCR PV P+T+M+ K Sbjct: 5417 IRAETMHQTSSYLCRIPVLPETQMVSVSCCK 5325
>LOC_Os01g41790:12001.t03700:unspliced-genomic hypothetical protein| Length = 2307 Score = 32.7 bits (65), Expect = 2.9 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 / +3 Query: 164 CFRPWRPSPGRDWWLQAARHA 226 C PWR R WWL++A H+ Sbjct: 567 CGSPWRDDFSRRWWLRSADHS 629
>LOC_Os02g10800:12002.t00928:unspliced-genomic protein brittle-1, chloroplast precursor, putative, expressed| Length = 2250 Score = 26.3 bits (51), Expect(2) = 2.9 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = -2 / +3 Query: 247 IPLHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQWMLSR 92 +P PSP S PVSP P P +S AS + T++ Q + +R Sbjct: 900 LPRSPSPSPSSPAPSPVSPPPSAPTPWSSSRPASPSR*TQTHTNPHQNLQNR 1055 Score = 23.5 bits (45), Expect(2) = 2.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 / +1 Query: 365 PPLPQVGHFLIPNPWQSKHFHL 300 PPL +F NPW+ FHL Sbjct: 793 PPLCFSLNFS*SNPWRPAAFHL 858
>LOC_Os06g12190:12006.t01096:unspliced-genomic glutaredoxin, putative, expressed| Length = 1152 Score = 24.4 bits (47), Expect(3) = 3.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +1 / +1 Query: 316 DCQGFGMRKCPTCGKGGL 369 D G R+CP C + GL Sbjct: 1078 DEDGGAFRRCPECNENGL 1131 Score = 23.1 bits (44), Expect(3) = 3.1 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 / +2 Query: 149 RPRPGCFRPWRPSPGRDW 202 RPR C RP R G W Sbjct: 245 RPRRRCVRPRRLMCGSSW 298 Score = 22.1 bits (42), Expect(3) = 3.1 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +1 / +1 Query: 214 CKTCRGKGAVECEGCKGT 267 C C G V C+ C G+ Sbjct: 1003 CGGCGGVRFVPCDACSGS 1056
>LOC_Os09g36600:12009.t03136:unspliced-genomic nodulin-like protein, putative, expressed| Length = 3715 Score = 26.3 bits (51), Expect(3) = 3.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 / -2 Query: 192 PGLGRHGRKHPGLGR 148 PGL RH R+H G GR Sbjct: 1380 PGLPRHVRRHRGGGR 1336 Score = 23.5 bits (45), Expect(3) = 3.1 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 / -1 Query: 634 HPTQSIRAETS*FPHNIL 581 HP++ I+ +T FPH+ L Sbjct: 2269 HPSKGIKNQTLQFPHSQL 2216 Score = 23.1 bits (44), Expect(3) = 3.1 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = -3 / -1 Query: 72 RLHGCCCC 49 R GCCCC Sbjct: 538 RRSGCCCC 515
>LOC_Os03g22600:12003.t02010:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 2697 Score = 26.3 bits (51), Expect(3) = 3.2 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 / +2 Query: 399 LLPFSSLLRREASLATGGALPHPKPLAVEALP 304 LLP ++L R+ G PHP L E P Sbjct: 1091 LLPAAALRRQVQGAQAGDGHPHPHKLRPELAP 1186 Score = 23.1 bits (44), Expect(3) = 3.2 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = -2 / +1 Query: 235 PSPCMSCSLKPPVSPRTWTPWPEASW 158 P P + + P R+ PW SW Sbjct: 1213 PPPNAAAAAATPTPSRSSAPWWRPSW 1290 Score = 22.6 bits (43), Expect(3) = 3.2 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = -3 / +2 Query: 69 LHGCCCC 49 + GCCCC Sbjct: 2513 IFGCCCC 2533
>LOC_Os05g04914:12005.t00384:unspliced-genomic expressed protein| Length = 8082 Score = 27.2 bits (53), Expect(2) = 3.5 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -3 / -3 Query: 60 CCCCLPQKLSKFYSPMQCN 4 CCCC+P +L + + Q + Sbjct: 5014 CCCCVPLRLHQLFRRSQAS 4958 Score = 22.1 bits (42), Expect(2) = 3.5 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = -3 / -3 Query: 63 GCCCC 49 GCCCC Sbjct: 5026 GCCCC 5012
>LOC_Os08g44520:12008.t04176:unspliced-genomic peptidyl-prolyl cis-trans isomerase-like 1, putative, expressed| Length = 3794 Score = 29.5 bits (58), Expect(2) = 3.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 / +3 Query: 173 PWRPSPGRDWWLQAAR 220 PW PSP R WL +AR Sbjct: 1353 PWAPSPSRYHWLGSAR 1400 Score = 24.4 bits (47), Expect(2) = 3.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 / +2 Query: 277 KKNGNIFERWKCFDCQ 324 K+NGN WKC D Q Sbjct: 2840 KRNGNCQAPWKCPDRQ 2887
>LOC_Os05g30860:12005.t02685:unspliced-genomic expressed protein| Length = 3600 Score = 27.2 bits (53), Expect(2) = 3.7 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 / -2 Query: 102 CSQGDQTSTSRLHGCCCC 49 C G ++S S CCCC Sbjct: 2927 CRDGHRSSHSTTASCCCC 2874 Score = 22.1 bits (42), Expect(2) = 3.7 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -3 / -2 Query: 60 CCCCLPQ 40 CCCCL Q Sbjct: 2882 CCCCLLQ 2862
>LOC_Os05g31160:12005.t02712:unspliced-genomic peptide chain release factor 2, putative, expressed| Length = 3313 Score = 26.7 bits (52), Expect(2) = 3.7 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 / +2 Query: 273 EQEERQHLREMEVLRLPGVWD 335 E EE + +R+ EVLR +WD Sbjct: 737 EMEEARRIRQEEVLRGRNLWD 799 Score = 22.6 bits (43), Expect(2) = 3.7 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +1 / +1 Query: 217 KTCRGKGAVECEGCKGTGRNKKN 285 + CR G +C C G G + +N Sbjct: 691 RRCRCPGRNDCIQCTGDGGSAEN 759
>LOC_Os06g51510:12006.t04834:unspliced-genomic expressed protein| Length = 3026 Score = 27.2 bits (53), Expect(2) = 3.8 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +2 / +2 Query: 44 GKQQQQPWSLLVLVWSP*EHPLPRTVAASCVGSQ*RPRP 160 G+++ +PW + P PLP T S + RP P Sbjct: 107 GREEGRPWPPPLTPRPPRPPPLPSTTTPSSASTPPRPLP 223 Score = 22.1 bits (42), Expect(2) = 3.8 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 / +1 Query: 152 PRPGCFRPWRPSP 190 P P FRP PSP Sbjct: 250 PEPYAFRPDAPSP 288
>LOC_Os11g01730:12011.t00069:unspliced-genomic L-ascorbate oxidase precursor, putative| Length = 4510 Score = 32.2 bits (64), Expect = 3.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 / -2 Query: 590 QHSACFSNQLCVSPYSVFDICLAILVD 510 +H ACF +Q C+ +F C I +D Sbjct: 2136 EH*ACFQHQFCIGSMCMFKFCARIQID 2056
>LOC_Os06g01760:12006.t00072:unspliced-genomic aldehyde dehydrogenase, putative, expressed| Length = 2870 Score = 32.2 bits (64), Expect = 3.9 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 / +1 Query: 232 SPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYGS 113 SPC S + PRTW P + S + AA TR + G+ Sbjct: 1144 SPCSSTATPSSWGPRTWASGPSSIPSRRTAAAATRPAAGT 1263
>LOC_Os04g55260:12004.t04999:unspliced-genomic vacuolar membrane protein, putative, expressed| Length = 4994 Score = 32.2 bits (64), Expect = 3.9 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 / -1 Query: 196 SPRTWTPWPEASWSWASLAADTRSSYGS 113 +PR PWP A W W S A T G+ Sbjct: 4919 TPRCT*PWPGARWPWLSATARTTRPRGA 4836
