ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf113j06 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os03g15700:12003.t01356:unspliced-genomic splicing factor 3A subunit 2, putative, expressed| Length = 2898 Score = 141 bits (303), Expect(8) = e-119 Identities = 56/59 (94%), Positives = 57/59 (96%) Frame = +3 / +3 Query: 186 LGSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPNKRKLAPRKS 362 + SYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPNKRK APRKS Sbjct: 294 VSSYECKLCLTLHNNEGNYLAHTQGKRHQTNLAKRAAREAKDAPAQPQPNKRKFAPRKS 470 Score = 100 bits (212), Expect(8) = e-119 Identities = 41/54 (75%), Positives = 42/54 (77%) Frame = +3 / +3 Query: 36 DAMDREWGSKPGSGGAATAQNEAIDXXXXXXXXXXXTIDLAKDPYFMRNHLGSY 197 DAMDREWGSKPGSGGAA+AQNEAID TIDLAKDPYFMRNHLG Y Sbjct: 54 DAMDREWGSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGRY 215 Score = 67.0 bits (140), Expect(8) = e-119 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 / +1 Query: 351 PRKSVKIGRPGYTVTKQYDPDTKQHSFLFEI 443 P SVKIGRPGY VTKQYDPD KQHSFLFE+ Sbjct: 1150 PSFSVKIGRPGYQVTKQYDPDMKQHSFLFEV 1242 Score = 65.2 bits (136), Expect(8) = e-119 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = +3 / +2 Query: 498 YEQKIQSWDKRYQYLLFAAEPYEVIGFKI 584 + QK++SWDK+YQYLLFAAEPYE+IGFK+ Sbjct: 1898 FVQKVESWDKKYQYLLFAAEPYEIIGFKV 1984 Score = 59.7 bits (124), Expect(8) = e-119 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 / +2 Query: 429 FLFEIEYPEIEDNSKPRHRFMASYEQKIQS 518 FLF I YPEIE+NSKPRHRFMASYEQ QS Sbjct: 1721 FLF*IGYPEIEENSKPRHRFMASYEQVKQS 1810 Score = 59.3 bits (123), Expect(8) = e-119 Identities = 21/27 (77%), Positives = 24/27 (88%) Frame = +3 / +1 Query: 579 KIPSTEIDKSTDKFFSYWDPDKKSYIL 659 +IPS EIDKS DKFF+YWDPDKK YI+ Sbjct: 2059 QIPSAEIDKSADKFFNYWDPDKKQYIV 2139 Score = 52.4 bits (108), Expect(8) = e-119 Identities = 23/53 (43%), Positives = 28/53 (52%) Frame = +2 / +1 Query: 728 WNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSACK 886 W + + P+TGSA ST+CTYG AP DP T STST + CK Sbjct: 2314 WRSTTPTPTAGSATPATGSAAASTKCTYGYAPKDPTPTCWWYSTSTTTAPTCK 2472 Score = 34.1 bits (68), Expect(8) = e-119 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +1 / +3 Query: 661 NYTSSQDRRRSIDNQQLLGLFQMEQE 738 NYTS QD ++ I +LLGL QM+ E Sbjct: 2241 NYTSKQDNQKLISRLRLLGLCQMDLE 2318 Score = 68.9 bits (144), Expect(10) = 3e-87 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 / -2 Query: 436 KRNECCFVSGSYCLVTVYPGLPILTDLRGASLRLF 332 KRNECCF+SGSYCLVT YPGLPILT+ G +++F Sbjct: 1235 KRNECCFMSGSYCLVT*YPGLPILTEKEGKIIKIF 1131 Score = 68.0 bits (142), Expect(10) = 3e-87 Identities = 37/64 (57%), Positives = 40/64 (62%) Frame = -2 / -2 Query: 960 EALQE*S*PMDHQKEVEVVLNVEDHLQAEVEGVEVEDRSLVVAGS*GAFP*VHSVEVVAE 781 E LQE*S*P+ H+ V V L VE HLQ VEVE V GS GA+P*VH VE AE Sbjct: 2546 EVLQE*S*PLHHRS*VGVGLIVEVHLQVGAVVVEVEYHQQVGVGSLGAYP*VHLVEAAAE 2367 Query: 780 PVDG 769 PV G Sbjct: 2366 PVAG 2355 Score = 62.0 bits (129), Expect(10) = 3e-87 Identities = 24/27 (88%), Positives = 24/27 (88%) Frame = -2 / -1 Query: 273 SGAASPACARGSSPRCCGASGTACTRS 193 SGAASPAC GSSPRCC ASGTACTRS Sbjct: 381 SGAASPACEPGSSPRCCAASGTACTRS 301 Score = 59.3 bits (123), Expect(10) = 3e-87 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -3 / -3 Query: 509 FLFI*CHETVPWLAIIFDFRVLNLKEK 429 +LFI*CHETVPWLA+ F+FR+ NLKEK Sbjct: 1801 YLFI*CHETVPWLAVFFNFRITNLKEK 1721 Score = 54.7 bits (113), Expect(10) = 3e-87 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 / -2 Query: 197 VAAEMVSHEVGVLG*VDRLEREAAQALPPVD 105 V AE+V+HEVGVLG VD LE EAA+ALPPVD Sbjct: 215 VPAEVVAHEVGVLGEVDGLEGEAAEALPPVD 123 Score = 50.6 bits (104), Expect(10) = 3e-87 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = -3 / -3 Query: 599 NLCAWYLKANDFIGLRCKK*ILIPLIPRLDFLF 501 N+ +LKAN+FIGL CKK*ILI IPR DFL+ Sbjct: 1999 NIQNTHLKANNFIGLCCKK*ILILFIPRFDFLY 1901 Score = 46.4 bits (95), Expect(10) = 3e-87 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -1 / -3 Query: 97 FCAVAAPPLPGLEPHSRSMAS 35 F A AAPPLPGLEPHSRSMAS Sbjct: 115 FWAEAAPPLPGLEPHSRSMAS 53 Score = 43.2 bits (88), Expect(10) = 3e-87 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = -3 / -1 Query: 656 NVRFLVRIPV*EKLVCRFVNLCAWYLK 576 NV FLV IP+ E+ +C V+LCAWYL+ Sbjct: 2136 NVLFLVWIPIVEEFIC*LVDLCAWYLQ 2056 Score = 29.9 bits (59), Expect(10) = 3e-87 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 / -3 Query: 1058 KASVQNL*PDLSCPH*DHLLL 996 + S+Q+L*PDLSC HLLL Sbjct: 2641 RQSLQHL*PDLSCCRLGHLLL 2579 Score = 24.4 bits (47), Expect(10) = 3e-87 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -3 / -3 Query: 737 SCSIWNSPRSCWLSIDLRRSWLEV*LQ 657 S SIW SPRS I S EV*L+ Sbjct: 2317 SRSIWQSPRSRRRLISFWLSCFEV*LE 2237 Score = 88.6 bits (187), Expect(8) = 2e-53 Identities = 39/57 (68%), Positives = 40/57 (70%) Frame = -1 / -3 Query: 361 DLRGASLRLFGWGCAGXXXXXXXXXXXXLVWCRFPCVCAR*FPSLLWSVRHSLHS*L 191 DLRGA+ L GWGCAG LVWCRFPCV AR*FPSLL SVRHSLHS*L Sbjct: 469 DLRGANFLLLGWGCAGASLASRAARLARLVWCRFPCV*AR*FPSLLCSVRHSLHS*L 299 Score = 56.5 bits (117), Expect(8) = 2e-53 Identities = 22/40 (55%), Positives = 25/40 (62%) Frame = -3 / -3 Query: 887 ICKRRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMG 768 ICK WRL T + W DP GH+HRCI WR +SLW G Sbjct: 2473 ICKWGRWWWRLSTTNRWGWDPWGHTHRCIWWRRRRSLWRG 2354 Score = 48.3 bits (99), Expect(8) = 2e-53 Identities = 21/27 (77%), Positives = 23/27 (85%) Frame = -1 / -1 Query: 580 LKPMTS*GSAAKSRY*YLLSQDWIFCS 500 LKP+ S*GSAAKSRY*Y LSQD FC+ Sbjct: 1980 LKPIIS*GSAAKSRY*YFLSQDSTFCT 1900 Score = 42.3 bits (86), Expect(8) = 2e-53 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -1 / -2 Query: 655 MYDFLSGSQYEKNLSVDLSISVLGI 581 MY FLSGSQ KNLS DLSIS LGI Sbjct: 2135 MYCFLSGSQ*LKNLSADLSISALGI 2061 Score = 39.1 bits (79), Expect(8) = 2e-53 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -3 / -1 Query: 443 NLKEKRVLLRVRIILFSYCISRSANLN 363 +LK+K VLL VRIIL S+ I RS+NLN Sbjct: 1242 DLKKK*VLLHVRIILLSHLIPRSSNLN 1162 Score = 28.6 bits (56), Expect(8) = 2e-53 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -1 / -1 Query: 517 DWIFCSYDAMKRC 479 D CSYDAMKRC Sbjct: 1809 DCFTCSYDAMKRC 1771 Score = 28.6 bits (56), Expect(8) = 2e-53 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 / -1 Query: 195 SCRDGFA*SRGPW 157 +CR G A*SRGPW Sbjct: 213 TCRGGCA*SRGPW 175 Score = 23.5 bits (45), Expect(8) = 2e-53 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -2 / -2 Query: 738 LLFHLEQSQELLVVY*SPAVLA*SIV 661 L HL +SQE Y* VL *SIV Sbjct: 2318 LQIHLAKSQEPQAAY*LLVVLF*SIV 2241 Score = 61.1 bits (127), Expect(9) = 1e-47 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +2 / +2 Query: 191 QLRVQAVPDAPQQRGELPRAHAGEAAPD 274 QLRVQAVPDA QQRGELP +HAGEAAPD Sbjct: 299 QLRVQAVPDAAQQRGELPGSHAGEAAPD 382 Score = 52.8 bits (109), Expect(9) = 1e-47 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +1 / +3 Query: 505 RKSNLGIRGINIYFLQRSPMKSLALR 582 RKSNLGI+ INIYFLQ+SPMK LALR Sbjct: 1905 RKSNLGIKSINIYFLQQSPMKLLALR 1982 Score = 51.0 bits (105), Expect(9) = 1e-47 Identities = 22/29 (75%), Positives = 22/29 (75%) Frame = +1 / +3 Query: 430 FSLRLSTLKSKIIASQGTVSWHHMNRKSN 516 FS RL LK K ASQGTVSWHHMNR SN Sbjct: 1722 FSFRLVILKLKKTASQGTVSWHHMNR*SN 1808 Score = 40.5 bits (82), Expect(9) = 1e-47 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = +2 / +3 Query: 365 *DWQTWIYSN*TV*S*HEATLVSL* 439 *DW+TW+ +* V*S*HEATL+S * Sbjct: 1164 *DWKTWVSGD*AV*S*HEATLISF* 1238 Score = 35.4 bits (71), Expect(9) = 1e-47 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +1 / +2 Query: 580 RYQAQRLTNRQTSFSHTGIRTRNRT 654 RYQAQR T++Q + S GI+TRN T Sbjct: 2060 RYQAQRSTSQQINSSTIGIQTRNST 2134 Score = 30.9 bits (61), Expect(9) = 1e-47 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +1 / +3 Query: 811 WECPLGSRHHQ*AVFNLHPLHLRLQM 888 W CP GS H V NLH LQM Sbjct: 2397 WVCPQGSHPHLLVVLNLHHHRPHLQM 2474 Score = 28.6 bits (56), Expect(9) = 1e-47 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +2 / +2 Query: 158 QGPLLHAKPSRQL 196 QGPLLHA+P RQ+ Sbjct: 176 QGPLLHAQPPRQV 214 Score = 28.6 bits (56), Expect(9) = 1e-47 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 / +1 Query: 662 TILQAKTAGDQ*TTSSSWDCSKW 730 TILQ KT * SWD +KW Sbjct: 2242 TILQNKTTRS**AACGSWDFAKW 2310 Score = 23.1 bits (44), Expect(9) = 1e-47 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 / +2 Query: 8 DPREAAKPSRRHGSRVGL 61 D R RHGSRVGL Sbjct: 26 DSRGGETERGRHGSRVGL 79 Score = 44.6 bits (91), Expect(4) = 2e-16 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = +2 / +1 Query: 503 TENPILG*EVSISTFCSGAL*SHWL* 580 TE+ ILG*+VSISTFCS AL*++WL* Sbjct: 1903 TESRILG*KVSISTFCSRAL*NYWL* 1980 Score = 34.5 bits (69), Expect(4) = 2e-16 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = +2 / +1 Query: 428 VSL*D*VP*NRR**QAKAPFHGII*TENPI 517 +SL D + *N R QAKAPFHGII*T I Sbjct: 1720 ISLLDWLS*N*RKQQAKAPFHGII*TGKAI 1809 Score = 34.1 bits (68), Expect(4) = 2e-16 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 / +3 Query: 581 DTKHRD*QIDRQVFLILGSGQEIVH 655 DTK RD Q+ R + +LGS QE VH Sbjct: 2061 DTKRRDRQVSR*ILQLLGSRQETVH 2135 Score = 27.2 bits (53), Expect(4) = 2e-16 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +3 / +2 Query: 657 LQLYFKPRPPEINR 698 LQLYFK R PE N+ Sbjct: 2237 LQLYFKTRQPEANK 2278 Score = 54.2 bits (112), Expect(5) = 1e-14 Identities = 24/47 (51%), Positives = 31/47 (65%) Frame = -2 / -2 Query: 564 HRAPLQKVDIDTSYPKIGFSVHMMP*NGALACYYLRFQGTQSQRETS 424 ++A K+ + S I VHMMP*NGALAC +L+FQ QS+RE S Sbjct: 1856 NKATYHKLKTEQSGRLIALPVHMMP*NGALACCFLQFQDNQSKREIS 1716 Score = 34.5 bits (69), Expect(5) = 1e-14 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -2 / -3 Query: 438 QRETSVASCQDHTV*LLYIQVCQS* 364 Q+E SVASCQDHT * QV QS* Sbjct: 1237 QKEMSVASCQDHTA*SPDTQVFQS* 1163 Score = 27.2 bits (53), Expect(5) = 1e-14 Identities = 13/43 (30%), Positives = 14/43 (32%) Frame = -3 / -3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTR 744 W W WWR R RW + W R W S R Sbjct: 2419 WDPWGHTHRCIWWRRRRSLWRGWRNLRWGWAWWTSRSIWQSPR 2291 Score = 25.4 bits (49), Expect(5) = 1e-14 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 / -3 Query: 193 LPRWFRMK*G 164 LPRW RMK*G Sbjct: 211 LPRWLRMK*G 182 Score = 23.5 bits (45), Expect(5) = 1e-14 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -2 / -3 Query: 666 IVAECTISCPDPS 628 + ++CT+SC DP+ Sbjct: 2146 LYSQCTVSCLDPN 2108 Score = 39.6 bits (80), Expect(2) = 0.019 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -2 / -2 Query: 564 HRAPLQKVDIDTSYPKIGFSV 502 HRA LQKVDIDT YPKI SV Sbjct: 1964 HRALLQKVDIDTFYPKIRLSV 1902 Score = 24.0 bits (46), Expect(2) = 0.019 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -3 / -3 Query: 872 WRGWRLKTAHWWW 834 WRGWR W W Sbjct: 2362 WRGWRNLRWGWAW 2324
>LOC_Os12g31800:12012.t02883:unspliced-genomic glycine-rich RNA-binding protein 7, putative, expressed| Length = 3854 Score = 42.3 bits (86), Expect(2) = 5e-06 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -3 / +2 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 +WR WQ W RW W R C +WN R W Sbjct: 3308 QWRVWQQGWWWRWLWSCRRICRCLLWNQLRW*W 3406 Score = 28.6 bits (56), Expect(2) = 5e-06 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +2 Query: 881 KRRWRGWRLKTAHWWW 834 +RRWR W WWW Sbjct: 3182 RRRWRLWWWWLQWWWW 3229 Score = 34.1 bits (68), Expect(2) = 0.060 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 / +2 Query: 803 IRWRWWQSLWMGRWPWWSTRR 741 ++W WW W +W WW RR Sbjct: 3212 LQWWWWLWRWWLQWWWWWRRR 3274 Score = 22.6 bits (43), Expect(2) = 0.060 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 / +2 Query: 878 RRWRGWRLKTAHWWW 834 RRW R WWW Sbjct: 3167 RRWLWRRRWRLWWWW 3211 Score = 32.7 bits (65), Expect(2) = 0.15 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -3 / +2 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WWWR R + W+ W+ G W W Sbjct: 3257 WWWRRRLPRRRRWLWWQQWRVWQQGWWWRW 3346 Score = 22.6 bits (43), Expect(2) = 0.15 Identities = 5/10 (50%), Positives = 6/10 (60%) Frame = -3 / +2 Query: 863 WRLKTAHWWW 834 WR + WWW Sbjct: 3179 WRRRWRLWWW 3208 Score = 35.0 bits (70), Expect = 1.1 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = -3 / +2 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASC 732 +W W + WW R R RW WWQ + + WW SC Sbjct: 3215 QWWWWLWRWWLQWWWWWRRRLPRRRRWLWWQQWRVWQQGWWWRWLWSC 3358
