| Clone Name | FLbaf111c09 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os07g45194:12007.t04158:unspliced-genomic expressed protein| Length = 5550 Score = 39.1 bits (79), Expect = 0.007 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 / +1 Query: 64 PCFSVHACKCLMDHSHRLLIHQCNKIRSAVC 156 P S H C+CL D HR + H+C R A+C Sbjct: 3037 PHLSEHLCECLPDLHHRFVRHRCRHRRHALC 3129
>LOC_Os07g45234:12007.t04162:unspliced-genomic expressed protein| Length = 5952 Score = 38.2 bits (77), Expect = 0.013 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 / +2 Query: 64 PCFSVHACKCLMDHSHRLLIHQCNKIRSAVC 156 P S H C+CL D HR H+C R A+C Sbjct: 3512 PHLSEHLCECLPDLHHRFARHRCRHRRHALC 3604
>LOC_Os03g51670:12003.t04493:unspliced-genomic serine esterase family protein, putative, expressed| Length = 5383 Score = 33.6 bits (67), Expect = 0.32 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = -2 / -3 Query: 75 TEAWMQERKTEKEPTSPRQTLQETY 1 TEA ++R+ +K+PTS Q+LQ+TY Sbjct: 5306 TEARKRQREGKKKPTSETQSLQDTY 5232
>LOC_Os07g15050:12007.t01368:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2289 Score = 30.9 bits (61), Expect = 2.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 / +2 Query: 1 VCFL*SLSRARRFLFSFSLLHPCFSVHAC 87 VC S R FS +HPCF+ HAC Sbjct: 803 VCQSSSCLWGRTVSLCFSYVHPCFARHAC 889
>LOC_Os06g03780:12006.t00269:unspliced-genomic nucleolar protein 10, putative, expressed| Length = 7912 Score = 30.9 bits (61), Expect = 2.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 / -3 Query: 67 CFSVHACKCLMDHSHRLLIH 126 C S+ C CL+ H H LL+H Sbjct: 7562 CPSLCLCLCLLSHHHHLLLH 7503
>LOC_Os06g42370:12006.t03928:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9484 Score = 30.4 bits (60), Expect = 2.9 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +1 / +2 Query: 13 *SLSRARRFLFSFSLLHPCFSVHACKCLMDHSHRLLIHQC 132 * L+R RFL S + HPC +H R IH C Sbjct: 7715 *KLARLFRFLSSTARTHPCIGIHLHVLSSPGKSRWPIHLC 7834
>LOC_Os05g52070:12005.t04632:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 14530 Score = 30.4 bits (60), Expect = 2.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 / +2 Query: 38 SFSVFLSCIHASVCMHVNV*WTT 106 SF VFL C+HAS C+ V W + Sbjct: 9743 SFIVFLVCLHASFCV*VCCLWVS 9811
>LOC_Os11g40510:12011.t03592:unspliced-genomic nucleolysin TIAR, putative, expressed| Length = 4951 Score = 25.8 bits (50), Expect(2) = 3.6 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 / +1 Query: 73 SVHACKCLMDHSHRLLIHQCNKIRSAVCCV 162 +VH C C S L H NK +CC+ Sbjct: 3661 TVHDCLCWQSSS*CNLSHF*NKFLFVLCCI 3750 Score = 24.0 bits (46), Expect(2) = 3.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 / +2 Query: 23 LGLVGSFSVFLSCIHASVCMHVNV 94 LG +V L + +VC+HVN+ Sbjct: 2711 LGTEKLLNVLLQLLFCTVCVHVNL 2782
>LOC_Os03g44840:12003.t03868:unspliced-genomic expressed protein| Length = 4221 Score = 29.9 bits (59), Expect = 3.9 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -3 / +1 Query: 116 SLWLWSIKHLHACTLKHGCKREKLKRNL 33 S+WLW H+H +++ C+ LK ++ Sbjct: 2599 SMWLWQNWHIHGLSMESVCQVAPLKHSV 2682
>LOC_Os01g38450:12001.t03382:unspliced-genomic hypothetical protein| Length = 1326 Score = 29.9 bits (59), Expect = 3.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 / -2 Query: 113 LWLWSIKHLHACTLKH 66 LWLW++ HL LKH Sbjct: 824 LWLWNVTHLDCSKLKH 777
>LOC_Os12g42900:12012.t03963:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 1658 Score = 29.9 bits (59), Expect = 4.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 / -3 Query: 46 SFSLLHPCFSVHACKCLMDHSHRLLI 123 +F LL CFS+H C+C +H LI Sbjct: 1629 TFWLLMWCFSIHICRC*FTCNHISLI 1552
>LOC_Os03g22634:12003.t02013:unspliced-genomic terpene synthase 7, putative, expressed| Length = 14687 Score = 29.9 bits (59), Expect = 4.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 / -1 Query: 118 TACGCGPLNIYMHAH*SM 65 T+CG GP +Y+H H S+ Sbjct: 10994 TSCGLGPTYVYLHGHCSI 10941
>LOC_Os09g12420:12009.t01032:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 9297 Score = 25.4 bits (49), Expect(2) = 4.5 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 / -2 Query: 79 HACKCLMDHSHRLLIHQCNKIRSAV 153 +AC + H HR L QC +I+ + Sbjct: 7625 YAC*KALPHVHRFLTRQCVQIKCMI 7551 Score = 24.9 bits (48), Expect(2) = 4.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 / -3 Query: 4 CFL*SLSRARRFLFSFSLLHPCFSVHACKC 93 C++ ++S AR F L C+ V KC Sbjct: 8236 CYVDAMSHARHDFLLFPHLFTCYIVFHSKC 8147