>LOC_Os04g55250:12004.t04998:unspliced-genomic expressed protein| Length = 1463 Score = 32.2 bits (64), Expect = 3.9 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 / +1 Query: 196 SPRTWTPWPEASWSWASLAADTRSSYGS 113 +PR PWP A W W S A T G+ Sbjct: 76 TPRCT*PWPGARWPWLSATARTTRPRGA 159
>LOC_Os03g17700:12003.t01544:unspliced-genomic OsMPK3 - putative MAPK based on amino acid sequence homology,| expressed Length = 2774 Score = 32.2 bits (64), Expect = 3.9 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -2 / +1 Query: 220 SCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYGS 113 SC PP +P T P A+ SW+S A S G+ Sbjct: 1453 SCCSTPPTTPPPSTSGPSAASSWSSSTASRSSPAGT 1560
>LOC_Os03g16369:12003.t01420:unspliced-genomic serine/arginine repetitive matrix protein 1, putative, expressed| Length = 6567 Score = 32.2 bits (64), Expect = 3.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 / -2 Query: 202 PVSPRTWTPWPEASW 158 P S R W PWP +SW Sbjct: 3386 PASTRRWRPWPTSSW 3342
>LOC_Os02g47960:12002.t04380:unspliced-genomic hypothetical protein| Length = 1398 Score = 32.2 bits (64), Expect = 3.9 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -2 / -3 Query: 205 PPVSPRTWTPWPEASWSWASLAADTRSSYGSWQW 104 PP PR WP A+W AA S+ G W Sbjct: 364 PPPPPRAAGAWPPAAWRPGEAAATPSSTTGKPAW 263
>LOC_Os02g44000:12002.t03985:unspliced-genomic acetylglutamate kinase, putative, expressed| Length = 1330 Score = 32.2 bits (64), Expect = 3.9 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -2 / +3 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQWMLSRR 89 P S SC+ S R W + S + A+ TRS + SW+W S R Sbjct: 396 PASASAPCSCTAGARRSTRGWGASASSRSSGTASASRTRSPWRSWRWCSSAR 551
>LOC_Os02g43720:12002.t03956:unspliced-genomic methylglutaconyl-CoA hydratase, mitochondrial precursor, putative,| expressed Length = 3050 Score = 32.2 bits (64), Expect = 3.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 / -2 Query: 235 PSPCMSCSLKPPVSPRTWTPWPEAS 161 PSP S S P SP W WP A+ Sbjct: 406 PSPSRSRSATPGASPSRWRSWPPAA 332
>LOC_Os02g07980:12002.t00694:unspliced-genomic expressed protein| Length = 1645 Score = 32.2 bits (64), Expect = 3.9 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 / +1 Query: 228 PACLAA*SHQSRPGLGRHGRKHPGLGRHWLPTQEAATVR 112 PA + SRP R R P + W PT AAT R Sbjct: 304 PAARPSRRSPSRPRSSRSARSAPSVASSWPPTTSAATAR 420
>LOC_Os01g42280:12001.t03747:unspliced-genomic selenium-binding protein-like, putative, expressed| Length = 2555 Score = 32.2 bits (64), Expect = 3.9 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 / -1 Query: 205 PPVSPRTWTPWPEASWSWASLAADTRSSYGSWQ 107 PP +P W A+WS A A+ G W+ Sbjct: 137 PPPAPHCWESEASAAWSEAEAEAEASCGLGGWR 39
>LOC_Os01g14330:12001.t01291:unspliced-genomic conserved hypothetical protein| Length = 888 Score = 32.2 bits (64), Expect = 3.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 / -3 Query: 152 PRPGCFRPWRPSPGR 196 PRP +RPW P PGR Sbjct: 583 PRPALWRPWLPPPGR 539
>LOC_Os06g43384:12006.t04028:unspliced-genomic cytochrome P450 71D10, putative, expressed| Length = 4686 Score = 27.2 bits (53), Expect(2) = 4.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 / -3 Query: 321 PGVWDEEVPHLWQGRPHAGA 380 P W PH W+GR GA Sbjct: 487 PAAWRPPPPHGWRGRRRRGA 428 Score = 26.7 bits (52), Expect(2) = 4.3 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +3 / -1 Query: 171 GHGVQVRGETGGFRLQDMQGEGCSGMRRLQGDW 269 G Q R + GG + GC G R + G W Sbjct: 3591 GRHAQQRAKAGGRCAHTVARAGCGGERGIGGGW 3493
>LOC_Os05g29790:12005.t02579:unspliced-genomic papillar cell-specific pectin methylesterase-like protein, putative,| expressed Length = 3340 Score = 30.9 bits (61), Expect(2) = 4.3 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 / -1 Query: 235 PSPCMSCSLKPPVSPRTWTP 176 PS C SC+ PP SPRT P Sbjct: 1006 PS*CTSCAWAPPRSPRTRRP 947 Score = 22.6 bits (43), Expect(2) = 4.3 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = -2 / -1 Query: 184 WTPWPEASWSWASLAADTRSSYGSWQW 104 WTP P A W A ++ W+W Sbjct: 673 WTPSPWAPTPW*RGRARGCRAWCRWRW 593
>LOC_Os10g34670:12010.t02761:unspliced-genomic prefoldin subunit 5, putative, expressed| Length = 9856 Score = 25.8 bits (50), Expect(2) = 4.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 / -1 Query: 208 SGCKTCRGKGAVECEGCKG 264 SGC T R + A C C G Sbjct: 4639 SGCATRRRRSAAGCTACSG 4583 Score = 23.1 bits (44), Expect(2) = 4.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / -1 Query: 161 GCFRPWRPSPGRDW 202 GC RP P P R W Sbjct: 4729 GCRRPSPPPPPRRW 4688
>LOC_Os04g40100:12004.t03575:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 2627 Score = 27.6 bits (54), Expect(2) = 4.7 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 / -1 Query: 196 SPRTWTPWPEASWSWASLAADTRSS 122 +PR W P P AS S A A + SS Sbjct: 1937 APRAWKPSPRASCS*APCTASSSSS 1863 Score = 25.4 bits (49), Expect(2) = 4.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 / -1 Query: 244 PLHPSPCMSCSLKPPVSPRTWTP 176 P P P S S PP +PR P Sbjct: 2243 PRRPPPPASSSASPPSTPRASAP 2175
>LOC_Os09g39190:12009.t03385:unspliced-genomic copine family protein, expressed| Length = 5406 Score = 26.3 bits (51), Expect(2) = 4.8 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 / -3 Query: 152 PRPGCFRPWRPSPG 193 PRP RPWR PG Sbjct: 1078 PRPAARRPWRG*PG 1037 Score = 22.6 bits (43), Expect(2) = 4.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 / -2 Query: 83 VWSP*EHPLPR 115 +W+ * HPLPR Sbjct: 1112 LWTK*AHPLPR 1080 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 / +2 Query: 190 RTWTPWPEASWSWASLAADTRSSYG 116 R+ +PW SW+WA+ A SS G Sbjct: 1040 RSASPWTPRSWAWAAAAGAPTSSTG 1114
>LOC_Os02g44740:12002.t04064:unspliced-genomic expressed protein| Length = 5246 Score = 24.4 bits (47), Expect(2) = 4.8 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 / +2 Query: 458 TTLESASAWCCHGW 417 TT SA WC GW Sbjct: 4448 TTAASAPRWCPSGW 4489 Score = 24.4 bits (47), Expect(2) = 4.8 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 / +3 Query: 372 REASLATGGALPHPKP 325 R+ L GA PHP+P Sbjct: 4479 RQDGLRAAGARPHPRP 4526
