| Clone Name | FLbaf125m19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q9NZR2:LRP1B_HUMAN Low-density lipoprotein receptor-related prot... | 35 | 0.52 | 2 | Q9JI18:LRP1B_MOUSE Low-density lipoprotein receptor-related prot... | 30 | 9.8 |
|---|
>Q9NZR2:LRP1B_HUMAN Low-density lipoprotein receptor-related protein 1B precursor - Homo| sapiens (Human) Length = 4599 Score = 34.7 bits (78), Expect = 0.52 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +3 Query: 351 GTCLF-PWICSLSRDCRQRAHEFH-EGECEVSSGNCN-QTNQTWQWICEVDDD 500 G C+ WIC +DC EFH + C + C+ Q + WIC+ +DD Sbjct: 2692 GRCILNTWICDGQKDCEDGRDEFHCDSSCSWNQFACSAQKCISKHWICDGEDD 2744
>Q9JI18:LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B precursor - Mus| musculus (Mouse) Length = 4599 Score = 30.4 bits (67), Expect = 9.8 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +3 Query: 351 GTCLF-PWICSLSRDCRQRAHEFH-EGECEVSSGNCN-QTNQTWQWICEVDDD 500 G C+ W+C +DC E H + C + C+ + + WIC+ +DD Sbjct: 2692 GRCILNTWVCDGQKDCEDGLDELHCDSSCSWNQFACSVKKCISKHWICDGEDD 2744 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 158,580,339 Number of extensions: 3515678 Number of successful extensions: 7335 Number of sequences better than 10.0: 2 Number of HSP's gapped: 7326 Number of HSP's successfully gapped: 2 Length of query: 293 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 181 Effective length of database: 69,965,399 Effective search space: 12663737219 Effective search space used: 12663737219 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)