>LOC_Os07g40510:12007.t03709:unspliced-genomic formin-2, putative, expressed| Length = 6892 Score = 38.2 bits (77), Expect(3) = 7e-06 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 / -3 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTR 744 WW R +WRWW S+ + W WW R Sbjct: 443 WWGRWRSIKACSWKWRWWWSIRV*DWRWWRRR 348 Score = 26.3 bits (51), Expect(3) = 7e-06 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -3 / -3 Query: 878 RRWRGWRLKTAHWWWRDPRG 819 RRWR W WW RG Sbjct: 587 RRWRTWTCTWRWWWRWRARG 528 Score = 22.1 bits (42), Expect(3) = 7e-06 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 / -2 Query: 930 DHQKEVEVVLNVEDHLQAEVE 868 DH + VEVV ++ +HL+ E Sbjct: 645 DHLEGVEVVEDLGEHLEVVEE 583 Score = 26.3 bits (51), Expect(3) = 0.006 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -3 / -3 Query: 797 WRWWQSLWMG 768 WRWW+ W G Sbjct: 368 WRWWRRRWNG 339 Score = 25.8 bits (50), Expect(3) = 0.006 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / -3 Query: 878 RRWRGWRLKTAHWWW 834 R WR WR T W W Sbjct: 596 RWWRRWRTWTCTWRW 552 Score = 24.0 bits (46), Expect(3) = 0.006 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / -3 Query: 839 WWRDPRGHSHRCIRW 795 WWR RG C RW Sbjct: 485 WWRWRRGIKMCCWRW 441 Score = 29.5 bits (58), Expect(2) = 0.024 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = -3 / -3 Query: 884 CKRRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQ 783 C WR R T WR R WRWW+ Sbjct: 686 CTATWRRKRWSTWTTTWRGWRWWRTWASTWRWWR 585 Score = 28.6 bits (56), Expect(2) = 0.024 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 / -3 Query: 797 WRWWQSLWMGRWPWWSTRRA 738 WRW + + M W WW R+ Sbjct: 482 WRWRRGIKMCCWRWWGRWRS 423 Score = 26.7 bits (52), Expect(2) = 2.0 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 / -3 Query: 800 RWRWWQSLWMGRWPW 756 RWR W W W W Sbjct: 584 RWRTWTCTWRWWWRW 540 Score = 24.4 bits (47), Expect(2) = 2.0 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 / -3 Query: 878 RRWRGWRLKTAHWWW 834 R WR WR + W W Sbjct: 635 RGWRWWRTWASTWRW 591
>LOC_Os03g19600:12003.t01725:unspliced-genomic PE_PGRS family protein, putative, expressed| Length = 2044 Score = 34.1 bits (68), Expect(3) = 1e-05 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWWSTRR 741 RW WW W R WW RR Sbjct: 603 RWTWWWCRWRWRTWWWCWRR 662 Score = 26.3 bits (51), Expect(3) = 1e-05 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -3 / +3 Query: 848 AHWWWRDPRGHSHRCIRWRW 789 + WWW R C RW W Sbjct: 525 SRWWWWCWRRPRWWCRRWAW 584 Score = 25.8 bits (50), Expect(3) = 1e-05 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWW 834 W WR + WWW Sbjct: 396 WSRWRWRAW*WWW 434 Score = 28.1 bits (55), Expect(4) = 1e-04 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 RWRWW W R W Sbjct: 834 RWRWWTRWWHRRRWW 878 Score = 24.4 bits (47), Expect(4) = 1e-04 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWR 831 W WR +T W WR Sbjct: 618 WCRWRWRTWWWCWR 659 Score = 22.6 bits (43), Expect(4) = 1e-04 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -3 / +3 Query: 848 AHWWWRDPRGHSHRCIRWRW 789 + WWW R C R RW Sbjct: 675 SRWWWWCRRWAWWWCWRRRW 734 Score = 22.6 bits (43), Expect(4) = 1e-04 Identities = 9/25 (36%), Positives = 9/25 (36%) Frame = -3 / +3 Query: 776 WMGRWPWWSTRRASCSIWNSPRSCW 702 W WW RR W RS W Sbjct: 987 WRWWTRWWRRRRWRTRRWCWRRSWW 1061 Score = 30.9 bits (61), Expect(3) = 3e-04 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWWWRDPRGHSHRCIRWRW 789 +R W W + WWW RG + RW Sbjct: 897 RRWWTRWWCRRRSWWWCRSRGRARWRCWCRW 989 Score = 26.7 bits (52), Expect(3) = 3e-04 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGR 765 RWRWW W R Sbjct: 984 RWRWWTRWWRRR 1019 Score = 23.5 bits (45), Expect(3) = 3e-04 Identities = 9/25 (36%), Positives = 9/25 (36%) Frame = -3 / +3 Query: 776 WMGRWPWWSTRRASCSIWNSPRSCW 702 W WW RR W RS W Sbjct: 1107 WRWWTRWWRRRRWRTRRWCRRRSWW 1181 Score = 31.8 bits (63), Expect(3) = 3e-04 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -3 / +3 Query: 794 RWWQSLWMGRWPWWSTR 744 RWW W R PWW R Sbjct: 1260 RWWTRRWCRRRPWWWCR 1310 Score = 24.4 bits (47), Expect(3) = 3e-04 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWR 831 R WR R +T W WR Sbjct: 1002 RWWRRRRWRTRRWCWR 1049 Score = 24.4 bits (47), Expect(3) = 3e-04 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRW 789 WWW RG + +RW Sbjct: 1176 WWWCRSRGRARWRCWYRW 1229 Score = 33.6 bits (67), Expect(2) = 0.025 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIWNSPR 711 WR W W RW WS RR+ +W R Sbjct: 162 WRRWWCRWWFRWRAWSWRRSWRWVWRG*R 248 Score = 24.4 bits (47), Expect(2) = 0.025 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = -3 / +2 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRW 795 WR +WWR R S R RW Sbjct: 32 WRSRHWPRCLFWWRPLRHGSLRRRRW 109 Score = 29.9 bits (59), Expect(2) = 0.034 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIW 723 W R R RW W W RW W RR W Sbjct: 1578 WLRRGARWQQR*WFRWWVWCWWWSRRWCWCGFRRGRRCGW 1697 Score = 27.6 bits (54), Expect(2) = 0.034 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 / +3 Query: 884 CKRRWRGWRLKTAHWWW 834 C RRWR W + WW Sbjct: 1485 CWRRWRTWWWRRRRPWW 1535 Score = 28.6 bits (56), Expect(4) = 0.072 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -3 / +3 Query: 788 WQSLWMGRWPWWSTRR 741 W W RW WW RR Sbjct: 708 WWWCWRRRWTWWWCRR 755 Score = 24.9 bits (48), Expect(4) = 0.072 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWW 834 RRWR W + W W Sbjct: 282 RRWRRWWFRWRAWSW 326 Score = 22.6 bits (43), Expect(4) = 0.072 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = -3 / +3 Query: 806 CIRWRWW 786 C RW WW Sbjct: 693 CRRWAWW 713 Score = 22.1 bits (42), Expect(4) = 0.072 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = -3 / +3 Query: 758 WWSTRRASCSIWNSPRSCW 702 WW RR W RS W Sbjct: 885 WWHRRRWWTRWWCRRRSWW 941 Score = 33.1 bits (66), Expect(2) = 0.12 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWS 750 W WR WW+R R RW W W R WS Sbjct: 153 WWSWRRWWCRWWFRWRAWSWRRSWRWVWRG*RWRPRRRRWS 275 Score = 27.2 bits (53), Expect(2) = 0.12 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = -3 / +3 Query: 776 WMGRWPWWSTRRASCSIWNSPRSCW 702 W RW WW R + W R W Sbjct: 690 WCRRWAWWWCWRRRWTWWWCRRRPW 764 Score = 28.6 bits (56), Expect(2) = 0.15 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 / +3 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WW R R WRW +S W W W Sbjct: 1362 WWWRRRRWRTRWWCWRWCRSGWWVWWWCW 1448 Score = 26.7 bits (52), Expect(2) = 0.15 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / +3 Query: 884 CKRRWRGWRLKTAHWWWR 831 C+ RW WR W WR Sbjct: 1305 CRSRWWVWRRCRCWWRWR 1358 Score = 36.8 bits (74), Expect = 0.32 Identities = 16/52 (30%), Positives = 19/52 (36%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIW 723 R W R + WW R + R RWW W R WW R + W Sbjct: 816 RWWCWCRWRWWTRWWHRRRWWTRWWHRRRWWTRWWCRRRSWWWCRSRGRARW 971 Score = 28.6 bits (56), Expect(3) = 0.55 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 RWRWW W R W Sbjct: 1224 RWRWWTRWWCWRRWW 1268 Score = 25.4 bits (49), Expect(3) = 0.55 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWR 831 R W WR +T W WR Sbjct: 462 RWWCRWRWRTWWWCWR 509 Score = 23.1 bits (44), Expect(3) = 0.55 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / +3 Query: 839 WWRDPRGHSHRCIRWRWW 786 WWR R + R R R W Sbjct: 1125 WWRRRRWRTRRWCRRRSW 1178 Score = 34.1 bits (68), Expect = 2.2 Identities = 19/67 (28%), Positives = 23/67 (34%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCWLS 696 R R W + + WW R RC W + W WW+ R W RS W Sbjct: 1146 RTRRWCRRRSWWWCRSRGRARWRCWYRWRWWTRWWCWRRWWTRRWCRRRPWWWCRSRWWV 1325 Query: 695 IDLRRSW 675 R W Sbjct: 1326 WRRCRCW 1346 Score = 26.7 bits (52), Expect(2) = 2.2 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIW 723 W W + W RW W R+ +W Sbjct: 1362 WWWRRRRWRTRWWCWRWCRSGWWVW 1436 Score = 24.4 bits (47), Expect(2) = 2.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWR 831 R W WR T W WR Sbjct: 1212 RCWYRWRWWTRWWCWR 1259 Score = 26.7 bits (52), Expect(3) = 3.9 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGR 765 RWRWW W R Sbjct: 1104 RWRWWTRWWRRR 1139 Score = 24.4 bits (47), Expect(3) = 3.9 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWW 837 +RRW W + WW Sbjct: 723 RRRWTWWWCRRRPWW 767 Score = 22.6 bits (43), Expect(3) = 3.9 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRW 789 WWW RG + RW Sbjct: 1056 WWWCRSRGRARWRCWCRW 1109 Score = 27.6 bits (54), Expect(2) = 5.4 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 / +3 Query: 809 RCIRWRWWQSLWMGRWPW 756 R RW WW W W W Sbjct: 669 RWSRWWWWCRRWAWWWCW 722 Score = 22.1 bits (42), Expect(2) = 5.4 Identities = 6/15 (40%), Positives = 7/15 (46%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWR 831 RW W + WW R Sbjct: 528 RWWWWCWRRPRWWCR 572 Score = 27.2 bits (53), Expect(2) = 5.5 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = -3 / +3 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRW 762 WWR R R W WW RW Sbjct: 276 WWRRWRRWWFRWRAWSWWWPWRWVRW 353 Score = 27.2 bits (53), Expect(2) = 5.5 Identities = 10/29 (34%), Positives = 11/29 (37%) Frame = -3 / +3 Query: 788 WQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 W W RW WW R + W R W Sbjct: 582 W*WCWRRRWTWWWCRWRWRTWWWCWRRTW 668 Score = 32.7 bits (65), Expect = 5.6 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WRG R + W R RWR W W RW W Sbjct: 234 WRG*RWRPRRRRWSWWRRWRRWWFRWRAWSWWWPWRWVRW 353 Score = 32.7 bits (65), Expect = 5.6 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTR 744 WR R W WR R RWR W W WW R Sbjct: 336 WRWVRWWEGRWSWRRRRSWWWSRWRWRAW*WWWARWRSWWWPR 464 Score = 32.7 bits (65), Expect = 5.6 Identities = 18/75 (24%), Positives = 34/75 (45%) Frame = +2 / -2 Query: 656 SATILQAKTAGDQ*TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPA 835 S ++ T+ T S++ + S C+T STG+ T + CT + + Sbjct: 897 SGATTESTTSSGATTESTTSTGTSTTTESSPCTTAKPATSTGTPTKAASCTTTKSTASAS 718 Query: 836 TTNERSSTSTPSTSA 880 TT + +S +T +T + Sbjct: 717 TTTKPTSGTTTTTGS 673 Score = 32.2 bits (64), Expect = 7.7 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGRWPW 756 WWW R RWR W RW W Sbjct: 150 WWWSWRRWWCRWWFRWRAWSWRRSWRWVW 236
>LOC_Os05g44720:12005.t03960:unspliced-genomic spidroin 1, putative| Length = 1752 Score = 50.1 bits (103), Expect = 3e-05 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -3 / +3 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WR + WWW + + C WRWW W W WW Sbjct: 1581 WRWRWCCWWWWEGKSRCCCCPWWRWWCC*WWWWWWWW 1691 Score = 34.1 bits (68), Expect = 2.2 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +2 / -1 Query: 740 PSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTST 865 PS +T T +T S TTST + P TT+ +STST Sbjct: 1704 PSPPTTTTTTTTTSSTTTSTRGSSSTCSSPPTTTSSTTSTST 1579