>LOC_Os02g44730:12002.t04063:unspliced-genomic tetracycline transporter protein, putative, expressed| Length = 2913 Score = 24.4 bits (47), Expect(2) = 5.1 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 / -3 Query: 458 TTLESASAWCCHGW 417 TT SA WC GW Sbjct: 2797 TTAASAPRWCPSGW 2756 Score = 24.4 bits (47), Expect(2) = 5.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 / -1 Query: 372 REASLATGGALPHPKP 325 R+ L GA PHP+P Sbjct: 2766 RQDGLRAAGARPHPRP 2719
>LOC_Os11g35030:12011.t03052:unspliced-genomic expressed protein| Length = 3601 Score = 25.4 bits (49), Expect(3) = 5.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 / -1 Query: 431 CCHGWMDA*CFFYLSPLCSGVRPPLP 354 C + +D L PLC G RPP P Sbjct: 1243 CSNVLVDQCLVLQLHPLCWGERPPDP 1166 Score = 24.4 bits (47), Expect(3) = 5.1 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -3 / -2 Query: 84 TSTSRLHGCCCC 49 +ST+++ CCCC Sbjct: 969 SSTTQVGACCCC 934 Score = 22.1 bits (42), Expect(3) = 5.1 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -3 / -2 Query: 600 DFLTTFCLFL 571 DF T++CLFL Sbjct: 2997 DFRTSYCLFL 2968
>LOC_Os08g12300:12008.t01110:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 8191 Score = 29.0 bits (57), Expect(2) = 5.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 / -3 Query: 224 HVLQPEATSLAPDLDAMAGSILVLGVTGCR 135 H + AT PD DA G L++ GCR Sbjct: 6431 HTIDVPATFPTPDRDAADGLPLIVSTPGCR 6342 Score = 25.4 bits (49), Expect(2) = 5.2 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -3 / -1 Query: 66 HGCCCCLPQ 40 HGCC C PQ Sbjct: 2218 HGCCGCCPQ 2192
>LOC_Os05g32220:12005.t02818:unspliced-genomic 50S ribosomal protein L1, putative, expressed| Length = 4135 Score = 26.7 bits (52), Expect(2) = 5.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 / +2 Query: 345 ALPHPKPLAVEALPS 301 A+PHP+P+A LP+ Sbjct: 173 AVPHPRPVAARLLPA 217 Score = 26.7 bits (52), Expect(2) = 5.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 / +3 Query: 72 RLHGCCCCLPQKLSKF 25 +LHGCCC + +S F Sbjct: 3456 KLHGCCCKISAPISIF 3503
>LOC_Os12g41800:12012.t03856:unspliced-genomic VTC2, putative, expressed| Length = 4123 Score = 31.8 bits (63), Expect = 5.4 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -1 / +1 Query: 560 CVSPYSVFDICLAILVDTYF*IVVRIRAELSMINTTLESASAWCCHGWM 414 C+ S+F++CL + V YF ++ +R +NT + S + +G M Sbjct: 3046 CLQHISIFNLCLLLFVIFYFNLL*YVRL*TVHLNTAMISCTVCLLNGLM 3192
>LOC_Os12g38900:12012.t03570:unspliced-genomic chorismate mutase, chloroplast precursor, putative, expressed| Length = 4462 Score = 31.8 bits (63), Expect = 5.4 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +1 / -2 Query: 148 TPKTRMLPAMASKSGARLVASGCKTCRGKGAVECEGCKGTGR 273 TP T P + GAR+ SG + C G+ +E E G GR Sbjct: 156 TPGTGSPPPPPQRRGARVGWSGPRPCPGEAPLEAEEEAGGGR 31
>LOC_Os11g39020:12011.t03445:unspliced-genomic expressed protein| Length = 3966 Score = 31.8 bits (63), Expect = 5.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -2 / +3 Query: 193 PRTWTPWPEASWSWASLAADTRSSYGSWQWMLSR 92 PRTWT W +S S + R+S W SR Sbjct: 717 PRTWTSWGASSTSSTCCSGGRRTSTSGWSRSRSR 818
>LOC_Os11g32180:12011.t02815:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6855 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 / +3 Query: 169 PAMASKSGARLVASGCKTCRGKGAVECEGCKGTGRNKKN 285 PA + KS +++ A + G ++C C+G G +K+ Sbjct: 2817 PAESGKSSSQVPAKSASSVASTGRIQCHHCQGFGHVQKD 2933
>LOC_Os11g03100:12011.t00201:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3302 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + QA RHAGG Sbjct: 2148 PWRSPPAPSYGFQAPRHAGG 2089
>LOC_Os10g39140:12010.t03156:unspliced-genomic gibberellin 20 oxidase 2, putative, expressed| Length = 5866 Score = 31.8 bits (63), Expect = 5.4 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -2 / +1 Query: 205 PPVSPRTWTPWPEASWSWASLAADTRSS 122 P SPRT TP P S SW + + RSS Sbjct: 4399 PMASPRTPTPTPSPSSSWTTRSPACRSS 4482
>LOC_Os10g33290:12010.t02630:unspliced-genomic NPGR2, putative, expressed| Length = 6423 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 / -1 Query: 404 CFFYLSPLCSGVRPPLPQVGHFLIP 330 C LS +C+ RPP+P + +LIP Sbjct: 5961 CLLQLSGICTNHRPPIPILLRYLIP 5887
>LOC_Os10g30650:12010.t02397:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3273 Score = 31.8 bits (63), Expect = 5.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 / +2 Query: 214 SLKPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQWMLS 95 S +P PR +P S SW + T +S W+WM S Sbjct: 2975 SRRPSSHPRGTSPKERWSSSWRATRPGTPTSLRGWRWMSS 3094
>LOC_Os09g23780:12009.t02061:unspliced-genomic expressed protein| Length = 1110 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = -2 / +2 Query: 190 RTWTPWPEASWSWASLAADTRSSYGSWQWMLSRR 89 RTW W W + AA R W+W + R Sbjct: 455 RTWRRWCRRRGRWPAAAASRRGGRRPWRWAWTAR 556
>LOC_Os08g45030:12008.t04224:unspliced-genomic multidrug resistance protein 1, putative, expressed| Length = 5864 Score = 31.8 bits (63), Expect = 5.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 / -2 Query: 146 *RPRPGCFRPWRPSPGRDWWLQAARHAGGRVQW 244 *R R G +RPWRP P W + + AG W Sbjct: 2008 *R*RSGRWRPWRPPPTPPAWRRPSPAAGSPGWW 1910
>LOC_Os08g44870:12008.t04260:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 2051 Score = 31.8 bits (63), Expect = 5.4 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = -2 / +2 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQW 104 P PSP + PP S T P WAS + S SW W Sbjct: 167 PSAPSPTTPSAP*PPCSSATSETSPSPPPPWASPCSPPSPSASSWAW 307
>LOC_Os08g40390:12008.t03770:unspliced-genomic flavonol sulfotransferase-like, putative| Length = 976 Score = 31.8 bits (63), Expect = 5.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 / -1 Query: 170 RPWRPSPGRDWWLQAARHAGG 232 RPW P GR +A RHAGG Sbjct: 514 RPWAPGRGRRCGSRARRHAGG 452
>LOC_Os08g32470:12008.t02992:unspliced-genomic hypothetical protein| Length = 1029 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 / -3 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWP 170 PL P C + L P+SP W P P Sbjct: 274 PLPPLACYATPLHSPISPELWLPIP 200
>LOC_Os07g33250:12007.t03005:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3272 Score = 31.8 bits (63), Expect = 5.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 / +1 Query: 214 SLKPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQWMLS 95 S +P PR +P S SW + T +S W+WM S Sbjct: 2974 SRRPSSHPRGTSPKERWSSSWRATRPGTPTSLRGWRWMSS 3093