>LOC_Os09g03110:12009.t00210:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 10233 Score = 29.5 bits (58), Expect = 5.5 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +2 / +1 Query: 2 YVSCKVCLGLVGSFSVFLSCIHASVCMHVNV 94 Y+ +CL ++GS S++ SC + + + V Sbjct: 2812 YIKILLCLSILGSCSIYYSCFNILIWSSIGV 2904
>LOC_Os06g22380:12006.t02052:unspliced-genomic expressed protein| Length = 9988 Score = 29.5 bits (58), Expect = 5.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 / -2 Query: 67 CFSVHACKCLMDHSHRLLIHQCNKIR 144 C+ VH+ KCL D R H+C ++ Sbjct: 2778 CYRVHSRKCLTDFGPR*QDHRCKAVQ 2701
>LOC_Os05g14160:12005.t01191:unspliced-genomic hypothetical protein| Length = 6051 Score = 29.5 bits (58), Expect = 5.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 / -3 Query: 67 CFSVHACKCLMDHSHRL 117 CFSV +C CL H H + Sbjct: 5083 CFSVFSCLCLFQHIHTM 5033
>LOC_Os01g56490:12001.t05058:unspliced-genomic ubiquitin carboxyl-terminal hydrolase 21, putative, expressed| Length = 17146 Score = 29.5 bits (58), Expect = 5.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 / +1 Query: 17 VCLGLVGSFSVFLSCIHASVCMHVNV*WT 103 +C+G + FS+ IH S C + V WT Sbjct: 5596 LCIGSISQFSLSWLSIHWSFCCYRQVLWT 5682
>LOC_Os07g42610:12007.t03912:unspliced-genomic ring-H2 zinc finger protein, putative, expressed| Length = 3984 Score = 29.0 bits (57), Expect = 7.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 / -3 Query: 19 LSRARRFLFSFSLLHPCFSVHAC 87 +S +R L S+L PC S HAC Sbjct: 3670 ISGIQRRLLCCSILSPCLSAHAC 3602
>LOC_Os03g10080:12003.t00811:unspliced-genomic expressed protein| Length = 4716 Score = 29.0 bits (57), Expect = 7.6 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +1 / -1 Query: 37 FLFSFSLLHPCFSVHACKCLMDHSHRLLIHQCNKIRS 147 FLF +L F H C+ + ++H + HQ NK+++ Sbjct: 552 FLFLEALASERFPRHRCRY*LTYAHVNIKHQLNKLKA 442
>LOC_Os02g58580:12002.t05428:unspliced-genomic metal tolerance protein C2, putative, expressed| Length = 5402 Score = 29.0 bits (57), Expect = 7.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 / +1 Query: 85 CKCLMDHSHRLLIHQCNKIRSAVC 156 C CL HS RLL+ K+ A+C Sbjct: 4408 CSCLFCHSLRLLVISFCKLHQAMC 4479
>LOC_Os02g15980:12002.t01391:unspliced-genomic expressed protein| Length = 3953 Score = 29.0 bits (57), Expect = 7.6 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 / -3 Query: 49 FSLLHPCFSVHACKCLMDHSHRLLIHQC 132 FS +HPC C+ L H+ H C Sbjct: 3429 FS*VHPCCLCSFCEALYGHASECYFHAC 3346
>LOC_Os07g42800:12007.t03929:unspliced-genomic AT hook-containing MAR binding 1-like protein, putative, expressed| Length = 3192 Score = 24.4 bits (47), Expect(2) = 7.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 / +1 Query: 2 YVSCKVCLGLVGSFSVFLSC 61 +V C++ LVG VF+SC Sbjct: 1477 FVDCRLSPKLVGGRVVFISC 1536 Score = 23.5 bits (45), Expect(2) = 7.9 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +1 / +2 Query: 34 RFLFSFSLLHPCFSVHACKCLMDHSHRLL 120 R+ + L+HPC + C+M +S L+ Sbjct: 2582 RWSSGYHLIHPCHNHPWMYCIMTYSAYLV 2668
>LOC_Os01g51990:12001.t04627:unspliced-genomic multiple stress-responsive zinc-finger protein ISAP1, putative| Length = 1846 Score = 23.5 bits (45), Expect(2) = 8.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 / +2 Query: 160 RNTQRILFYYTDESTA 113 RN ILFYYT S++ Sbjct: 734 RNANDILFYYTRTSSS 781 Score = 23.5 bits (45), Expect(2) = 8.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 / +3 Query: 130 TDESTACGCGPL 95 T++STA GC PL Sbjct: 1176 TEDSTARGCAPL 1211
>LOC_Os03g49050:12003.t04255:unspliced-genomic carboxy-lyase, putative| Length = 5538 Score = 25.4 bits (49), Expect(2) = 9.4 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 / -2 Query: 67 CFSVHACKCLMD 102 CFSV CKC +D Sbjct: 5075 CFSVTKCKCKLD 5040 Score = 23.1 bits (44), Expect(2) = 9.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 / -3 Query: 112 RLLIHQCNKIRSAVC 156 RL +HQC+ + VC Sbjct: 979 RLCLHQCHCVNVCVC 935 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 79,077,184 Number of extensions: 1010828 Number of successful extensions: 6212 Number of sequences better than 10.0: 24 Length of query: 84 Length of database: 55,613,886 Length adjustment: 45 Effective length of query: 39 Effective length of database: 53,081,376 Effective search space: 2070173664 Effective search space used: 2070173664 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)