>LOC_Os06g40020:12006.t03699:unspliced-genomic ATP-dependent RNA helicase ded-1, putative, expressed| Length = 5143 Score = 29.0 bits (57), Expect(3) = 6e-05 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +2 Query: 875 RWRGWRLKTAHWWWR 831 RW WR WWWR Sbjct: 4421 RWWWWRRLLRWWWWR 4465 Score = 28.1 bits (55), Expect(3) = 6e-05 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +2 Query: 767 RWPWWSTRRASCSIW 723 RWPWW RR W Sbjct: 4526 RWPWWLLRRRRWRWW 4570 Score = 26.3 bits (51), Expect(3) = 6e-05 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -3 / +2 Query: 809 RCIRWRWWQSLWMGRW 762 R +RW WW W W Sbjct: 4466 RLLRWWWWLLRWWPWW 4513 Score = 29.5 bits (58), Expect(2) = 0.20 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 / +2 Query: 833 RDPRGHSHRCIRWRWWQSLWMGRW 762 R P G R +RW WW+ L W Sbjct: 4388 RFPPGQWRRLLRWWWWRRLLRWWW 4459 Score = 25.4 bits (49), Expect(2) = 0.20 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = -3 / +2 Query: 788 WQSLWMGRWPWWSTRRASCS 729 W L RW WW + CS Sbjct: 4535 WWLLRRRRWRWWRPLPSKCS 4594 Score = 26.7 bits (52), Expect(2) = 2.1 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -3 / +2 Query: 875 RWRGWRLKTAHWWW 834 RW WR WWW Sbjct: 4448 RWWWWRRLLRWWWW 4489 Score = 24.4 bits (47), Expect(2) = 2.1 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -3 / +2 Query: 800 RWRWWQSL 777 RWRWW+ L Sbjct: 4556 RWRWWRPL 4579 Score = 26.3 bits (51), Expect(2) = 3.8 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 / +2 Query: 794 RWWQSLWMGRWPWWSTR 744 RWW + RW WW R Sbjct: 4448 RWWWWRRLLRWWWWLLR 4498 Score = 24.0 bits (46), Expect(2) = 3.8 Identities = 6/11 (54%), Positives = 6/11 (54%) Frame = -3 / +2 Query: 863 WRLKTAHWWWR 831 WR WWWR Sbjct: 4406 WRRLLRWWWWR 4438
>LOC_Os01g08530:12001.t00731:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1461 Score = 29.9 bits (59), Expect(3) = 1e-04 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -3 / +3 Query: 791 WWQSLWMGRWPWWSTRR 741 WW W W WW RR Sbjct: 471 WWCRGWWWHWCWWRFRR 521 Score = 27.6 bits (54), Expect(3) = 1e-04 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -3 / +3 Query: 860 RLKTAHWWWRDPRGHSHRCIRWRW 789 RL+ W W G R RWRW Sbjct: 285 RLRREWWSWWRRHGWQWRVWRWRW 356 Score = 24.9 bits (48), Expect(3) = 1e-04 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -3 / +3 Query: 878 RRWRGWR 858 RRWRGWR Sbjct: 183 RRWRGWR 203 Score = 29.0 bits (57), Expect(3) = 0.012 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 / +3 Query: 806 CIRWRWWQSLWMGRWPWW 753 C RW WW RW W Sbjct: 606 CRRWSWWWGRTRRRWNGW 659 Score = 24.0 bits (46), Expect(3) = 0.012 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRW 789 WWW R + RW W Sbjct: 546 WWWGQIRRRWNGWWRWVW 599 Score = 22.1 bits (42), Expect(3) = 0.012 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 / +3 Query: 884 CKRRWRGWRLKTAHWW 837 C+ +GWR WW Sbjct: 411 CRWWSQGWRWSRGGWW 458 Score = 34.1 bits (68), Expect(2) = 0.019 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRW 789 RW W + WW R R H C W W Sbjct: 684 RWWVWCRRGCGWWHRSWRRHGRWCQWWHW 770 Score = 24.4 bits (47), Expect(2) = 0.019 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 R R W+ W RW W Sbjct: 804 RRRCWRRRWRWRWGW 848 Score = 35.0 bits (70), Expect(2) = 0.93 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WR R W W RG WR+ + W RW WW Sbjct: 432 WRWSRGGWWRWIWWWCRGWWWHWCWWRFRRRCWCRRWSWW 551 Score = 21.7 bits (41), Expect(2) = 0.93 Identities = 8/22 (36%), Positives = 10/22 (45%) Frame = -3 / +3 Query: 776 WMGRWPWWSTRRASCSIWNSPR 711 W RW WS R +W+ R Sbjct: 1149 WWYRWRTWSGRWHWGWVWSKRR 1214 Score = 30.4 bits (60), Expect(2) = 0.94 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIW 723 RWRW + L W WW +W Sbjct: 267 RWRWRRRLRREWWSWWRRHGWQWRVW 344 Score = 22.1 bits (42), Expect(2) = 0.94 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWW 834 R W WR HW W Sbjct: 201 RCWCRWRRGWWHWRW 245 Score = 27.2 bits (53), Expect(2) = 1.3 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 / +3 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRW 789 WR + WW R H + WRW Sbjct: 276 WRRRLRREWWSWWRRHGWQWRVWRW 350 Score = 24.9 bits (48), Expect(2) = 1.3 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 +WR W+ W W W Sbjct: 330 QWRVWRWRWRWSWRW 374 Score = 28.6 bits (56), Expect(2) = 3.1 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 / +3 Query: 806 CIRWRWWQSLWMGRWPWW 753 C RW WW RW W Sbjct: 531 CRRWSWWWGQIRRRWNGW 584 Score = 22.1 bits (42), Expect(2) = 3.1 Identities = 7/19 (36%), Positives = 8/19 (42%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRWW 786 WW + R RW WW Sbjct: 417 WWSQGWRWSRGGWWRWIWW 473 Score = 32.7 bits (65), Expect = 5.6 Identities = 21/54 (38%), Positives = 27/54 (50%) Frame = +2 / -1 Query: 704 SSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTST 865 S+S SK STK T PS SA+TST +P ATT+ + T+T Sbjct: 363 STSTSTSKPATATHASSTKTTTPS*ASASTSTSTQTTCSPTASATTHAATYTNT 202
>LOC_Os07g32710:12007.t02953:unspliced-genomic expressed protein| Length = 1402 Score = 33.6 bits (67), Expect(3) = 1e-04 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 RWR W+ W GRW W Sbjct: 666 RWRVWRRRWHGRWRW 710 Score = 24.9 bits (48), Expect(3) = 1e-04 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWW 837 RWR W L WW Sbjct: 501 RWRRWWLWRRRWW 539 Score = 24.0 bits (46), Expect(3) = 1e-04 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRWWQ 783 W W R + R RWR W+ Sbjct: 594 WRWSGRRRRNGRRWRWRVWR 653 Score = 31.8 bits (63), Expect(2) = 0.11 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = -3 / +3 Query: 848 AHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWN 720 + WW R + + R RWR W W W R IW+ Sbjct: 453 SRWWCRRWKWYGRRAWRWRRWWLWRRRWWRAWWWRWQGRRIWS 581 Score = 28.1 bits (55), Expect(2) = 0.11 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWW 834 R WR WRL+ WW Sbjct: 195 RIWRRWRLRRRRRWW 239 Score = 38.2 bits (77), Expect = 0.12 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = -3 / +3 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WR + WW R H R RW W W RW W Sbjct: 702 WRWRRRRSWWWWWRRHGWRRRRWNGWWRRWRFRWWSW 812 Score = 28.1 bits (55), Expect(2) = 0.38 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWR 831 RWR R ++ WWWR Sbjct: 699 RWRWRRRRSWWWWWR 743 Score = 25.8 bits (50), Expect(2) = 0.38 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 / +3 Query: 833 RDPRGHSHRCIRWRWWQSLWMGRWPW 756 R R R R R W+ W+G W W Sbjct: 837 RRSRRRRWRWPRRRRWRRWWLGWWCW 914 Score = 28.1 bits (55), Expect(2) = 0.94 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = -3 / +3 Query: 824 RGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 RG R R +W W RW W+ R W R W Sbjct: 414 RGWWWRWSRRWFWSRWWCRRWKWYGRRAWRWRRWWLWRRRW 536 Score = 24.4 bits (47), Expect(2) = 0.94 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHR 807 W WR+ W WR R R Sbjct: 243 WWRWRVWRRRWRWRRRRSRRRR 308 Score = 33.1 bits (66), Expect(2) = 2.2 Identities = 14/50 (28%), Positives = 17/50 (34%) Frame = -3 / +3 Query: 860 RLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPR 711 R + W W R + W W+ W RW W TR W R Sbjct: 840 RSRRRRWRWPRRRRWRRWWLGWWCWRRPWPWRWTRWRTRARRRPWWGRLR 989 Score = 22.1 bits (42), Expect(2) = 2.2 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHW 840 RWR WR + W Sbjct: 636 RWRVWRRRGQRW 671
>LOC_Os04g52540:12004.t04728:unspliced-genomic eukaryotic translation initiation factor 2C 2, putative, expressed| Length = 4249 Score = 31.3 bits (62), Expect(3) = 1e-04 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIW 723 R RWW +W R WW R +W Sbjct: 303 RRRWWTWVWRRRRRWWVRVRRWAWVW 380 Score = 25.8 bits (50), Expect(3) = 1e-04 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWW 834 RRWR W + W W Sbjct: 162 RRWRRWSRRRLWWCW 206 Score = 24.9 bits (48), Expect(3) = 1e-04 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 / +3 Query: 848 AHWWWRDPRGHSHRCIRWRWWQSLW 774 A WWW R + R RW + W Sbjct: 240 ASWWWWWTRVRARRRAWVRWRRRRW 314 Score = 28.6 bits (56), Expect(2) = 0.87 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = -3 / +3 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWR 792 W + WWW R +RWR Sbjct: 231 WAWASWWWWWTRVRARRRAWVRWR 302 Score = 24.0 bits (46), Expect(2) = 0.87 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRWPWWSTRR 741 WR W + + RW W RR Sbjct: 378 WRRWTWV*IRRWAWTWRRR 434 Score = 25.8 bits (50), Expect(2) = 6.8 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWW 834 RRW RL WWW Sbjct: 171 RRWSRRRLWWCWWWW 215 Score = 23.5 bits (45), Expect(2) = 6.8 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRWWQSLW 774 W WR R R RW W W Sbjct: 321 WVWRRRRRWWVRVRRWAWVWRRW 389
>LOC_Os07g32680:12007.t02950:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1424 Score = 47.3 bits (97), Expect = 2e-04 Identities = 18/44 (40%), Positives = 20/44 (45%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTR 744 RW WR WWWR R RWR W+ LW W W +R Sbjct: 532 RWCRWRRGWWSWWWRRLWWWWRRWPRWRAWRRLWRWCWCRWWSR 663 Score = 36.3 bits (73), Expect(2) = 0.007 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = -3 / +1 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 W W + WW R PR + R + W W W WW Sbjct: 559 WSWWWRRLWWWWRRWPRWRAWRRLWRWCWCRWWSRWWRWW 678 Score = 27.6 bits (54), Expect(2) = 0.007 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -3 / +1 Query: 776 WMGRWPWWSTRRASCSIWNSPRSCW 702 W R PWW +RR S CW Sbjct: 1009 WWRRRPWWWSRRRVWSWCRRRWRCW 1083 Score = 29.9 bits (59), Expect(2) = 0.026 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = -3 / +1 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIWNSPR 711 W W S W W WW R W PR Sbjct: 643 WCRWWSRWWRWWGWWVWRWRRQRAWWWPR 729 Score = 28.1 bits (55), Expect(2) = 0.026 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWWR 831 +R W W + WWWR Sbjct: 547 RRGWWSWWWRRLWWWWR 597 Score = 30.9 bits (61), Expect(2) = 0.047 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 / +1 Query: 887 ICKRRWRGWRLKTAHWWWR 831 I +R W WR + WWWR Sbjct: 940 IWRRCWCWWRCRWRCWWWR 996 Score = 26.3 bits (51), Expect(2) = 0.047 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -3 / +1 Query: 809 RCIRWRWWQSLWMGRWPWWSTRR 741 RC WR W R WWS RR Sbjct: 979 RCWWWRRIWWWWRRRPWWWSRRR 1047 Score = 34.5 bits (69), Expect(2) = 0.064 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 / +1 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIW 723 W WR R IR WW W+ W W RR S W Sbjct: 451 WRWRWLWRRRWRRIRRWWWPWWWVWCWRWCRWRRGWWSWW 570 Score = 22.1 bits (42), Expect(2) = 0.064 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHW 840 +RRW WR + W Sbjct: 370 RRRWAWWRTRWRVW 411 Score = 28.6 bits (56), Expect(2) = 0.94 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRW 762 R RWW+ +W RW Sbjct: 871 RCRWWRRIWWRRW 909 Score = 24.0 bits (46), Expect(2) = 0.94 Identities = 9/26 (34%), Positives = 10/26 (38%) Frame = -3 / +1 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWW 786 W + W R H R WRWW Sbjct: 721 WPRRWVWCWRRSWWWHWWRWRLWRWW 798 Score = 34.1 bits (68), Expect(2) = 1.6 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -3 / +1 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLW 774 W WR + WWW PR + + W W W Sbjct: 763 WHWWRWRLWRWWWWRPRWWTWWRLWWWSWCWQW 861 Score = 21.7 bits (41), Expect(2) = 1.6 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = -3 / +1 Query: 797 WRWWQSLWMGRWPWWSTRR 741 WR W RW W RR Sbjct: 943 WRRCWCWWRCRWRCWWWRR 999 Score = 29.0 bits (57), Expect(2) = 3.0 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -3 / +1 Query: 809 RCIRWRWWQSLWMGRWPWW 753 R RW WW+ W W W Sbjct: 781 RLWRWWWWRPRWWTWWRLW 837 Score = 25.8 bits (50), Expect(2) = 3.0 Identities = 11/30 (36%), Positives = 11/30 (36%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWW 786 R R W WWWR R WR W Sbjct: 202 RRRLWWGWWVRWWWRWRARWRWRWTWWRTW 291 Score = 29.0 bits (57), Expect(2) = 4.0 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -3 / +1 Query: 797 WRWWQSLWMGRWPWWSTRR 741 W WW W + WW RR Sbjct: 676 WGWWVWRWRRQRAWWWPRR 732 Score = 25.4 bits (49), Expect(2) = 4.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWW 834 +RRWR R WWW Sbjct: 472 RRRWRRIRRWWWPWWW 519 Score = 26.7 bits (52), Expect(2) = 5.6 Identities = 6/13 (46%), Positives = 6/13 (46%) Frame = -3 / +1 Query: 791 WWQSLWMGRWPWW 753 WW W W WW Sbjct: 556 WWSWWWRRLWWWW 594 Score = 23.1 bits (44), Expect(2) = 5.6 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWWR 831 RW GW W WR Sbjct: 430 RWCGWWAWRWRWLWR 474 Score = 32.7 bits (65), Expect = 5.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 / +1 Query: 797 WRWWQSLWMGRWPWWST 747 W W++ W RW WW T Sbjct: 238 WWRWRARWRWRWTWWRT 288 Score = 32.7 bits (65), Expect = 5.6 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = -3 / +1 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRR 741 W + WWW R S RWR W W W RR Sbjct: 1006 WWWRRRPWWWSRRRVWSWCRRRWRCWWRCWWWWRLWRRWRR 1128