>LOC_Os07g24850:12007.t02181:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3420 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 / +3 Query: 169 PAMASKSGARLVASGCKTCRGKGAVECEGCKGTGRNKKN 285 PA +SK +++ A + G ++C C+G G +K+ Sbjct: 882 PAESSKGSSQVPAKSASSVTSTGRIQCHRCQGFGHVQKD 998
>LOC_Os06g32800:12006.t02977:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2621 Score = 31.8 bits (63), Expect = 5.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 / +1 Query: 214 SLKPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQWMLS 95 S +P PR +P S SW + T +S W+WM S Sbjct: 2323 SRRPSSHPRGTSPKERWSSSWRATRPGTPTSLRGWRWMSS 2442
>LOC_Os06g05790:12006.t00465:unspliced-genomic transferase, putative, expressed| Length = 3394 Score = 31.8 bits (63), Expect = 5.4 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 / +1 Query: 187 TWTPWPEASWSWASLAADTRSSYGSWQWMLSRR 89 TW PWP + S + TRSS+ W RR Sbjct: 1072 TWRPWPARPSARCSGRSGTRSSWTGWSSARRRR 1170
>LOC_Os05g25310:12005.t02187:unspliced-genomic acyl-CoA synthetase long-chain family member 3, putative, expressed| Length = 13075 Score = 31.8 bits (63), Expect = 5.4 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 / +1 Query: 616 VLTGLDAFESICCKYFLFSEYIQFV 690 VL GL A S CC+ FLFS ++ +V Sbjct: 10750 VLVGLLASISFCCEIFLFSYHVVYV 10824
>LOC_Os04g53880:12004.t04861:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4026 Score = 31.8 bits (63), Expect = 5.4 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -2 / +2 Query: 214 SLKPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQWMLS 95 S +P PR +P S SW + T +S W+WM S Sbjct: 3728 SRRPSSHPRGTSPKERWSSSWRATRPGTPTSLRGWRWMSS 3847
>LOC_Os03g29940:12003.t02604:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6627 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 / +2 Query: 169 PAMASKSGARLVASGCKTCRGKGAVECEGCKGTGRNKKN 285 PA + KS +++ A + G ++C C+G G +K+ Sbjct: 2585 PAESGKSSSQVPAKSASSVASTGRIQCHRCQGFGHVQKD 2701
>LOC_Os03g17990:12003.t01573:unspliced-genomic protein YIP1, putative, expressed| Length = 3261 Score = 31.8 bits (63), Expect = 5.4 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -2 / -2 Query: 208 KPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQW 104 +PP + T +PWP W A S G W W Sbjct: 191 RPPAARGTPSPWPPRRWRRRRAATARVSRSGWWWW 87
>LOC_Os03g12080:12003.t01007:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1794 Score = 31.8 bits (63), Expect = 5.4 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = +1 / +1 Query: 226 RGKGAVECEGCKGTGRNKKNGNIFERWKCFDCQGFGMRKCPTCGKGG 366 RG+G E +G GR G ERW G G C GG Sbjct: 1525 RGRGDPERQGLGLGGRTAARGRSGERWAAVTMVGAGAAMLGRCDDGG 1665
>LOC_Os02g56660:12002.t05238:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3419 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + QA RHAGG Sbjct: 2265 PWRSPPAPSYGFQAPRHAGG 2206
>LOC_Os02g46220:12002.t04209:unspliced-genomic S-ribonuclease binding protein SBP1, putative, expressed| Length = 1814 Score = 31.8 bits (63), Expect = 5.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 161 GCFRPWRPSPGRDWWLQAARHAGGR 235 G F PWR P R W +AA+ GR Sbjct: 927 GSFFPWRDVPARSWTGRAAQAGDGR 1001
>LOC_Os02g44060:12002.t03991:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3245 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + QA RHAGG Sbjct: 2109 PWRSPPAPSYGFQAPRHAGG 2050
>LOC_Os02g16540:12002.t01447:unspliced-genomic OsWRKY39v2 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2356 Score = 31.8 bits (63), Expect = 5.4 Identities = 13/39 (33%), Positives = 17/39 (43%) Frame = -2 / -3 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTR 128 P PSPC + PP P PW ++ W+ A R Sbjct: 1634 PRRPSPCPPRAALPPPPPPRPPPWTASAAVWSGRAPPPR 1518
>LOC_Os01g57900:12001.t05191:unspliced-genomic expressed protein| Length = 2358 Score = 31.8 bits (63), Expect = 5.4 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -2 / +2 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYGS 113 P PC SL+ P P PWP + A+ AA S G+ Sbjct: 437 PSRRPPCRPSSLRSPQRPPPLRPWPSCALCCAAGAASRLSLSGA 568
>LOC_Os01g12070:12001.t01075:unspliced-genomic endoglucanase 1 precursor, putative, expressed| Length = 3470 Score = 31.8 bits (63), Expect = 5.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 / +3 Query: 152 PRPGCFRPWRPSPGRDWWLQAARH 223 PRP RPWRP P W + + R+ Sbjct: 2292 PRPSRRRPWRPRPRPAWPVTSTRY 2363
>LOC_Os08g39430:12008.t03675:unspliced-genomic thylakoid lumenal 19 kDa protein, chloroplast precursor, putative,| expressed Length = 1038 Score = 24.4 bits (47), Expect(2) = 5.5 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -2 / -2 Query: 229 PCMSCSLKPPVSPRTWTPWP 170 PC S PP P PWP Sbjct: 296 PCRSTP*TPPPRPPPPPPWP 237 Score = 24.4 bits (47), Expect(2) = 5.5 Identities = 8/25 (32%), Positives = 9/25 (36%) Frame = -2 / -2 Query: 160 WSWASLAADTRSSYGSWQWMLSRRP 86 W W G+W W S RP Sbjct: 137 WWWWEEGKGRGGRRGAWPWSTSERP 63
>LOC_Os02g32320:12002.t02875:unspliced-genomic hypothetical protein| Length = 612 Score = 29.0 bits (57), Expect(2) = 5.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 / +2 Query: 220 SCSLKPPVSPRTWTPWPEASWS 155 SC + P SP +W WP A S Sbjct: 95 SCGPRRPCSPPSWWSWPSAGSS 160 Score = 21.7 bits (41), Expect(2) = 5.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 / +3 Query: 126 AATVRGSGCSQGD 88 AAT+RGS +GD Sbjct: 333 AATLRGSQAGEGD 371
>LOC_Os04g20990:12004.t01833:unspliced-genomic tRNA-dihydrouridine synthase A, putative, expressed| Length = 13827 Score = 28.6 bits (56), Expect(2) = 6.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 / -1 Query: 135 TQEAATVRGSGCSQGDQTSTSRLHGCCCC 49 T + A +RG+ +G + R CCCC Sbjct: 3963 TSDMAHLRGAAAWRGGRERGRRSSRCCCC 3877 Score = 26.3 bits (51), Expect(2) = 6.0 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 / -3 Query: 374 GVRPPLPQVGHFLIPNPWQSKH 309 G+RPP+ +P+PW + H Sbjct: 5107 GLRPPVEGEDSPFLPSPWLASH 5042
>LOC_Os04g29240:12004.t02617:unspliced-genomic hypothetical protein| Length = 294 Score = 24.4 bits (47), Expect(2) = 6.0 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 / -1 Query: 366 ASLATGGALPHPKPLAVEALPS 301 ASLA LPH P +E PS Sbjct: 279 ASLARFRPLPHRLPAGIELAPS 214 Score = 24.0 bits (46), Expect(2) = 6.0 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = -2 / -3 Query: 235 PSPCMSCSLKPPVSPRTWTPWPEASW 158 P P + + PP SP P P W Sbjct: 163 PGPSPAPASPPPASPHRRRPRPPPRW 86
>LOC_Os07g38820:12007.t03546:unspliced-genomic lectin-like receptor kinase 7, putative| Length = 2512 Score = 30.9 bits (61), Expect(2) = 6.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 / +3 Query: 235 PSPCMSCSLKPPVSPRTW 182 PSP CS KP SPR+W Sbjct: 1137 PSPRSLCSPKPSTSPRSW 1190 Score = 21.7 bits (41), Expect(2) = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 / +3 Query: 151 ASLAADTRSSYGSW 110 AS +DT +S GSW Sbjct: 1674 ASAVSDTGTSCGSW 1715
>LOC_Os09g27240:12009.t02403:unspliced-genomic mitochondrial carrier-like protein, putative, expressed| Length = 3386 Score = 24.0 bits (46), Expect(3) = 6.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 / -2 Query: 479 AELSMINTTLESASAWC 429 A L + + TL SAS+WC Sbjct: 3373 AHLELESETLLSASSWC 3323 Score = 24.0 bits (46), Expect(3) = 6.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 / -2 Query: 423 WMDGCLMFLLPFSSLLRREASLATGGALPHPK 328 WM MF LPFS+ + ++ HPK Sbjct: 1888 WMATLNMFTLPFSNKAASLQII*LNNSICHPK 1793 Score = 23.5 bits (45), Expect(3) = 6.1 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -2 / -1 Query: 247 IPLHPSPCMSCSLKPPVSPRTWTPWPEASWS 155 +P+HP S PP S R ASWS Sbjct: 1226 LPIHPP*SASSPSSPP*SARRLPHP*PASWS 1134
>LOC_Os02g50860:12002.t04670:unspliced-genomic rac-like GTP-binding protein 3, putative, expressed| Length = 3732 Score = 26.7 bits (52), Expect(2) = 6.4 Identities = 8/17 (47%), Positives = 14/17 (82%) Frame = +2 / +1 Query: 635 LLNLYVVSIFCFLNIFS 685 +L++Y+ +FCFLN+ S Sbjct: 3166 MLDVYLYVLFCFLNLIS 3216 Score = 26.3 bits (51), Expect(2) = 6.4 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 / +1 Query: 164 CFRPWRPSP 190 C RPWRP+P Sbjct: 235 CVRPWRPAP 261
>LOC_Os02g37654:12002.t03402:unspliced-genomic 1-O-acylceramide synthase precursor, putative, expressed| Length = 10594 Score = 30.9 bits (61), Expect(2) = 6.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 / -1 Query: 159 GLGRHWLPTQEAATVRGSGCSQ 94 G+GR WL Q + +RGSG S+ Sbjct: 196 GVGRRWLGAQRWSRIRGSGSSR 131 Score = 23.5 bits (45), Expect(2) = 6.4 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -3 / -2 Query: 471 EHDKYDIGECICLVLPWMDGCLMFLLPFSSLLRREASLATGGA 343 E K G ++ P + LMF + L +SLATG A Sbjct: 6474 EFSKI*RGTTYTVINPSYENYLMFKIKLDQYLLIPSSLATGDA 6346
>LOC_Os03g19200:12003.t01686:unspliced-genomic heat shock protein binding protein, putative, expressed| Length = 3519 Score = 24.9 bits (48), Expect(3) = 6.5 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -2 / -2 Query: 247 IPLHPSPCMSCSLKPPVSPRTWTPWPEASWS 155 +PL P P L P W+ W SW+ Sbjct: 2816 LPLLPLPWARSLLPWTSPPSPWSSWSLPSWT 2724 Score = 23.5 bits (45), Expect(3) = 6.5 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -3 / -3 Query: 90 DQTSTSRLHGCCCC 49 D+ S GCCCC Sbjct: 2578 DRQSRRCSRGCCCC 2537 Score = 23.1 bits (44), Expect(3) = 6.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 / -3 Query: 376 PA*GLPCHRW 347 PA G PCH W Sbjct: 3022 PADGSPCHGW 2993
>LOC_Os11g07650:12011.t00656:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 4908 Score = 25.4 bits (49), Expect(2) = 6.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 / +2 Query: 105 GCSQGDQTSTSRLHGCCC 52 G DQ ++S H CCC Sbjct: 4421 GLFPSDQHASSAQHSCCC 4474 Score = 23.1 bits (44), Expect(2) = 6.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -3 / +2 Query: 57 CCCLPQKLS 31 CCC QKLS Sbjct: 4466 CCCFSQKLS 4492
>LOC_Os01g13350:12001.t01197:unspliced-genomic 25.3 kDa vesicle transport protein, putative, expressed| Length = 4816 Score = 24.9 bits (48), Expect(2) = 6.5 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -3 / +3 Query: 135 TQEAATVRGSGCSQGDQTSTSRLHGCCCC 49 T+ T+ + S+ + + GCCCC Sbjct: 4635 TRSTVTLPLTTSSESTSITAAAAAGCCCC 4721 Score = 23.5 bits (45), Expect(2) = 6.5 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 / +1 Query: 208 KPPVSPRTWTPWP 170 +PP R TPWP Sbjct: 4576 RPPARRRRGTPWP 4614
>LOC_Os10g08620:12010.t00682:unspliced-genomic chalcone synthase 8, putative| Length = 1977 Score = 29.0 bits (57), Expect(2) = 6.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 / -2 Query: 66 HGCCCCLPQKLSKFYSPMQC 7 HGC C LP LS+ P C Sbjct: 1760 HGCNCSLPSMLSRIARPPGC 1701 Score = 23.1 bits (44), Expect(2) = 6.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 / -3 Query: 414 GCLMFLLPFSSLLRREASLATGGALPHPKP 325 GC L SL++R ASL A+ H +P Sbjct: 1948 GCA*QLSQL*SLVQRPASLPIHAAVTHLRP 1859
>LOC_Os01g61080:12001.t05488:unspliced-genomic OsWRKY24 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2668 Score = 25.8 bits (50), Expect(2) = 6.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -3 / -1 Query: 66 HGCCCC 49 HGCCCC Sbjct: 955 HGCCCC 938 Score = 22.6 bits (43), Expect(2) = 6.8 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -2 / -2 Query: 244 PLHPSPCMSCSLKPPVSPRTWTPWP 170 P+ PSP S P S W P P Sbjct: 1056 PVAPSPTRSPGTAPHRSSPRWHPRP 982
>LOC_Os04g42650:12004.t03812:unspliced-genomic expressed protein| Length = 2246 Score = 25.4 bits (49), Expect(2) = 6.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 / +1 Query: 159 GLGRHWLPTQEAATVRGSGCSQGDQTSTSRLHG 61 G R W T AT RGS T+TS G Sbjct: 1729 GCARRWCSTSTTATSRGSRTR*TGTTTTSGAPG 1827 Score = 23.1 bits (44), Expect(2) = 6.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 / +2 Query: 177 HGRKHPGLGRHWL 139 HG +HPG +H L Sbjct: 1571 HGHRHPGRQQHHL 1609
>LOC_Os01g13340:12001.t01196:unspliced-genomic harpin-induced protein, putative, expressed| Length = 1646 Score = 24.9 bits (48), Expect(2) = 7.1 Identities = 8/29 (27%), Positives = 14/29 (48%) Frame = -3 / -3 Query: 135 TQEAATVRGSGCSQGDQTSTSRLHGCCCC 49 T+ T+ + S+ + + GCCCC Sbjct: 720 TRSTVTLPLTTSSESTSITAAAAAGCCCC 634 Score = 23.5 bits (45), Expect(2) = 7.1 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 / -1 Query: 208 KPPVSPRTWTPWP 170 +PP R TPWP Sbjct: 779 RPPARRRRGTPWP 741
>LOC_Os06g35970:12006.t03294:unspliced-genomic meiosis 5, putative, expressed| Length = 1588 Score = 24.4 bits (47), Expect(2) = 7.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 / +3 Query: 381 LLRREASLATGGALPHPKPLAVEALP 304 LLR +A+ A G A+ HP+ L P Sbjct: 897 LLREQAADAAGRAVQHPQGLLRRPAP 974 Score = 24.0 bits (46), Expect(2) = 7.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 / +2 Query: 193 PRTWTPWPEAS 161 PRT TPWP S Sbjct: 986 PRTSTPWPPRS 1018