>LOC_Os01g07070:12001.t00587:unspliced-genomic loricrin, putative, expressed| Length = 5483 Score = 38.2 bits (77), Expect(2) = 5e-04 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 / +1 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WW RG R ++ RWW+ W+ PWW Sbjct: 1315 WWWHWRGRKRRRLQ*RWWR*SWI**PPWW 1401 Score = 25.8 bits (50), Expect(2) = 5e-04 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 / +1 Query: 872 WRGWRLKTAHW 840 WRGWRL++ W Sbjct: 1216 WRGWRLQSWWW 1248 Score = 29.0 bits (57), Expect(2) = 0.35 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -3 / +1 Query: 872 WRGWRLKTAHWWW 834 WR W T WWW Sbjct: 1747 WRPWCTSTLSWWW 1785 Score = 24.9 bits (48), Expect(2) = 0.35 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = -3 / +1 Query: 803 IRWRWWQSLWMGRW 762 + W WW W RW Sbjct: 1771 LSWWWWWWWWRRRW 1812 Score = 28.6 bits (56), Expect(2) = 9.5 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPWW 753 RWRW Q W WW Sbjct: 1264 RWRWLQQRWRRLQLWW 1311 Score = 26.3 bits (51), Expect(2) = 9.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWW 786 RWR R W R R C RW WW Sbjct: 187 RWRRRRPWEGRWRRRRGRIWWWWCGRWIWW 276
>LOC_Os07g25810:12007.t02277:unspliced-genomic expressed protein| Length = 1681 Score = 27.6 bits (54), Expect(3) = 5e-04 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 RWR W W G W W Sbjct: 624 RWRSWWRHW*GWWTW 668 Score = 26.7 bits (52), Expect(3) = 5e-04 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 / +3 Query: 887 ICKRRWRGWRLKTAHWWW 834 I +R W W + HWWW Sbjct: 561 IWQRWWFRWWHWSWHWWW 614 Score = 25.8 bits (50), Expect(3) = 5e-04 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 / +3 Query: 770 GRWPWWSTRRASCSIWNSPRSCWLSIDLRRSW 675 GRW W RR+ W S W R +W Sbjct: 795 GRWRTWWRRRSWWRHWEGWWSWWRHWQRRWTW 890 Score = 41.8 bits (85), Expect(2) = 5e-04 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 R W WR W W R R I RWW W W WW Sbjct: 486 RWWIWWRFW*RRWDWWRHRTWCWRWIWQRWWFRWWHWSWHWW 611 Score = 22.1 bits (42), Expect(2) = 5e-04 Identities = 9/30 (30%), Positives = 10/30 (33%) Frame = -3 / +3 Query: 764 WPWWSTRRASCSIWNSPRSCWLSIDLRRSW 675 W WW T S W W R+ W Sbjct: 696 WGWWRTWWRRWSWWWHWEGRWTWWWFRKRW 785 Score = 35.9 bits (72), Expect(3) = 0.007 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRW 762 WR W WW R R W WW+ W RW Sbjct: 285 WRLWERWWLWRWWWRRRRRWLRRWWWVWWRRWWRARW 395 Score = 24.0 bits (46), Expect(3) = 0.007 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = -3 / +3 Query: 770 GRWPWWSTRRASCSIWNSPRSCWLSIDLRRSW 675 GRW W + + W S W RRSW Sbjct: 1041 GRWRSWWRQWSRWRYWEGWWSRWQLW*RRRSW 1136 Score = 23.5 bits (45), Expect(3) = 0.007 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = -3 / +3 Query: 776 WMGRWPWW 753 W G W WW Sbjct: 972 WQGWWNWW 995 Score = 34.5 bits (69), Expect(2) = 0.010 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLW 774 W+ WR W W R + RWR+W+ W Sbjct: 1002 WKRWRSWGWWWTWGRWRSWWRQWSRWRYWEGWW 1100 Score = 24.9 bits (48), Expect(2) = 0.010 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = -3 / +3 Query: 776 WMGRWPWWSTRRASCSIWNSPRSCW 702 W RW W RR+ +W + W Sbjct: 1095 WWSRWQLW*RRRSWWWLWQGWWNWW 1169 Score = 31.3 bits (62), Expect(2) = 0.019 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWWSTR 744 RW W W RW WW R Sbjct: 486 RWWIWWRFW*RRWDWWRHR 542 Score = 27.2 bits (53), Expect(2) = 0.019 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWRDPRG 819 R WR W L+ W W+ RG Sbjct: 390 RWWRRWWLRRRWWVWQRRRG 449 Score = 29.5 bits (58), Expect(3) = 0.39 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 / +3 Query: 812 HRCIRWRWWQSLWMGRWPWWS 750 HR WRW W RW WS Sbjct: 537 HRTWCWRWIWQRWWFRWWHWS 599 Score = 25.8 bits (50), Expect(3) = 0.39 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = -3 / +3 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWW 786 WRL W WR R +R WW Sbjct: 285 WRLWERWWLWRWWWRRRRRWLRRWWW 362 Score = 21.7 bits (41), Expect(3) = 0.39 Identities = 7/22 (31%), Positives = 10/22 (45%) Frame = -3 / +3 Query: 767 RWPWWSTRRASCSIWNSPRSCW 702 RW +W + +W RS W Sbjct: 1074 RWRYWEGWWSRWQLW*RRRSWW 1139 Score = 30.4 bits (60), Expect(2) = 1.4 Identities = 13/46 (28%), Positives = 15/46 (32%) Frame = -3 / +3 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 WW R R W +W W W W R S W + W Sbjct: 849 WWSWWRHWQRRWTWWWFW*RWWSWGWWWTWWGRGRWSRWRHWQGWW 986 Score = 25.8 bits (50), Expect(2) = 1.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWW 834 RRW WR +T W W Sbjct: 516 RRWDWWRHRTWCWRW 560 Score = 30.9 bits (61), Expect(2) = 6.2 Identities = 11/34 (32%), Positives = 13/34 (38%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLW 774 RW W + W W R R WR W+ W Sbjct: 753 RWTWWWFRKRWWSWGRWRTWWRRRSWWRHWEGWW 854 Score = 23.1 bits (44), Expect(2) = 6.2 Identities = 6/17 (35%), Positives = 8/17 (47%) Frame = -3 / +3 Query: 791 WWQSLWMGRWPWWSTRR 741 WW+ W WW R+ Sbjct: 1212 WWRRWWRWWRIWWRWRQ 1262 Score = 29.9 bits (59), Expect(2) = 8.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWW 753 R R W LW G W WW Sbjct: 1122 RRRSWWWLWQGWWNWW 1169 Score = 23.5 bits (45), Expect(2) = 8.3 Identities = 5/13 (38%), Positives = 8/13 (61%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWW 834 WR W+ + WW+ Sbjct: 861 WRHWQRRWTWWWF 899
>LOC_Os01g41120:12001.t03634:unspliced-genomic protein binding protein, putative, expressed| Length = 2099 Score = 46.0 bits (94), Expect = 6e-04 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = -3 / -1 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 W + WWWR R RWRWW W R WW Sbjct: 1427 WWRRRWRWWWRRRRRGRRWRRRWRWWWWRWRRR*RWW 1317 Score = 29.9 bits (59), Expect(2) = 0.034 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 / -1 Query: 824 RGHSHRCIRWRWWQSLWMGRW 762 R R RWRWW+ W W Sbjct: 1460 RWRRRRWRRWRWWRRRWRWWW 1398 Score = 27.6 bits (54), Expect(2) = 0.034 Identities = 9/25 (36%), Positives = 9/25 (36%) Frame = -3 / -1 Query: 776 WMGRWPWWSTRRASCSIWNSPRSCW 702 W RW WW RR W W Sbjct: 1424 WRRRWRWWWRRRRRGRRWRRRWRWW 1350 Score = 24.9 bits (48), Expect(3) = 0.20 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = -3 / -1 Query: 860 RLKTAHWWWRDPRGHSHRCIRWRW 789 R HW WR R R R RW Sbjct: 1481 RRAVVHWRWRRRRWRRWRWWRRRW 1410 Score = 23.1 bits (44), Expect(3) = 0.20 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = -3 / -1 Query: 776 WMGRWPWW 753 W RW WW Sbjct: 1373 WRRRWRWW 1350 Score = 22.6 bits (43), Expect(3) = 0.20 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = -3 / -1 Query: 800 RWRWW 786 RWRWW Sbjct: 1415 RWRWW 1401 Score = 37.3 bits (75), Expect = 0.23 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 / -1 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIRWRWW 786 RRWR WR + WW R RG R WW Sbjct: 1439 RRWRWWRRRWRWWWRRRRRGRRWRRRWRWWW 1347 Score = 34.5 bits (69), Expect = 1.6 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -3 / -1 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTR 744 RWR R + WW R R R R R W+ W W W R Sbjct: 1460 RWRRRRWRRWRWWRRRWRWWWRRRRRGRRWRRRWRWWWWRWRRR 1329 Score = 32.7 bits (65), Expect = 5.6 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -3 / -1 Query: 881 KRRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGR 765 +RRWR WR W W R R R RW W R Sbjct: 1451 RRRWRRWRWWRRRWRWWWRRRRRGRRWRRRWRWWWWRWR 1335
>LOC_Os06g21140:12006.t01931:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 994 Score = 36.3 bits (73), Expect(2) = 7e-04 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGRWPW 756 WWW R R +RW W+ W+ W W Sbjct: 573 WWW*RLRRWIRRWLRWWIWRWQWLWWWRW 659 Score = 27.2 bits (53), Expect(2) = 7e-04 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 / +3 Query: 863 WRLKTAHWWWR 831 WRL+TA WWR Sbjct: 417 WRLRTAWIWWR 449
>LOC_Os01g54714:12001.t04887:unspliced-genomic conserved hypothetical protein| Length = 5956 Score = 32.7 bits (65), Expect(2) = 0.001 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWW 786 R R W+ WWW+ R H RWR W Sbjct: 5443 RRRWWKRWWRWWWWKYWRRHRGVHRRWRTW 5532 Score = 29.9 bits (59), Expect(2) = 0.001 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = -3 / +1 Query: 803 IRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 +R RWW+ W W RR C R CW Sbjct: 5605 LRRRWWRVPWRRLWWNNRRRRWRCCWSRRRRCCW 5706
>LOC_Os12g38810:12012.t03561:unspliced-genomic expressed protein| Length = 1490 Score = 27.6 bits (54), Expect(3) = 0.002 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -3 / +2 Query: 800 RWRWWQSLWMGRWPWW 753 RW W W PWW Sbjct: 827 RWPWGSPPWSATSPWW 874 Score = 27.2 bits (53), Expect(3) = 0.002 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 / +2 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIR 798 RR WR +T WW R S C R Sbjct: 626 RRAGAWRARTRRWWRRTCSARS*CCPR 706 Score = 23.5 bits (45), Expect(3) = 0.002 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = -3 / +2 Query: 761 PWWSTRRASCSIWNSPRSCWLSIDLRR 681 P W +R S W R C S RR Sbjct: 950 PRWRSRSRPTSAWPPRRRCSSSASCRR 1030
>LOC_Os10g31330:12010.t02459:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 1267 Score = 29.9 bits (59), Expect(3) = 0.002 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / +1 Query: 797 WRWWQSLWMGRWPWWSTR 744 W WW+ W RW W R Sbjct: 547 W*WWRRWWWPRWWCWRLR 600 Score = 26.3 bits (51), Expect(3) = 0.002 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWWR 831 +RRWR W WW R Sbjct: 310 RRRWRWWWW*RRRWWLR 360 Score = 22.1 bits (42), Expect(3) = 0.002 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = -3 / +1 Query: 809 RCIRWRWW 786 RC RWR W Sbjct: 412 RCCRWRVW 435 Score = 36.8 bits (74), Expect = 0.32 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = -3 / +1 Query: 860 RLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 R + WWW R R I +W +W GRW W R + W R W Sbjct: 307 RRRRWRWWWW*RRRWWLRWIGLWFWFWVW*GRW*WRCCRWRVWAWWRRRRRWW 465 Score = 25.8 bits (50), Expect(2) = 3.1 Identities = 8/25 (32%), Positives = 9/25 (36%) Frame = -3 / +1 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIW 723 W W W RW W R +W Sbjct: 652 WWWLWKWWRWRWRWRPRWRLRLWLW 726 Score = 24.9 bits (48), Expect(2) = 3.1 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWW 834 RW WRL+ W W Sbjct: 577 RWWCWRLRARVWLW 618
>LOC_Os04g59440:12004.t05401:unspliced-genomic photosystem II 22 kDa protein, chloroplast precursor, putative,| expressed Length = 1126 Score = 31.3 bits (62), Expect(3) = 0.002 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 / +3 Query: 770 GRWPWWSTRRASCSIWNSPRSCWLSIDLRRS 678 G WP W +RR S + + R+ W S RR+ Sbjct: 396 GGWPCWGSRRPSSARRSPARASWRSSTWRRA 488 Score = 24.4 bits (47), Expect(3) = 0.002 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRW 795 WWWR R RW Sbjct: 255 WWWRRSRAEPRLPPRW 302 Score = 22.6 bits (43), Expect(3) = 0.002 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWW 834 RRW R + WWW Sbjct: 216 RRWFSCRG*RSIWWW 260
>LOC_Os03g14620:12003.t01251:unspliced-genomic expressed protein| Length = 1470 Score = 38.6 bits (78), Expect(3) = 0.002 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQ 783 WR WR WWW G R + WR W+ Sbjct: 786 WRRWRRHRRWWWWHRRHGSWGRRLCWRRWR 875 Score = 24.4 bits (47), Expect(3) = 0.002 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 / +3 Query: 767 RWPWWSTRRASCSIW 723 RW WW R S W Sbjct: 1224 RWWWWHRRHGSWGRW 1268 Score = 22.1 bits (42), Expect(3) = 0.002 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = -3 / +3 Query: 794 RWWQSLWMGRWPWW 753 RW + W G W W Sbjct: 963 RWRRHRWHGSWGRW 1004 Score = 34.1 bits (68), Expect = 2.2 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRW 795 WR WR WWW G R + W Sbjct: 1200 WRRWRRHRRWWWWHRRHGSWGRWLHW 1277