>LOC_Os12g18374:12012.t01687:unspliced-genomic NB-ARC domain containing protein, expressed| Length = 9332 Score = 31.3 bits (62), Expect = 7.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 / +2 Query: 208 KPPVSPRTWTPWPEASWSW 152 +PP+ PR PW A+W W Sbjct: 5804 QPPLHPRPDPPWGSATWVW 5860
>LOC_Os12g01170:12012.t00016:unspliced-genomic tonneau 1b, putative, expressed| Length = 3359 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 / +3 Query: 611 RNQLISSQHSACFSNQLCVSPYSVFDICLAIL 516 R +++S H+ C + +PY FD C IL Sbjct: 3030 RRRMLSVDHAYCTPSSFVYAPYMGFDFCWTIL 3125
>LOC_Os11g01170:12011.t00017:unspliced-genomic tonneau 1b, putative, expressed| Length = 3354 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 / +3 Query: 611 RNQLISSQHSACFSNQLCVSPYSVFDICLAIL 516 R +++S H+ C + +PY FD C IL Sbjct: 3039 RRRMLSVDHAYCTPSSFVYAPYMGFDFCWTIL 3134
>LOC_Os10g38670:12010.t03107:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1257 Score = 31.3 bits (62), Expect = 7.4 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = -2 / +3 Query: 238 HPSPCMSCSLKPPVSPRTWTPWPEASWSWASLAADTRSSYG 116 HP C + S P R W P AS W RSS G Sbjct: 717 HPRRCPASSCSIPPRRRFWRPGRSASSRWTRRRRPCRSSAG 839
>LOC_Os10g35400:12010.t02835:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3116 Score = 31.3 bits (62), Expect = 7.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + LQA RHAGG Sbjct: 2148 PWRFPPTPSYGLQAPRHAGG 2089
>LOC_Os10g32400:12010.t02553:unspliced-genomic oxygen evolving enhancer protein, putative, expressed| Length = 8244 Score = 31.3 bits (62), Expect = 7.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 / +3 Query: 135 TQEAATVRGSGCSQGDQTSTSRLHGC 58 + E ATVR GCS ++ +T R GC Sbjct: 2442 SMEGATVRCRGCSTSEERATMRGRGC 2519
>LOC_Os10g32348:12010.t02548:unspliced-genomic psbP family protein, expressed| Length = 15197 Score = 31.3 bits (62), Expect = 7.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 / +3 Query: 135 TQEAATVRGSGCSQGDQTSTSRLHGC 58 + E ATVR GCS ++ +T R GC Sbjct: 9402 SMEGATVRCRGCSTSEERATMRGRGC 9479
>LOC_Os10g21110:12010.t01602:unspliced-genomic 1,4-beta-xylanase, putative, expressed| Length = 3613 Score = 31.3 bits (62), Expect = 7.4 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -3 / -2 Query: 159 GLGRHWLPTQEAATVRGSGCSQGDQTSTSRLHGCCC 52 G GRH P AA R Q T+ +R H C C Sbjct: 1254 GAGRHLQPRCGAAARRRGAARQTTGTTHARTHACIC 1147
>LOC_Os07g37890:12007.t03457:unspliced-genomic catalytic/ protein phosphatase type 2C, putative, expressed| Length = 5521 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +1 / +1 Query: 178 ASKSGARLVASGCKTCRGKGAVECEGCKGTGR 273 A + G+R +GC CR + GC+ T R Sbjct: 1417 AKRRGSRSAGAGCSRCRTSRRCQGSGCRSTTR 1512
>LOC_Os06g45710:12006.t04259:unspliced-genomic phosphoglycerate kinase, cytosolic, putative, expressed| Length = 3438 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGGR 235 PWRPSP R W + R G R Sbjct: 376 PWRPSPSRT*WWEPTRGCGCR 314
>LOC_Os06g28090:12006.t02513:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3260 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + QA RHAGG Sbjct: 2106 PWRSPPAPSYEFQAPRHAGG 2047
>LOC_Os06g14150:12006.t01290:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3419 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + QA RHAGG Sbjct: 2265 PWRSLPAPSYGFQAPRHAGG 2206
>LOC_Os06g06840:12006.t00568:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3249 Score = 31.3 bits (62), Expect = 7.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 / -1 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + LQA RHAGG Sbjct: 2097 PWRFPPTPSYGLQAPRHAGG 2038
>LOC_Os06g05840:12006.t00470:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3302 Score = 31.3 bits (62), Expect = 7.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + LQA RHAGG Sbjct: 2148 PWRFPPTPSYGLQAPRHAGG 2089
>LOC_Os06g05030:12006.t00392:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3260 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + QA RHAGG Sbjct: 2106 PWRSPPAPSYEFQAPRHAGG 2047
>LOC_Os04g54630:12004.t04935:unspliced-genomic SEP2, putative, expressed| Length = 1341 Score = 31.3 bits (62), Expect = 7.4 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 / +1 Query: 149 RPRPGCFRPWRPSPGR 196 R RPGC PW P+P R Sbjct: 580 RRRPGCASPWSPAPPR 627
>LOC_Os04g49940:12004.t05476:unspliced-genomic expressed protein| Length = 1795 Score = 31.3 bits (62), Expect = 7.4 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 / +3 Query: 214 CKTCRGKGAVECEGCKGTG 270 C CRG G ++C C G G Sbjct: 1155 CTICRGTGKIDCRNCFGRG 1211
>LOC_Os04g23510:12004.t02075:unspliced-genomic conserved hypothetical protein| Length = 360 Score = 31.3 bits (62), Expect = 7.4 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 / +1 Query: 181 SKSGARLVASGCKTCRGKGAVECEGCKGTGRNKKNGNIFERWK 309 + SG R G C G GA+E G G R K G++ E ++ Sbjct: 124 ASSGQRSGKGGGGGCSGVGAIEGTGGSGGKRKKMEGSVGELYR 252
>LOC_Os04g03550:12004.t00244:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3292 Score = 31.3 bits (62), Expect = 7.4 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 / -3 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR P + LQA RHAGG Sbjct: 2138 PWRFPPTPSYGLQAPRHAGG 2079
>LOC_Os03g52890:12003.t04611:unspliced-genomic hypothetical protein| Length = 396 Score = 31.3 bits (62), Expect = 7.4 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 / +2 Query: 428 CHGWMDA*CFFYLSPLCSGVRPPLPQVGHFLIPNPW 321 C W + FF+ SP + RPP P + + +PW Sbjct: 146 CMTWSEISRFFFFSPQQTA*RPPSPSLPIWRCHSPW 253
>LOC_Os03g27270:12003.t02403:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 663 Score = 31.3 bits (62), Expect = 7.4 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / -3 Query: 152 PRPGCFRPWRPS 187 PRP C RPWRP+ Sbjct: 436 PRPACARPWRPA 401
>LOC_Os03g14040:12003.t01196:unspliced-genomic expressed protein| Length = 3011 Score = 31.3 bits (62), Expect = 7.4 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 / +3 Query: 259 KGTGRNKKNGNIFERWKCFDCQGFGMRKCPTCGKGGLTPEQRGER 393 KGT G E C +C G G C TC G+ P R Sbjct: 1041 KGTVTVVIGGGETEVSNCVNCDGVGSLTCTTCQGSGIQPRYLDRR 1175
>LOC_Os02g52610:12002.t04842:unspliced-genomic galactoside 2-alpha-L-fucosyltransferase, putative, expressed| Length = 8077 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 / -1 Query: 195 RPGLGRHGRKHPGLG 151 RP LGRHGR+ PG G Sbjct: 2287 RPPLGRHGRRRPGHG 2243
>LOC_Os02g50880:12002.t04672:unspliced-genomic protease Do-like 9, putative, expressed| Length = 5027 Score = 31.3 bits (62), Expect = 7.4 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +2 / +3 Query: 137 GSQ*RPRPGCFRPWRPSPGRDWWLQAARHAGGR 235 G + RP G PWR G WW + AG R Sbjct: 228 GRRPRPAAGRRSPWRMEEGTRWWRRGDPWAGTR 326
>LOC_Os02g29510:12002.t02644:unspliced-genomic non-imprinted in Prader-Willi/Angelman syndrome region protein 1,| putative, expressed Length = 11896 Score = 31.3 bits (62), Expect = 7.4 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 / -3 Query: 135 TQEAATVRGSGCSQGDQTSTS 73 ++E ATVRG GCS D+ +T+ Sbjct: 5159 SEEGATVRGRGCSTSDEGATA 5097
>LOC_Os02g14800:12002.t01274:unspliced-genomic expressed protein| Length = 13762 Score = 31.3 bits (62), Expect = 7.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 / +3 Query: 249 RRLQGDWQEQEERQHLRE 302 R + GDW++QE+RQH E Sbjct: 3606 RFINGDWEQQEQRQHRPE 3659
>LOC_Os01g46260:12001.t04077:unspliced-genomic expressed protein| Length = 1000 Score = 31.3 bits (62), Expect = 7.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 / +3 Query: 78 TSRLHGCCCCLPQKLSKFYSPMQC 7 ++R GCCCC P F+ P C Sbjct: 3 STRNTGCCCCCPALPCSFHFPPYC 74
>LOC_Os01g23190:12001.t02046:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 846 Score = 31.3 bits (62), Expect = 7.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 / -2 Query: 223 MSCSLKPPVSPRTWTPWPEASWSWA 149 +SCS + + PR WP+ W+W+ Sbjct: 281 LSCSSRVSIIPRRSLYWPDNCWNWS 207
>LOC_Os01g09550:12001.t00833:unspliced-genomic ANAC075, putative, expressed| Length = 6743 Score = 31.3 bits (62), Expect = 7.4 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -3 / -1 Query: 681 NIFRKQKILTTYRFKSIQPSQYVQKPVDFLTTFCLFLKPIMC 556 N + Q+ LT + + +QP KP D L++FC + C Sbjct: 4091 NQIKMQEKLTPFVLEDVQPIISSSKPADLLSSFCCCCCCVAC 3966
>LOC_Os04g17430:12004.t01495:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3187 Score = 27.2 bits (53), Expect(2) = 7.5 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 / +3 Query: 193 PRTWTPWPEASWSWASLAADTRSSYGSWQWMLS 95 PR +P S SW T +S W+WM S Sbjct: 2910 PRGTSPKERWSSSWRVTRPGTPTSLHGWRWMSS 3008 Score = 25.4 bits (49), Expect(2) = 7.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / +1 Query: 231 PPACLAA*SHQSRPGLGRHG 172 PPACL A*+ Q G R G Sbjct: 1975 PPACLGA*NPQEGAGGDRQG 2034
>LOC_Os08g34660:12008.t03206:unspliced-genomic hypothetical protein| Length = 842 Score = 25.4 bits (49), Expect(2) = 7.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 / -2 Query: 166 ASWSWASLAADTRSSYG 116 ASW+WA+ + TR G Sbjct: 619 ASWAWAAATSSTRREEG 569 Score = 23.1 bits (44), Expect(2) = 7.5 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 / -2 Query: 229 PCMSCSLKPPVSPRTWTPWPEASWSWA 149 P MS ++ PP+S + P S +W+ Sbjct: 820 PHMSATISPPLSLSSCPPLRSFSSTWS 740
>LOC_Os05g37280:12005.t03271:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3191 Score = 30.4 bits (60), Expect(2) = 7.5 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = -2 / +1 Query: 214 SLKPPVSPRTWTPWPEASWSWASLAADTRSSYGSWQWMLS 95 S +P PR +P S SW ++ T +S W+W S Sbjct: 2893 SRRPSSHPRGTSPKERWSSSWRAIRPGTPTSLRGWRWTSS 3012 Score = 22.1 bits (42), Expect(2) = 7.5 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 / +3 Query: 428 CHGWMDA*CFFYLSPLCSGVRPP 360 C+GW + FF+L +R P Sbjct: 186 CNGWAGSAIFFFLHGCPGVLRSP 254
>LOC_Os11g47420:12011.t04217:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3302 Score = 27.2 bits (53), Expect(2) = 7.7 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 / +1 Query: 193 PRTWTPWPEASWSWASLAADTRSSYGSWQWMLS 95 PR +P S SW T +S W+WM S Sbjct: 3025 PRGTSPKERWSSSWRVTRLGTPTSLHGWRWMSS 3123 Score = 25.4 bits (49), Expect(2) = 7.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / +2 Query: 231 PPACLAA*SHQSRPGLGRHG 172 PPACL A*+ Q G R G Sbjct: 2090 PPACLGA*NPQEGAGGDRQG 2149
>LOC_Os08g28870:12008.t02643:unspliced-genomic receptor-like protein kinase 5 precursor, putative, expressed| Length = 3333 Score = 29.0 bits (57), Expect(2) = 7.8 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -3 / -1 Query: 243 HCTLPPACLAA*SHQSRPGLGRHGRKHPGLGRHW 142 HCT A A + + PG R GR G R W Sbjct: 357 HCTTGRAAPATGARTAAPGTRRRGRGWRGARRRW 256 Score = 23.5 bits (45), Expect(2) = 7.8 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -1 / -2 Query: 356 PQVGHFLIPNPWQSKHFHLSKM 291 PQ+ L+P P Q +H L ++ Sbjct: 2294 PQLHDVLVPYPPQRRHLRLERV 2229
>LOC_Os07g12100:12007.t01082:unspliced-genomic expressed protein| Length = 6907 Score = 29.0 bits (57), Expect(2) = 8.0 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -3 / +3 Query: 90 DQTSTSRLHGCCCCLPQKLSK 28 D+ ++ R CCCCL ++L K Sbjct: 6213 DEAASRRRRRCCCCLRRRLWK 6275 Score = 24.4 bits (47), Expect(2) = 8.0 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 / +2 Query: 235 PSPCMSCSLKPPVSPRTWTP 176 PSP SCS + R W P Sbjct: 2660 PSPSSSCSAAASSTTRWWRP 2719
>LOC_Os07g13810:12007.t01246:unspliced-genomic cytokinin-N-glucosyltransferase 1, putative, expressed| Length = 1835 Score = 29.0 bits (57), Expect(2) = 8.3 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 / +1 Query: 205 PPVSPRTWTPWPEASWSW 152 PP PR+ TPW S +W Sbjct: 379 PPARPRSGTPWRRCSPAW 432 Score = 22.6 bits (43), Expect(2) = 8.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 / +1 Query: 123 ATVRGSGCSQGDQTSTSR 70 A+VRG CS+G + T R Sbjct: 1288 ASVRGCPCSRGRASPTRR 1341
>LOC_Os03g29864:12003.t02598:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 8360 Score = 25.4 bits (49), Expect(2) = 8.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 / +1 Query: 202 PVSPRTWTPWPEASW 158 P+ + WTPW SW Sbjct: 3781 PL*SKLWTPWSPNSW 3825 Score = 22.6 bits (43), Expect(2) = 8.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 / +2 Query: 362 PLPQVGHFLIPNPWQSKHFHLS 297 PLPQ+ P P SK+ LS Sbjct: 3602 PLPQLCFSSSPTPISSKYLSLS 3667