>LOC_Os06g09870:12006.t00865:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 1107 Score = 32.2 bits (64), Expect(2) = 0.002 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 / +3 Query: 887 ICKRRWRGWRLKTAHWWW 834 +C RRWR WR + WW Sbjct: 351 LCSRRWRWWRRRRWTKWW 404 Score = 29.5 bits (58), Expect(2) = 0.002 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWW 753 RWR W+ W +W +W Sbjct: 489 RWRRWRRRWWSKWWFW 536 Score = 33.1 bits (66), Expect(2) = 0.035 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 / +3 Query: 887 ICKRRWRGWRLKTAHWWW 834 IC RRWR WR + WW Sbjct: 477 ICSRRWRRWRRRWWSKWW 530 Score = 24.4 bits (47), Expect(2) = 0.035 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWM 771 WWW R + +R W S W+ Sbjct: 627 WWWTKWRVRVWLRLWFRIWSSWWI 698 Score = 28.6 bits (56), Expect(2) = 0.53 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWN 720 RWRWW+ +W W R +W+ Sbjct: 363 RWRWWRRRRWTKWWVWVWFRFRFWLWS 443 Score = 24.9 bits (48), Expect(2) = 0.53 Identities = 6/15 (40%), Positives = 7/15 (46%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWR 831 +W W WWWR Sbjct: 213 KWTRWVC*WRRWWWR 257
>LOC_Os07g32700:12007.t02952:unspliced-genomic conserved hypothetical protein| Length = 891 Score = 34.5 bits (69), Expect(2) = 0.002 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -3 / +3 Query: 848 AHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWN 720 + WW R + + R RWR W RW W R +W+ Sbjct: 438 SRWWCRRWKWYGRRAWRWRRWWFWRRWRWRDWWWRWQGRRVWS 566 Score = 27.2 bits (53), Expect(2) = 0.002 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWWWR 831 +RRW R + WWWR Sbjct: 366 RRRWLWRR*RRRGWWWR 416 Score = 28.1 bits (55), Expect(2) = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 / +3 Query: 836 WRDPRGHSHRCIRWRWWQSLWMGRWPW 756 WR R R RWR W W GR W Sbjct: 483 WRWRRWWFWRRWRWRDWWWRWQGRRVW 563 Score = 27.6 bits (54), Expect(2) = 1.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWWW 834 +R WR WR++ WW Sbjct: 192 RRVWRRWRIQRRRRWW 239 Score = 27.2 bits (53), Expect(2) = 2.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 RWR W+ GRW W Sbjct: 651 RWRVWRRWCHGRWCW 695 Score = 24.0 bits (46), Expect(2) = 2.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWWWR 831 +R W R + WWWR Sbjct: 492 RRWWFWRRWRWRDWWWR 542
>LOC_Os07g11310:12007.t01005:unspliced-genomic alpha-amylase inhibitor 5, putative, expressed| Length = 690 Score = 32.7 bits (65), Expect(2) = 0.004 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = -2 / +2 Query: 246 RGSSPRCCGASGTACTRSCRDGFA*SRGPW 157 RG+ CCG + A R C G A S G W Sbjct: 227 RGAGRTCCGGAAAATRRGCGRGAATS*GRW 316 Score = 31.3 bits (62), Expect(2) = 0.004 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = -3 / +2 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCWLSIDLRRSW 675 W R R RWRWW+ W P RA+ S + R+ + R+W Sbjct: 44 WRRRTASSRCRRWRWRWWR*WWWWSAPSSRRLRAARSTTAASRARRMGASRGRAW 208
>LOC_Os06g51440:12006.t04827:unspliced-genomic expressed protein| Length = 956 Score = 34.1 bits (68), Expect(2) = 0.004 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRW 789 +WR WR WWWR H W W Sbjct: 294 QWRWWRWWLRRWWWRQLWKRWHGFRVWWW 380 Score = 30.4 bits (60), Expect(2) = 0.004 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 / +3 Query: 794 RWWQSLWMGRWPWW 753 R WQ +W+ W WW Sbjct: 585 RLWQRIWLRWWSWW 626 Score = 40.5 bits (82), Expect = 0.025 Identities = 18/59 (30%), Positives = 22/59 (37%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCWLS 696 W W + W W R R +WRWWQ W R W + C +W W S Sbjct: 444 WWIWLWQRWLWIWLW*RLWLRRRCKWRWWQRRWWWRRWWSLRIQVWCRLWQRIWLRWWS 620 Score = 26.3 bits (51), Expect(2) = 1.7 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIWN 720 W W S W W W R WN Sbjct: 603 WLRWWSWWWRWWCGWRWGRRELQRWN 680 Score = 25.4 bits (49), Expect(2) = 1.7 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWR 831 RR WR WWWR Sbjct: 504 RRRCKWRWWQRRWWWR 551 Score = 25.4 bits (49), Expect(2) = 4.3 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 RWR W+ W W W Sbjct: 417 RWRSWRRGWWWIWLW 461 Score = 24.9 bits (48), Expect(2) = 4.3 Identities = 10/31 (32%), Positives = 13/31 (41%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQ 783 RW W L+ W R H R W W++ Sbjct: 300 RWWRWWLRRWWWRQLWKRWHGFRVWWWLWFR 392 Score = 27.2 bits (53), Expect(2) = 7.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = -3 / +3 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRR 741 W R CIR W W RW W RR Sbjct: 228 WVWQRRRRRQWCIRPGLWLWFWQWRWWRWWLRR 326 Score = 22.1 bits (42), Expect(2) = 7.7 Identities = 6/17 (35%), Positives = 8/17 (47%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWRDP 825 RW W+ + WW P Sbjct: 105 RWWVWQRRRRRQWWIRP 155
>LOC_Os03g48260:12003.t04183:unspliced-genomic expressed protein| Length = 5287 Score = 35.4 bits (71), Expect(2) = 0.004 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -3 / +1 Query: 791 WWQSLWMGRWPWW 753 WW+ W+ WPWW Sbjct: 4831 WWRRRWLPEWPWW 4869 Score = 25.4 bits (49), Expect(2) = 0.004 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = -3 / +1 Query: 863 WRLKTAHWWWR 831 WR+ WWWR Sbjct: 4807 WRVPEWSWWWR 4839
>LOC_Os01g08470:12001.t00725:unspliced-genomic protein binding protein, putative, expressed| Length = 2275 Score = 35.4 bits (71), Expect(2) = 0.004 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -3 / -2 Query: 794 RWWQSLWMGRWPWWSTRRASCSIW 723 R W+ W RW WW RR C W Sbjct: 1395 RRWRRWWRWRWRWW*RRRR*CRRW 1324 Score = 25.4 bits (49), Expect(2) = 0.004 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 / -2 Query: 878 RRWRGWRLKTAHWWWRDPR 822 R+ R WR++ WWR R Sbjct: 1479 RQLRTWRMRLWRGWWRRRR 1423 Score = 26.3 bits (51), Expect(2) = 3.0 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -3 / -2 Query: 806 CIRWRWWQSLWMGRWPWWSTRR 741 C RWRW W R W RR Sbjct: 1335 CRRWRWGWRRWRRRRR*WWWRR 1270 Score = 24.4 bits (47), Expect(2) = 3.0 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -3 / -2 Query: 878 RRWRGWRLKTAHWWWRDPR 822 RRWR W WW R R Sbjct: 1395 RRWRRWWRWRWRWW*RRRR 1339
>LOC_Os09g17020:12009.t01489:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 4532 Score = 30.9 bits (61), Expect(2) = 0.005 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWWW 834 +R WR WR WWW Sbjct: 822 QRWWRQWRSTELRWWW 869 Score = 29.5 bits (58), Expect(2) = 0.005 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 803 IRWRWWQSLWMGRWPW 756 +RW W LW RW W Sbjct: 855 LRWWWLWELWRRRWLW 902
>LOC_Os11g43640:12011.t03894:unspliced-genomic extensin-like protein, putative| Length = 2882 Score = 40.9 bits (83), Expect(2) = 0.006 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -3 / -3 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTR 744 R W G + + WWR R + +RWW++LW RW S R Sbjct: 1737 RLWWGRCVALWYRWWRVRGRRRRRGLPFRWWRALWSCRWGVLSRR 1603 Score = 24.4 bits (47), Expect(2) = 0.006 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 / -2 Query: 761 PWWSTRRASCSIWNSPRSCW 702 PW +RRA CS S R+ W Sbjct: 886 PWARSRRACCS*S*SRRAFW 827
>LOC_Os01g33740:12001.t02939:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5844 Score = 42.3 bits (86), Expect = 0.007 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -3 / +1 Query: 821 GHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNS 717 G + R + W WW+S W+ R PWW R S W S Sbjct: 4879 GINARMVWWIWWKSWWLWRKPWW*RR*PWRSHWRS 4983
>LOC_Os07g40130:12007.t03674:unspliced-genomic transcriptional regulatory protein algP, putative| Length = 2024 Score = 34.1 bits (68), Expect(2) = 0.008 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 / -2 Query: 764 WPWWSTRRASCSIWNSPRSCW 702 W WW+ RRA S W P + W Sbjct: 160 WWWWAPRRARASSWRRPVAWW 98 Score = 25.8 bits (50), Expect(2) = 0.008 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -3 / -2 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWS 750 WR R + R+PR R W GR PWW+ Sbjct: 391 WRAPRRRGKEATRREPRPGETRPAAGWPWPPWAPGRVPWWT 269
>LOC_Os06g21270:12006.t01944:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 991 Score = 30.4 bits (60), Expect(2) = 0.008 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -3 / +2 Query: 797 WRWWQSLWMGRWPWWSTRRA 738 WRWW S W WW R A Sbjct: 713 WRWWLSWWWILRWWWWWRMA 772 Score = 29.5 bits (58), Expect(2) = 0.008 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -3 / +2 Query: 875 RWRGWRLKTAHWWWRDPR 822 RW WR+ WWWR R Sbjct: 545 RWIWWRIWWWWWWWRRRR 598
>LOC_Os07g48910:12007.t04519:unspliced-genomic collagen-like protein 2, putative, expressed| Length = 1705 Score = 33.6 bits (67), Expect(2) = 0.010 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 / +1 Query: 791 WWQSLWMGRWPWWS 750 WW+ W RW WWS Sbjct: 418 WWRKRWRPRWWWWS 459 Score = 25.8 bits (50), Expect(2) = 0.010 Identities = 10/32 (31%), Positives = 12/32 (37%) Frame = -3 / +1 Query: 869 RGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLW 774 R W + WW R H R W W+ W Sbjct: 268 RWWIWRGRWWWSWPWRRHWRRVWWWERWRLRW 363 Score = 34.1 bits (68), Expect(2) = 0.019 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = -3 / +1 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 W R R S R RWR W W PW R W W Sbjct: 703 WRRWSRRRSRRWCRWRRWSRRWCWWRPWRRRRSRRWCRWRRRCGWW 840 Score = 24.4 bits (47), Expect(2) = 0.019 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWW 834 RW WR ++ W W Sbjct: 619 RWFRWRRRSRRWCW 660 Score = 38.6 bits (78), Expect = 0.090 Identities = 20/69 (28%), Positives = 23/69 (33%) Frame = -3 / +1 Query: 884 CKRRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSC 705 C+ W + W R RC RW W W R W R C W+ R Sbjct: 523 CRCWWWSGSGRRCWWRRWSRRWSRRRCRRWSWRWFRWRRRSRRWCWWRRRCWWWSGRRCR 702 Query: 704 WLSIDLRRS 678 W RRS Sbjct: 703 WRRWSRRRS 729 Score = 29.0 bits (57), Expect(2) = 0.69 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -3 / +1 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASC 732 WW RG R WRW + R WWS C Sbjct: 451 WWSWWRRGRRCRRRSWRWSRRRRRCRCWWWSGSGRRC 561 Score = 27.6 bits (54), Expect(2) = 0.69 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWNSPR 711 RW WW+ R W R C W+ R Sbjct: 763 RWCWWRPWRRRRSRRWCRWRRRCGWWSGRR 852 Score = 25.4 bits (49), Expect(2) = 0.69 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / +1 Query: 878 RRWRGWRLKTAHWWWRDP 825 RRW WR + W W P Sbjct: 730 RRWCRWRRWSRRWCWWRP 783 Score = 24.0 bits (46), Expect(2) = 0.69 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -3 / +1 Query: 872 WRGWRLKTAHWWWR 831 W WR +T W WR Sbjct: 370 WCWWRDRTWRWRWR 411 Score = 28.6 bits (56), Expect(2) = 2.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = -3 / +1 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WW R S R RWR W RW W Sbjct: 658 WWRRRCWWWSGRRCRWRRWSRRRSRRWCRW 747 Score = 22.6 bits (43), Expect(2) = 2.3 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWW 834 RW R + WWW Sbjct: 499 RWSRRRRRCRCWWW 540 Score = 30.4 bits (60), Expect(2) = 6.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 RW + W RW W RR C W R W Sbjct: 943 RWFRRRQRWRLRWWWRRWRRRRCRRWLRRRQGW 1041 Score = 23.5 bits (45), Expect(2) = 6.3 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = -3 / +1 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQSLW 774 WR + W R R S R RWR W Sbjct: 565 WRRWSRRWSRRRCRRWSWRWFRWRRRSRRW 654
>LOC_Os03g64010:12003.t005811:unspliced-genomic expressed protein| Length = 666 Score = 41.4 bits (84), Expect = 0.013 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 / +3 Query: 848 AHWWWRDPRGHSHRCIRWRWWQ 783 + WWWR R C+RWRWW+ Sbjct: 348 SRWWWRR*RPRPLFCLRWRWWR 413
>LOC_Os04g37980:12004.t03368:unspliced-genomic sugar transport protein 5, putative, expressed| Length = 2706 Score = 33.1 bits (66), Expect(2) = 0.014 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 / +3 Query: 866 GWRLKTAHWWWRDPRGHSHRCIRWRWWQS 780 GWR W R R RWRWW+S Sbjct: 2139 GWRGSWGRRWGRTGRRRWRGRTRWRWWRS 2225 Score = 30.9 bits (61), Expect(2) = 0.014 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 / +3 Query: 273 SGAASPACARGSSPRCCGASGTA 205 S +ASP+C R S C SGTA Sbjct: 2340 SASASPSCRRSRSSPCSAGSGTA 2408