>LOC_Os02g32490:12002.t02892:unspliced-genomic acetyl-coenzyme A synthetase, putative, expressed| Length = 6105 Score = 25.8 bits (50), Expect(2) = 8.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 / -1 Query: 202 PVSPRTWTPWPEASWSWASLAADTRSS 122 P PR+ +PW +S S +S A D S Sbjct: 381 PAGPRSPSPWRSSSSSSSSAADDAARS 301 Score = 22.1 bits (42), Expect(2) = 8.6 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = -3 / -2 Query: 63 GCCCC 49 GCCCC Sbjct: 269 GCCCC 255
>LOC_Os02g42700:12002.t03855:unspliced-genomic thioredoxin M-type, chloroplast precursor, putative, expressed| Length = 3890 Score = 30.4 bits (60), Expect(2) = 8.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 / -1 Query: 178 PWPEASWSWASLAADT 131 PW E SW WA+ DT Sbjct: 281 PWKEVSWPWAAHTTDT 234 Score = 22.1 bits (42), Expect(2) = 8.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 / -3 Query: 596 SSQHSACFSNQLCV 555 + +S CFS LCV Sbjct: 2424 NQSYSTCFSKALCV 2383
>LOC_Os03g38560:12003.t03299:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3039 Score = 25.8 bits (50), Expect(2) = 9.1 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 / -2 Query: 173 PWRPSPGRDWWLQAARHAGG 232 PWR PG +A R+AGG Sbjct: 1886 PWRSPPGPSDGPRALRYAGG 1827 Score = 22.1 bits (42), Expect(2) = 9.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 / -2 Query: 128 SCVGSQ*RPRPGCFRPWR 181 SC+G RP P + WR Sbjct: 1970 SCIGGGGRPAPRRAQRWR 1917
>LOC_Os06g29570:12006.t02661:unspliced-genomic hypothetical protein| Length = 2747 Score = 24.4 bits (47), Expect(2) = 9.1 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = +3 / +1 Query: 315 RLPGVWDEEVPHLWQGRPHAGAERRKVEETSSIHPSMAAPG 437 R P + +P LW P + + ++ HP++ PG Sbjct: 745 RAPPATVQPLPSLWAPAPPSCRSAPRRRAPAAQHPALPPPG 867 Score = 23.5 bits (45), Expect(2) = 9.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 / +3 Query: 154 KTRMLPAMASKSGARLVASGCKTCRGKGAVEC 249 + R P A+ ARL A + RG+ A C Sbjct: 627 RRRKKPRAAAPGPARLGAFPTRATRGRAATPC 722
>LOC_Os06g08450:12006.t00724:unspliced-genomic response regulator receiver domain containing protein| Length = 8126 Score = 30.4 bits (60), Expect(2) = 9.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 / +2 Query: 235 PSPCMSCSLKPPVSPRTWTPWP 170 PSPC C LK P P P P Sbjct: 1226 PSPCSRCKLKSPTPPSMAPPSP 1291 Score = 23.1 bits (44), Expect(2) = 9.2 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = -2 / +3 Query: 187 TWTPWPEASWSWASLAADTRSS 122 TW + + W+W L+A + S Sbjct: 5574 TWQTFWKNPWTWRMLSASPKGS 5639
>LOC_Os04g11300:12004.t00958:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2618 Score = 24.9 bits (48), Expect(2) = 9.2 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -2 / +1 Query: 235 PSPCMSCSLKPPVSPRTWTPW 173 P P MSCSL P + W Sbjct: 2008 PRPSMSCSLSHQSGPSPYGDW 2070 Score = 23.1 bits (44), Expect(2) = 9.2 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = -3 / +2 Query: 168 KHPGLGRHWLPTQEAATVRGSGCSQ 94 +H G+G HW A V+ C + Sbjct: 2054 RHMGIGHHWAIPGGAKWVQVRNCGR 2128
>LOC_Os12g01600:12012.t00059:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1488 Score = 26.7 bits (52), Expect(2) = 9.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 / -3 Query: 131 CVGSQ*RPRPGCFRPWRPSPGRDWWL 208 C+ Q* RP RPW P WL Sbjct: 1033 CLPPQ*AARPVRLRPWAPRRRMPTWL 956 Score = 24.4 bits (47), Expect(2) = 9.3 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 / -3 Query: 345 PHLWQGRPHAGA 380 PH W+ PHA A Sbjct: 853 PHAWRAAPHADA 818
>LOC_Os01g43844:12001.t03897:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 4288 Score = 28.6 bits (56), Expect(2) = 9.6 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 / -2 Query: 319 CQGFGMRKCPTCGKGGLTPEQRGER 393 C+ R+CP CG G RG+R Sbjct: 3279 CRSSRRRRCPCCGPGWTPAGGRGDR 3205 Score = 24.0 bits (46), Expect(2) = 9.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +1 / -3 Query: 181 SKSGARLVASGCKTCRGK 234 +++G R A GC+T RG+ Sbjct: 3947 AEAGRRGTARGCRTVRGR 3894
>LOC_Os11g22270:12011.t01897:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1354 Score = 25.8 bits (50), Expect(2) = 9.7 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 / -1 Query: 152 PRPGCFRPWRPSPGRDW 202 P PG RPSPG W Sbjct: 586 PAPGATGVTRPSPGTSW 536 Score = 22.1 bits (42), Expect(2) = 9.7 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 / -1 Query: 110 PRTVAASCVGSQ*RPRP 160 P T A + VGS PRP Sbjct: 748 PSTTAPTSVGSSASPRP 698
>LOC_Os02g31250:12002.t02817:unspliced-genomic hypothetical protein| Length = 1319 Score = 25.8 bits (50), Expect(2) = 9.7 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 / -2 Query: 419 WMDA*CFFYLSPLCSGVRPPLPQVGHFLIPN 327 WM A +F L G+R Q+ HF +PN Sbjct: 367 WMRAVIWFGCWQLRDGMRREERQIWHFSLPN 275 Score = 22.1 bits (42), Expect(2) = 9.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 / -2 Query: 451 WRVHLPGAAMDG 416 W+VHLP DG Sbjct: 475 WQVHLPPPPADG 440
>LOC_Os08g36030:12008.t03343:unspliced-genomic plant viral-response family protein, expressed| Length = 1319 Score = 25.4 bits (49), Expect(2) = 9.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -2 / +3 Query: 235 PSPCMSCSLKPPVSPRTW 182 PSP S PP P TW Sbjct: 339 PSPSRCSSTPPPPPPSTW 392 Score = 22.6 bits (43), Expect(2) = 9.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 / +3 Query: 178 PWPEASWSWASLAADTRSSYGSWQ 107 P P ++W AA RSS W+ Sbjct: 372 PPPPSTWPGCRTAAPCRSSSPPWR 443
>LOC_Os11g01590:12011.t00057:unspliced-genomic major Facilitator Superfamily protein, expressed| Length = 4421 Score = 27.2 bits (53), Expect(2) = 9.9 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 / +2 Query: 235 PSPCMSCSLKPPVSPRTWTPWPEAS 161 PSP S S PP SP T + P +S Sbjct: 353 PSPPSSSSPPPPASPHTPSSTPSSS 427 Score = 25.4 bits (49), Expect(2) = 9.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 / +1 Query: 141 LPTQEAATVRGSGCSQGDQTSTSRLHGCC 55 LP E A + SG S RLH CC Sbjct: 3727 LPNVEIA*CKHSGSRNSTNWSKLRLHLCC 3813 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 335,011,128 Number of extensions: 6349184 Number of successful extensions: 45285 Number of sequences better than 10.0: 217 Length of query: 235 Length of database: 55,613,886 Length adjustment: 49 Effective length of query: 186 Effective length of database: 52,856,264 Effective search space: 9831265104 Effective search space used: 9831265104 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)