>LOC_Os06g41740:12006.t03866:unspliced-genomic expressed protein| Length = 966 Score = 31.3 bits (62), Expect(2) = 0.014 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 / +3 Query: 869 RGWRLKTAHWWWRDPRGHSHRCIRWRWW 786 R W + WWWR R R R RWW Sbjct: 258 RRWWWRGRWWWWRRWRWWWWRRRRRRWW 341 Score = 27.6 bits (54), Expect(2) = 0.014 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGR 765 RWRWW+ W R Sbjct: 378 RWRWWRRRWRWR 413 Score = 29.5 bits (58), Expect(2) = 0.22 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWW 834 RW WR + WWW Sbjct: 303 RWWWWRRRRRRWWW 344 Score = 25.4 bits (49), Expect(2) = 0.22 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 RW WW W R W Sbjct: 333 RWWWWWGGWTRRGRW 377 Score = 31.8 bits (63), Expect(2) = 3.8 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 / +3 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WW R R RW WW+ W WW Sbjct: 264 WWWRGRWWWWRRWRWWWWRRRRRRWWWWW 350 Score = 22.1 bits (42), Expect(2) = 3.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 / +2 Query: 884 CKRRWRGWRLKTA 846 CKRR W+L+TA Sbjct: 92 CKRRPPPWQLQTA 130
>LOC_Os05g40010:12005.t03541:unspliced-genomic nonspecific lipid-transfer protein precursor, putative, expressed| Length = 1666 Score = 28.6 bits (56), Expect(3) = 0.017 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 / +1 Query: 848 AHWWWRDPRGHSHRC 804 A WWWR R + RC Sbjct: 160 ARWWWRGRRCRARRC 204 Score = 27.6 bits (54), Expect(3) = 0.017 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 / +1 Query: 884 CKRRWRGWRLKTAHWWW 834 C RR G R + WWW Sbjct: 79 CPRRGAGGRRRRRSWWW 129 Score = 25.8 bits (50), Expect(3) = 0.017 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -2 / +1 Query: 273 SGAASPACARGSSPRCCGASGTACT 199 + AA PAC G++ RC S T Sbjct: 373 TSAAPPACPAGAASRCPSRSAPTST 447
>LOC_Os05g44030:12005.t03893:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor, putative Length = 5748 Score = 40.5 bits (82), Expect = 0.025 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 / -2 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 RWRW +S W R WW RR CS+ R W Sbjct: 953 RWRWRRSSWWERGWWWLRRRRRCSLRWLGRHRW 855
>LOC_Os02g17860:12002.t01580:unspliced-genomic expressed protein| Length = 5462 Score = 40.5 bits (82), Expect = 0.025 Identities = 16/47 (34%), Positives = 18/47 (38%) Frame = -3 / +2 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIW 723 WR + WW R R R RWW W RW W R + W Sbjct: 3899 WRTR*RWRWWLAIRWSYRRGTRRRWWCGGWRARWRW*GARWRTRRRW 4039 Score = 32.2 bits (64), Expect(2) = 0.079 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -3 / +2 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIW 723 R RWW W RW W RR + W Sbjct: 3488 RRRWWCGGWRARWRW*GARRRTR*RW 3565 Score = 24.0 bits (46), Expect(2) = 0.079 Identities = 5/10 (50%), Positives = 6/10 (60%) Frame = -3 / +2 Query: 863 WRLKTAHWWW 834 WR + WWW Sbjct: 3425 WRTRRRWWWW 3454 Score = 35.4 bits (71), Expect = 0.83 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -3 / +2 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 WR++ W R R WRW W RW WW Sbjct: 4742 WRIR*RWRWRLAIRWSYCRGTCWRW*SGGWRARWRWW 4852 Score = 28.6 bits (56), Expect(2) = 2.1 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -3 / +2 Query: 794 RWWQSLWMGRWPWWSTR 744 RWW W RW W R Sbjct: 3848 RWWCGGWRARWRW*GAR 3898 Score = 28.6 bits (56), Expect(2) = 2.1 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = -3 / +2 Query: 794 RWWQSLWMGRWPWWSTR 744 RWW W RW W R Sbjct: 4892 RWWCGGWRARWRW*GAR 4942 Score = 22.6 bits (43), Expect(2) = 2.1 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = -3 / +2 Query: 800 RWRWW 786 RWRWW Sbjct: 3761 RWRWW 3775 Score = 22.6 bits (43), Expect(2) = 2.1 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = -3 / +2 Query: 800 RWRWW 786 RWRWW Sbjct: 4838 RWRWW 4852
>LOC_Os06g21220:12006.t01939:unspliced-genomic glycine-rich cell wall structural protein precursor, putative| Length = 1589 Score = 29.9 bits (59), Expect(2) = 0.026 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -3 / +2 Query: 803 IRWRWWQSLWMGRWPWWSTRRASCSIW 723 +RWR W +W W W R IW Sbjct: 1487 LRWRVWWWVWRWIWRWIQWWRLRRKIW 1567 Score = 28.1 bits (55), Expect(2) = 0.026 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 / +2 Query: 842 WWWRDPRGHSHRCIRWRWWQ 783 WWW R S RW WW+ Sbjct: 1355 WWWVRWRIWSSWVWRWVWWR 1414 Score = 28.6 bits (56), Expect(2) = 0.69 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = -3 / +2 Query: 794 RWWQSLWMGRWPWWSTRRASCSIW 723 RWW W+ W W R +W Sbjct: 1433 RWWLWRWIWMWVWRRVWRLRWRVW 1504 Score = 24.4 bits (47), Expect(2) = 0.69 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -3 / +2 Query: 872 WRGWRLKTAHWWWR 831 WR W K W WR Sbjct: 1409 WRVWLSKVRWWLWR 1450 Score = 26.3 bits (51), Expect(2) = 1.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 / +2 Query: 869 RGWRLKTAHWWW 834 R WRL+ WWW Sbjct: 1475 RVWRLRWRVWWW 1510 Score = 25.4 bits (49), Expect(2) = 1.7 Identities = 8/23 (34%), Positives = 9/23 (39%) Frame = -3 / +2 Query: 791 WWQSLWMGRWPWWSTRRASCSIW 723 WW W+ RW W R W Sbjct: 1505 WWVWRWIWRWIQWWRLRRKIWWW 1573
>LOC_Os02g02870:12002.t00187:unspliced-genomic glycine-rich protein 2, putative, expressed| Length = 1342 Score = 30.9 bits (61), Expect(2) = 0.026 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 / +3 Query: 884 CKRRWRGWRLKTAHWW 837 C+R WR WR + WW Sbjct: 552 CRRWWRRWRRRRRWWW 599 Score = 27.2 bits (53), Expect(2) = 0.026 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 785 QSLWMGRWPWWSTRR 741 Q W RW WW RR Sbjct: 645 QQRWWWRWWWWRRRR 689
>LOC_Os10g31460:12010.t02469:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 8917 Score = 26.7 bits (52), Expect(3) = 0.031 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWNSPRSC 705 RW +S W W W R C W ++C Sbjct: 8599 RWWTERSWWQRVW*WIRKRIWKCVWWTPIKTC 8694 Score = 24.0 bits (46), Expect(3) = 0.031 Identities = 5/12 (41%), Positives = 6/12 (50%) Frame = -3 / +1 Query: 872 WRGWRLKTAHWW 837 W WR+ WW Sbjct: 8530 WSSWRVWAVRWW 8565 Score = 22.6 bits (43), Expect(3) = 0.031 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = -3 / +1 Query: 800 RWRWW 786 RWRWW Sbjct: 8593 RWRWW 8607 Score = 33.6 bits (67), Expect(2) = 0.057 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPW 756 RWRWW W+ W W Sbjct: 8470 RWRWWTKWWIRIWVW 8514 Score = 23.1 bits (44), Expect(2) = 0.057 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = -3 / +1 Query: 767 RWPWWSTRRASCSIW 723 RW WW+ R +W Sbjct: 8593 RWRWWTERSWWQRVW 8637 Score = 28.1 bits (55), Expect(2) = 0.25 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = -3 / +2 Query: 794 RWWQSLWMGRWPWWSTRRASCSIWNSPRSCWLSIDLRRSWLE 669 +WW +W W + R ++W S W RR W E Sbjct: 3629 KWWIWIWFRLWFRVRSSRRVWTVWRWICSGWWPRWRRRWWTE 3754 Score = 26.3 bits (51), Expect(2) = 0.25 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +2 Query: 881 KRRWRGWRLKTAHWWW 834 +R W GWR T W W Sbjct: 3596 RRWWPGWRWWTKWWIW 3643 Score = 29.5 bits (58), Expect(2) = 1.1 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -3 / +2 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 R WW +W W W + R +IW S W Sbjct: 500 RAEWWIWIWFWLWIWIWSSRGIWAIWWWLCSSW 598 Score = 22.6 bits (43), Expect(2) = 1.1 Identities = 5/14 (35%), Positives = 8/14 (57%) Frame = -3 / +2 Query: 875 RWRGWRLKTAHWWW 834 RW W ++ W+W Sbjct: 374 RWAEWWIRIWFWFW 415 Score = 27.2 bits (53), Expect(2) = 2.0 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 / +2 Query: 797 WRWWQSLWMGRW 762 WRWW W+ W Sbjct: 3614 WRWWTKWWIWIW 3649 Score = 24.0 bits (46), Expect(2) = 2.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 / +2 Query: 881 KRRWRGWRLKTAHWWWR 831 +RRWR WR W+R Sbjct: 3482 RRRWRRWREWWFRIWFR 3532
>LOC_Os11g01030:12011.t00003:unspliced-genomic conserved hypothetical protein| Length = 3026 Score = 33.1 bits (66), Expect(2) = 0.033 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 / +2 Query: 884 CKRRWRGWRLKTAHWWWRDPRGHSHRCIRW 795 C RR R WR + W WR RG RW Sbjct: 383 CWRRRRWWR*ARSRWRWRGRRGRWRSGSRW 472 Score = 24.4 bits (47), Expect(2) = 0.033 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 / +2 Query: 806 CIRWRWWQSLWMGRW 762 CIR WW++ G W Sbjct: 539 CIRQTWWRARRSGWW 583
>LOC_Os12g01020:12012.t00002:unspliced-genomic conserved hypothetical protein| Length = 2964 Score = 33.1 bits (66), Expect(2) = 0.033 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 / +2 Query: 884 CKRRWRGWRLKTAHWWWRDPRGHSHRCIRW 795 C RR R WR + W WR RG RW Sbjct: 383 CWRRRRWWR*ARSRWRWRGRRGRWRSGSRW 472 Score = 24.4 bits (47), Expect(2) = 0.033 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 / +2 Query: 806 CIRWRWWQSLWMGRW 762 CIR WW++ G W Sbjct: 539 CIRQTWWRARRSGWW 583
>LOC_Os06g21340:12006.t01951:unspliced-genomic rho GDP-dissociation inhibitor 1, putative, expressed| Length = 3221 Score = 40.0 bits (81), Expect = 0.035 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 / -2 Query: 839 WWRDPRGHSHRCIRWRWWQSLWM 771 WWR RG R RWRWW+ + M Sbjct: 139 WWRRKRGRGRRRRRWRWWRRMEM 71
>LOC_Os01g43590:12001.t03874:unspliced-genomic heat shock factor protein HSF8, putative, expressed| Length = 1638 Score = 40.0 bits (81), Expect = 0.035 Identities = 17/60 (28%), Positives = 30/60 (50%) Frame = +2 / +3 Query: 701 TSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 T SS W RR WC+T+ S+G T+T + P ++++ SS++ S ++ Sbjct: 156 TGSSRRRRSWRRRTRWCATRGRTRSSGGGGTTTASSSSTPPPSRSSSSPASSSTATSPAS 335
>LOC_Os09g33600:12009.t02936:unspliced-genomic VAN3, putative, expressed| Length = 7602 Score = 27.2 bits (53), Expect(3) = 0.042 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -3 / +1 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGRWPW 756 WWW RG R W W + + R W Sbjct: 232 WWWWRERGVRRRRGGWWWCEERALMRLWW 318 Score = 23.5 bits (45), Expect(3) = 0.042 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 / +1 Query: 770 GRWPWWSTRRASCSIW 723 G+ WWS RRA+ ++ Sbjct: 325 GKAVWWSRRRAAAEMF 372 Score = 22.1 bits (42), Expect(3) = 0.042 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -3 / +1 Query: 866 GWRLKTAHWWWRD 828 G R + WWWR+ Sbjct: 211 GGRRRWWWWWWRE 249
>LOC_Os12g13860:12012.t01253:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1500 Score = 35.0 bits (70), Expect(2) = 0.047 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRWPW 756 WRWW W GRW W Sbjct: 1116 WRWWGWWWTGRW*W 1157 Score = 22.1 bits (42), Expect(2) = 0.047 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWWW 834 +RRW W A W W Sbjct: 1077 RRRWSFWWRLWAGWRW 1124 Score = 26.7 bits (52), Expect(2) = 5.5 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRW 762 RW WW W RW Sbjct: 1335 RWWWWWWRWRTRW 1373 Score = 23.1 bits (44), Expect(2) = 5.5 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWW 834 RW R A WWW Sbjct: 1305 RWSLRRKLWARWWW 1346
>LOC_Os02g07960:12002.t00692:unspliced-genomic ATP binding protein, putative, expressed| Length = 10006 Score = 39.6 bits (80), Expect = 0.048 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 / -2 Query: 800 RWRWWQSLWMGRWPWWSTRRASC 732 RWRWW RW WW RR C Sbjct: 4062 RWRWWCRRRRRRWWWWRRRRRRC 3994
>LOC_Os01g69020:12001.t06256:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1375 Score = 39.6 bits (80), Expect = 0.048 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = -3 / +2 Query: 881 KRRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTR 744 +RRWR R + WR G R R W+ W RW W R Sbjct: 311 RRRWRSRRRRCWRRRWRRCEGRCWRRCEGRCWRRRWSTRWRWCERR 448 Score = 25.4 bits (49), Expect(2) = 7.5 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -3 / +2 Query: 776 WMGRWPWWSTRRASCSIWNSPRSC 705 W RW W +RR S S R C Sbjct: 794 WCWRWRWCGSRRWSSRWHRS*RRC 865 Score = 24.0 bits (46), Expect(2) = 7.5 Identities = 9/27 (33%), Positives = 10/27 (37%) Frame = -3 / +2 Query: 836 WRDPRGHSHRCIRWRWWQSLWMGRWPW 756 WR R R R W+ W W W Sbjct: 728 WRSRRHRC*RRCERRRWRRRWCWCWRW 808
>LOC_Os02g54590:12002.t05038:unspliced-genomic serine threonine kinase, putative, expressed| Length = 5112 Score = 39.6 bits (80), Expect = 0.048 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +2 / +1 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 +++ W CS + P+WCS+ A ST +++TST T + RSS + +++ Sbjct: 3757 SSTRRWRCSAASATPTWCSSSARARSTAASSTSTWPTAASTTACSGAAAARSSRGSTASA 3936 Query: 878 A 880 + Sbjct: 3937 S 3939
>LOC_Os09g25710:12009.t02250:unspliced-genomic WAG22 antigen precursor, putative, expressed| Length = 528 Score = 31.3 bits (62), Expect(2) = 0.050 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 / +3 Query: 803 IRWRWWQSLWMGRWPWWST 747 IR+R W+ +W+ W WW + Sbjct: 468 IRFRIWRRVWLWIWFWWKS 524 Score = 25.8 bits (50), Expect(2) = 0.050 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWW 837 W GWR++ WW Sbjct: 363 WVGWRIRVWLWW 398
>LOC_Os01g32540:12001.t02830:unspliced-genomic acanthoscurrin-2 precursor, putative| Length = 297 Score = 34.5 bits (69), Expect(2) = 0.051 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -3 / +3 Query: 836 WRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIW 723 W R R RWR + W RW W RRAS + W Sbjct: 105 WWLRRARWRRQARWRRRRGRWWLRWARWRRRRASEARW 218 Score = 22.6 bits (43), Expect(2) = 0.051 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = -3 / +2 Query: 854 KTAHWWWR 831 + A WWWR Sbjct: 50 RQARWWWR 73
>LOC_Os01g22010:12001.t01938:unspliced-genomic S-adenosylmethionine synthetase 1, putative, expressed| Length = 2606 Score = 30.4 bits (60), Expect(2) = 0.061 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 / -1 Query: 767 RWPWWSTRRASCSIWN 720 RWPWW +RR W+ Sbjct: 1037 RWPWW*SRRTPSPCWS 990 Score = 26.3 bits (51), Expect(2) = 0.061 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 / -1 Query: 824 RGHSHRCIRWRWW 786 RG S R RW WW Sbjct: 1061 RGRSSRSRRWPWW 1023
>LOC_Os01g43550:12001.t03870:unspliced-genomic OsWRKY12 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2015 Score = 35.9 bits (72), Expect(2) = 0.062 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 / +1 Query: 842 WWWRDPRGHSHRCIRWR 792 WWWR PR H IRWR Sbjct: 265 WWWRRPRAHRMVRIRWR 315 Score = 25.4 bits (49), Expect(2) = 0.062 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = -3 / +1 Query: 794 RWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 R W W W W T +S ++ +CW Sbjct: 1585 RGWGWSWTSSWVPWMTTCSSSTMSWRTTACW 1677
>LOC_Os06g03050:12006.t00198:unspliced-genomic expressed protein| Length = 2447 Score = 39.1 bits (79), Expect = 0.066 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -3 / +1 Query: 845 HWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRS 708 HW WR ++ C+R RWW S R P +T W SP S Sbjct: 43 HW*WRIMSPWTNMCVRRRWWHSSIT*RHPTAATTARRRRWWPSPPS 180
>LOC_Os11g33120:12011.t02908:unspliced-genomic respiratory burst oxidase protein D, putative, expressed| Length = 7521 Score = 39.1 bits (79), Expect = 0.066 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = +2 / +3 Query: 734 RRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 RR S CS+++T PST S ++ + +P T+ +S ST +T+A Sbjct: 5415 RRSSLCSSRSTTPSTASTSSPAPASRPTSPAPTGATSTSASPSTTATNA 5561
>LOC_Os10g31320:12010.t02458:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 929 Score = 29.5 bits (58), Expect(3) = 0.078 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 / +3 Query: 803 IRWRWWQSLWMGRWPW 756 IR R W +W GRW W Sbjct: 210 IRVRLWIGVWRGRWCW 257 Score = 26.3 bits (51), Expect(3) = 0.078 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +3 Query: 767 RWPWWSTRRASCSIW 723 RW WW RR IW Sbjct: 618 RWWWWRRRRPRRRIW 662 Score = 22.1 bits (42), Expect(3) = 0.078 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -3 / +3 Query: 881 KRRWRGWR 858 +RRWR WR Sbjct: 150 RRRWRWWR 173 Score = 29.0 bits (57), Expect(2) = 0.96 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPW 756 RWRWW+ W R W Sbjct: 156 RWRWWRRRW*RRRRW 200 Score = 23.5 bits (45), Expect(2) = 0.96 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = -3 / +3 Query: 764 WPWWSTRR 741 WPWW RR Sbjct: 270 WPWWWWRR 293 Score = 32.7 bits (65), Expect = 5.6 Identities = 11/36 (30%), Positives = 16/36 (44%) Frame = -3 / +3 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPW 756 WR+ WWWR R + + W +W+ R W Sbjct: 603 WRICKRWWWWRRRRPRRRIWLWFWLWLRVWIRRRWW 710
>LOC_Os06g21210:12006.t01938:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 1089 Score = 34.1 bits (68), Expect(2) = 0.087 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -3 / +3 Query: 791 WWQSLWMGRWPWWSTRRASCSIW 723 WW W+ W WW R IW Sbjct: 630 WWLRRWIWTWVWWRVRWFGWRIW 698 Score = 22.1 bits (42), Expect(2) = 0.087 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWW 834 R W WR+ ++ WW Sbjct: 588 RWWVRWRIWSSWVWW 632
>LOC_Os09g11880:12009.t00977:unspliced-genomic glycine-rich cell wall structural protein precursor, putative| Length = 1084 Score = 38.6 bits (78), Expect = 0.090 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -3 / +1 Query: 860 RLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRR 741 R + + WW R R R+ WW S W PWW RR Sbjct: 754 RPRGSWWWRWQTRWPWSRWWRYPWWWSKWWYWCPWWWVRR 873 Score = 33.1 bits (66), Expect = 4.1 Identities = 12/40 (30%), Positives = 13/40 (32%) Frame = -3 / +1 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 W W WW R +C WW S W WW Sbjct: 829 WSKWWYWCPWWWVRRGWPWWRQCWGRSWWWSRRQPSWRWW 948 Score = 25.8 bits (50), Expect(2) = 4.2 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = -3 / +1 Query: 791 WWQSLWMGRWPWW 753 WW+ LW W W Sbjct: 955 WWRPLWTRPWQRW 993 Score = 24.4 bits (47), Expect(2) = 4.2 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWWRDPRGHSHRCIRWRW 789 +R W WR WW R S R R W Sbjct: 868 RRGWPWWRQCWGRSWWWSRRQPSWRWWRPWW 960
>LOC_Os11g01730:12011.t00069:unspliced-genomic L-ascorbate oxidase precursor, putative| Length = 4510 Score = 38.6 bits (78), Expect = 0.090 Identities = 22/56 (39%), Positives = 27/56 (48%) Frame = +2 / +3 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTST 865 T+SS+ +W R S T PST +ATTST G A PA T S+ T Sbjct: 4140 TSSSTAPPCRWCSRAPTSSPARTTPSTSTATTSTSSPRGWATSTPAPTRASSTWRT 4307
>LOC_Os12g25540:12012.t02274:unspliced-genomic conserved hypothetical protein| Length = 522 Score = 31.3 bits (62), Expect(2) = 0.091 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 / +2 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIW 723 RWRW ++ W + WW R S W Sbjct: 413 RWRWRRAWWRRQARWWRRRARWRSRW 490 Score = 24.9 bits (48), Expect(2) = 0.091 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWR 831 RRWR R + WWR Sbjct: 354 RRWRRARWRRRRAWWR 401 Score = 28.1 bits (55), Expect(2) = 1.3 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -3 / +2 Query: 836 WRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRR 741 WR R R RW ++ W RW W RR Sbjct: 416 WRWRRAWWRRQARWWRRRARWRSRWWWRRGRR 511 Score = 24.0 bits (46), Expect(2) = 1.3 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = -3 / +2 Query: 881 KRRWRGWRLKTAHW 840 +RRW WR + W Sbjct: 254 RRRWSEWRTEEVRW 295
>LOC_Os11g34720:12011.t03023:unspliced-genomic tartrate-resistant acid phosphatase type 5 precursor, putative,| expressed Length = 5890 Score = 30.9 bits (61), Expect(2) = 0.11 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 / +1 Query: 791 WWQSLWMGRWPWWSTRRASCSIW 723 WW+ W G WSTRR W Sbjct: 160 WWRRRWRGS*LGWSTRRRRTGRW 228 Score = 24.9 bits (48), Expect(2) = 0.11 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWWRDPRG 819 +RRW W WW R RG Sbjct: 121 RRRWLRWSSWLV*WWRRRWRG 183
>LOC_Os06g34060:12006.t03102:unspliced-genomic expressed protein| Length = 3342 Score = 33.1 bits (66), Expect(2) = 0.11 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 / +3 Query: 809 RCIRWRWWQSLWMGRW 762 RC R RWW W GRW Sbjct: 1182 RCCRSRWW*EGWWGRW 1229 Score = 22.6 bits (43), Expect(2) = 0.11 Identities = 6/14 (42%), Positives = 6/14 (42%) Frame = -3 / +3 Query: 758 WWSTRRASCSIWNS 717 WW R C W S Sbjct: 1215 WWGRWRRRCRCWTS 1256
>LOC_Os02g58530:12002.t05423:unspliced-genomic major facilitator superfamily protein, expressed| Length = 1959 Score = 35.4 bits (71), Expect(2) = 0.11 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -3 / +2 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRW 762 WR WR W R R + RC R WW + W Sbjct: 1532 WRRWRCWWRRAWRRWRRRRTRRCARGAWWCTCAASSW 1642 Score = 24.9 bits (48), Expect(2) = 0.11 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 / +2 Query: 273 SGAASPACARGSSPRCCGASGTACTRS 193 S + +CA SPR C AS + RS Sbjct: 1646 SAPSPTSCAPRYSPRACVASASPSARS 1726
>LOC_Os05g43380:12005.t03829:unspliced-genomic CXC domain containing TSO1-like protein 1, putative, expressed| Length = 2567 Score = 28.6 bits (56), Expect(2) = 0.11 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 / +2 Query: 788 WQSLWMGRWPWWSTRRA 738 W RWPWW RR+ Sbjct: 179 WSPCPRSRWPWWWQRRS 229 Score = 27.2 bits (53), Expect(2) = 0.11 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / +2 Query: 836 WRDPRGHSHRCIRWR 792 WR PR S R +RWR Sbjct: 56 WRPPRSPSSRRLRWR 100
>LOC_Os08g37810:12008.t03517:unspliced-genomic expressed protein| Length = 1649 Score = 32.7 bits (65), Expect(2) = 0.11 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = -3 / -3 Query: 821 GHSHRCIRWRWWQSLWMG 768 GH R RWRWW W G Sbjct: 195 GHRPRAERWRWWWWWWRG 142 Score = 23.1 bits (44), Expect(2) = 0.11 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 / -1 Query: 866 GWRLKTAHWWWR 831 G R + WWWR Sbjct: 347 GRRRRRRRWWWR 312 Score = 25.8 bits (50), Expect(2) = 9.9 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = -3 / -3 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRW 789 R R R + WWWR RG R W Sbjct: 189 RPRAERWRWWWWWWRGSRGGERAWWRAWW 103 Score = 23.1 bits (44), Expect(2) = 9.9 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = -3 / -3 Query: 791 WWQSLWMG 768 WW++ WMG Sbjct: 120 WWRAWWMG 97
>LOC_Os05g32070:12005.t02803:unspliced-genomic LRP1, putative, expressed| Length = 1337 Score = 28.1 bits (55), Expect(2) = 0.12 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / -2 Query: 770 GRWPWWSTRRASCSIW 723 GRW WWS R + W Sbjct: 577 GRWWWWSGSRGGVASW 530 Score = 27.6 bits (54), Expect(2) = 0.12 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = -3 / -2 Query: 872 WRGWRLKTAHWWW 834 W WR + WWW Sbjct: 601 WWRWRWRCGRWWW 563
>LOC_Os03g32100:12003.t02805:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 1223 Score = 28.6 bits (56), Expect(2) = 0.12 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 / +2 Query: 758 WWSTRRASCSIWNSPR 711 WW RR C+ W +PR Sbjct: 764 WWRRRRTCCTRWWAPR 811 Score = 27.2 bits (53), Expect(2) = 0.12 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 / +2 Query: 884 CKRRWRGWRLKTAHWWWR 831 C R W W ++A WW R Sbjct: 722 CARCWS*WASRSAGWWRR 775
>LOC_Os10g31440:12010.t02468:unspliced-genomic lipoprotein, putative, expressed| Length = 1037 Score = 33.6 bits (67), Expect(2) = 0.12 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -3 / +2 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRW 762 WW P S R RW W+ W G W Sbjct: 341 WWLWPSWWSVRSRRWPRWRRWWWGEW 418 Score = 22.1 bits (42), Expect(2) = 0.12 Identities = 6/15 (40%), Positives = 7/15 (46%) Frame = -3 / +2 Query: 767 RWPWWSTRRASCSIW 723 RW WW+ R W Sbjct: 515 RWRWWTKWRVWVWFW 559 Score = 28.1 bits (55), Expect(2) = 0.53 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 / +2 Query: 815 SHRCIRWRWWQSLWMGRWPW 756 S R RWRWW+ W W Sbjct: 722 SRRWTRWRWWRWTIRRVWFW 781 Score = 25.4 bits (49), Expect(2) = 0.53 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 / +2 Query: 887 ICKRRWRGWRLKTAHWW 837 IC RRW WR + W Sbjct: 602 ICSRRWTRWRWRRWTVW 652 Score = 28.6 bits (56), Expect(2) = 0.96 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 / +2 Query: 800 RWRWWQSLWMGRWPWW 753 +WR W W+ WP W Sbjct: 533 KWRVWVWFWLWLWPSW 580 Score = 24.0 bits (46), Expect(2) = 0.96 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 / +2 Query: 887 ICKRRWRGWRLKTAHWW 837 +C RRW WR + W Sbjct: 488 LCSRRWTRWRWRWWTKW 538 Score = 25.4 bits (49), Expect(2) = 4.2 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -3 / +2 Query: 794 RWWQSLWMGRWPWWSTRRASCSIWNSPRS 708 R W LW+ WP W R I + RS Sbjct: 767 RVWFWLWIWFWPSWWIRALRWRICSGRRS 853 Score = 24.9 bits (48), Expect(2) = 4.2 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / +2 Query: 878 RRWRGWRLKTAHWWWRDP 825 RRW WR+ W W P Sbjct: 635 RRWTVWRVWAWFWLWLWP 688
>LOC_Os06g22390:12006.t02053:unspliced-genomic expressed protein| Length = 766 Score = 33.1 bits (66), Expect(2) = 0.12 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -3 / +1 Query: 767 RWPWWSTRRASCSIWNSPRSCWLS 696 RW WWS R SCS R W S Sbjct: 313 RWRWWSGGRRSCSCSGGSRRGWRS 384 Score = 22.6 bits (43), Expect(2) = 0.12 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = -3 / +1 Query: 800 RWRWW 786 RWRWW Sbjct: 313 RWRWW 327
>LOC_Os03g11680:12003.t00969:unspliced-genomic zinc finger protein, putative, expressed| Length = 1909 Score = 38.2 bits (77), Expect = 0.12 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -2 / -1 Query: 273 SGAASPACARGSSPRCCGASGTACTRS 193 S AA+PACAR PR SG+AC+ S Sbjct: 589 SRAAAPACARSGGPRAPATSGSACSSS 509
>LOC_Os01g61160:12001.t05496:unspliced-genomic L-ascorbate oxidase precursor, putative, expressed| Length = 2515 Score = 38.2 bits (77), Expect = 0.12 Identities = 22/56 (39%), Positives = 29/56 (51%) Frame = +2 / +1 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTST 865 T+SSS + + R S + T PST +ATTST +A P T S+TST Sbjct: 1927 TSSSSAPWCRSSCRTPASSRRRTTPSTSTATTSTSSPRASATSTPRRTPRSSTTST 2094
>LOC_Os01g46270:12001.t04078:unspliced-genomic wax synthase isoform 3, putative, expressed| Length = 1047 Score = 38.2 bits (77), Expect = 0.12 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 / +2 Query: 270 GAASPACARGSSPRCCGASGTACTRSC 190 GAA+PAC R SS R C S + CT C Sbjct: 683 GAATPACWRRSSCRACSTSSSTCT*RC 763
>LOC_Os02g50570:12002.t04641:unspliced-genomic actin binding protein, putative, expressed| Length = 4722 Score = 37.3 bits (75), Expect(2) = 0.13 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -3 / -1 Query: 881 KRRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPW 756 +RRW R + + R R R RW W + W GRW W Sbjct: 1413 RRRWAFGRWRRRRAFGRWWRRCGFRRRRWGWRRGCWFGRWRW 1288 Score = 24.0 bits (46), Expect(2) = 0.13 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -2 / -3 Query: 273 SGAASPACARGSSPRCCGASGTACTRSCR 187 S A RG +PR C A + R CR Sbjct: 661 SRAGGTGRRRGPTPRSCSAPCSPRPRRCR 575
>LOC_Os06g03780:12006.t00269:unspliced-genomic nucleolar protein 10, putative, expressed| Length = 7912 Score = 32.7 bits (65), Expect(2) = 0.14 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 / +1 Query: 791 WWQSLWMGRWPWWSTRR 741 WW W RW WW R+ Sbjct: 7489 WWWKRWRRRWWWWERRQ 7539 Score = 22.6 bits (43), Expect(2) = 0.14 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWWR 831 +RR R W + WW R Sbjct: 7453 RRRRRSWERRRWWWWKR 7503
>LOC_Os04g52550:12004.t04729:unspliced-genomic AGO2, putative, expressed| Length = 5229 Score = 30.4 bits (60), Expect(2) = 0.14 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -3 / -2 Query: 791 WWQSLWMGRWPWWS 750 WW W RW WWS Sbjct: 431 WWWWRWW*RWLWWS 390 Score = 24.9 bits (48), Expect(2) = 0.14 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 / -2 Query: 884 CKRRWRGWRLKTAHWWWR 831 C R W W WWWR Sbjct: 470 CWRWWWWW*RWRWWWWWR 417
>LOC_Os02g06410:12002.t00539:unspliced-genomic pv42p, putative, expressed| Length = 2249 Score = 27.6 bits (54), Expect(3) = 0.16 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 / +3 Query: 761 PWWSTRRASCSIWNSPRSCW 702 PW S+RR S W S R W Sbjct: 1782 PWRSSRRGWASPWRSSRRRW 1841 Score = 26.3 bits (51), Expect(3) = 0.16 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 / +3 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGR 765 W R RG + R RWR + +W R Sbjct: 1377 WRRSARGCTARWCRWRARRRMWWRR 1451 Score = 25.4 bits (49), Expect(3) = 0.16 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWRDPRGHS 813 RW WR + WW R S Sbjct: 204 RWWSWRAPSGGWWRSPTRRRS 266
>LOC_Os06g50650:12006.t04749:unspliced-genomic blue copper protein precursor, putative, expressed| Length = 810 Score = 33.1 bits (66), Expect(2) = 0.16 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 / -1 Query: 839 WWRDPRGHSHRCIRWRW 789 W R PRGH RC R RW Sbjct: 150 WCRCPRGHRRRCTRPRW 100 Score = 22.1 bits (42), Expect(2) = 0.16 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = -3 / -1 Query: 884 CKRRWRGW 861 C+ RWR W Sbjct: 171 CRTRWRSW 148
>LOC_Os06g50420:12006.t04726:unspliced-genomic uclacyanin-2 precursor, putative| Length = 636 Score = 33.1 bits (66), Expect(2) = 0.16 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 / -3 Query: 839 WWRDPRGHSHRCIRWRW 789 W R PRGH RC R RW Sbjct: 115 WCRCPRGHRRRCTRPRW 65 Score = 22.1 bits (42), Expect(2) = 0.16 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = -3 / -3 Query: 884 CKRRWRGW 861 C+ RWR W Sbjct: 136 CRTRWRSW 113
>LOC_Os07g28850:12007.t02575:unspliced-genomic argonaute-like protein, putative, expressed| Length = 6576 Score = 37.7 bits (76), Expect = 0.17 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 / +3 Query: 827 PRGHSHRCIRWRWWQSLWMGRWPWWSTRR 741 PR R WRW LW RW WW RR Sbjct: 162 PRWGLWRWWWWRWAAVLWRRRWWWWRRRR 248
>LOC_Os07g28170:12007.t02508:unspliced-genomic hypothetical protein| Length = 3474 Score = 37.7 bits (76), Expect = 0.17 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWWSTR 744 RW+WW+ + RW WW R Sbjct: 3342 RWQWWEHWDLDRWKWWQRR 3398
>LOC_Os08g30634:12008.t02815:unspliced-genomic resistance protein, putative, expressed| Length = 15915 Score = 37.7 bits (76), Expect = 0.17 Identities = 18/41 (43%), Positives = 23/41 (56%) Frame = +2 / +3 Query: 755 TKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 T A +P GS+TT++ T + PA T SST PSTS Sbjct: 15114 TPAAIPCAGSSTTASAPTSTSTRAAPACTGRSSSTGLPSTS 15236
>LOC_Os05g27570:12005.t02408:unspliced-genomic SAG20, putative| Length = 1566 Score = 37.7 bits (76), Expect = 0.17 Identities = 16/46 (34%), Positives = 29/46 (63%) Frame = +2 / +2 Query: 740 PSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 PS ++A+ P+TG + +T C+ ++P +T+ RSST+ P +S Sbjct: 302 PSTARSRASRPATGGSR*TTRCSTRSSPS*ASTSTRRSSTTPPCSS 439
>LOC_Os04g40990:12004.t03660:unspliced-genomic malate synthase, glyoxysomal, putative, expressed| Length = 2480 Score = 37.7 bits (76), Expect = 0.17 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +2 / +1 Query: 719 CSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 CS+W R + C+T + + TTS+ + +AP A++ S++ PSTS Sbjct: 1225 CSRWRRSCTSCATTRRGSTAAAGTTSSATSRRSAPAPTASSPTAPSSAWPSTS 1383
>LOC_Os03g01100:12003.t00010:unspliced-genomic DNA repair endonuclease UVH1, putative, expressed| Length = 5393 Score = 27.6 bits (54), Expect(2) = 0.19 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -3 / +1 Query: 863 WRLKTAHWWW 834 WR TA WWW Sbjct: 91 WRTPTAAWWW 120 Score = 27.2 bits (53), Expect(2) = 0.19 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = -3 / +1 Query: 791 WWQSLWMGRWPWWSTRRASCSIWNSP 714 WW RWP W +S S N P Sbjct: 112 WWWFRVASRWPPWRPPSSSSSSTNPP 189
>LOC_Os10g30870:12010.t02418:unspliced-genomic expressed protein| Length = 2214 Score = 28.1 bits (55), Expect(2) = 0.21 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 / -3 Query: 881 KRRWRGWRLKTAHWWWR 831 +RRW G + WWWR Sbjct: 160 RRRWCGAKGAFRRWWWR 110 Score = 26.7 bits (52), Expect(2) = 0.21 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = -3 / -1 Query: 842 WWWRDPRGHSHRCIRWRWW 786 WW R G WRWW Sbjct: 93 WWRRGGGGGGRGRAWWRWW 37
>LOC_Os08g43530:12008.t04078:unspliced-genomic F-box protein interaction domain containing protein| Length = 2103 Score = 37.3 bits (75), Expect = 0.23 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 / +2 Query: 878 RRWRGWRLKTAHWWWRDPRGHS 813 RRWR WR A WWW R S Sbjct: 809 RRWRRWRGSCAWWWWSTRRSRS 874
>LOC_Os05g47940:12005.t04229:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 1838 Score = 37.3 bits (75), Expect = 0.23 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 / -3 Query: 881 KRRWRGWRLKTAHWWWR 831 +RRW GWR + WWWR Sbjct: 411 RRRWYGWRRR*HRWWWR 361
>LOC_Os11g38070:12011.t03349:unspliced-genomic expressed protein| Length = 1525 Score = 37.3 bits (75), Expect = 0.23 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -2 / -2 Query: 273 SGAASPACARGSSPRCCGASGTAC 202 SGAA P ARGSSPR G +G C Sbjct: 414 SGAAGPGAARGSSPRSRGCTGWPC 343
>LOC_Os08g43334:12008.t04058:unspliced-genomic heat shock factor protein 7, putative, expressed| Length = 9575 Score = 37.3 bits (75), Expect = 0.23 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +2 / +2 Query: 734 RRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 RR SW T+ + S+ TT+ + G P PAT++ +S++T S ++ Sbjct: 6107 RRTSWWMTRRSTTSSPGTTTAPPSSCGAPPSSPATSSPSTSSTTTSPAS 6253
>LOC_Os10g31380:12010.t02464:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative| Length = 655 Score = 29.9 bits (59), Expect(2) = 0.24 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -3 / +1 Query: 809 RCIRWRWWQSLWMGRWPW 756 R RWRW + +W+ W W Sbjct: 445 RRCRWRWRRRVWLWCWRW 498 Score = 27.6 bits (54), Expect(2) = 0.24 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWRDPR 822 RR R WR WWW + R Sbjct: 90 RRRRRWRWWWGRWWWPNRR 146 Score = 29.5 bits (58), Expect(2) = 1.1 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -3 / +1 Query: 791 WWQSLWMGRWPWWSTRRASCSIW 723 WW+ W RW W R S W Sbjct: 337 WWRRWWWRRWVWLWCWRGIWSSW 405 Score = 25.8 bits (50), Expect(2) = 1.1 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -3 / +3 Query: 800 RWRWWQSLW 774 RWRWW W Sbjct: 102 RWRWWWGRW 128
>LOC_Os11g26860:12011.t02300:unspliced-genomic serine hydroxymethyltransferase, mitochondrial precursor, putative,| expressed Length = 3336 Score = 32.7 bits (65), Expect(2) = 0.24 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 / +3 Query: 656 SATILQAKTAGDQ*TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTST 799 SA+ + TA T+ +W ++ +R SW S + PST A+ ST Sbjct: 2769 SASTSRRSTASSSRTSPRAW*TTRTSRTSSWRSRSSPPPSTCPASPST 2912 Score = 27.2 bits (53), Expect(2) = 0.24 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 / +2 Query: 279 LAKRAAREAKDAPAQPQPNKRKLAPRKSV 365 L +R R +D P+P R++ PR+ V Sbjct: 308 LLRRERRHRRDREPVPRPRPRRVPPRRRV 394
>LOC_Os03g55470:12003.t04811:unspliced-genomic expressed protein| Length = 4418 Score = 29.0 bits (57), Expect(2) = 0.27 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -3 / -3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRW 789 W WR + W WR RG S R + W Sbjct: 408 WWWWRRRRWRWIWRRGRGGSGRGRPYPW 325 Score = 25.4 bits (49), Expect(2) = 0.27 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 / -3 Query: 800 RWRWWQSLWMGR 765 RWRW +W GR Sbjct: 279 RWRWSWRIWTGR 244 Score = 25.8 bits (50), Expect(2) = 9.1 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -3 / -3 Query: 863 WRLKTAHWWW 834 WR T+ WWW Sbjct: 429 WRSPTSWWWW 400 Score = 23.1 bits (44), Expect(2) = 9.1 Identities = 8/21 (38%), Positives = 8/21 (38%) Frame = -3 / -3 Query: 797 WRWWQSLWMGRWPWWSTRRAS 735 W WW RW W R S Sbjct: 411 WWWWWRRRRWRWIWRRGRGGS 349
>LOC_Os03g53230:12003.t04645:unspliced-genomic bifunctional 3-phosphoadenosine 5-phosphosulfate synthetase,| putative, expressed Length = 3470 Score = 31.8 bits (63), Expect(2) = 0.27 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 / +2 Query: 884 CKRRWRGWRLKTAHWWWRDPR 822 C R WR A WWWR R Sbjct: 266 CSRSWRSGGEAIARWWWRRRR 328 Score = 22.6 bits (43), Expect(2) = 0.27 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = -3 / +2 Query: 770 GRWPWWSTRR 741 G W WW RR Sbjct: 428 GWWSWWCRRR 457
>LOC_Os04g59480:12004.t05405:unspliced-genomic POT family protein, expressed| Length = 3465 Score = 27.6 bits (54), Expect(2) = 0.27 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / +1 Query: 884 CKRRWRGWRLKTAHWWWR 831 C R R WR + W WR Sbjct: 2788 CSARGRAWRCRWRRWRWR 2841 Score = 26.7 bits (52), Expect(2) = 0.27 Identities = 10/38 (26%), Positives = 14/38 (36%) Frame = -3 / +1 Query: 788 WQSLWMGRWPWWSTRRASCSIWNSPRSCWLSIDLRRSW 675 W+ W W WW R +S + + W SW Sbjct: 2923 WRWGWRTCWRWWGCRSSSTARCRRGCAAWGWRSTTASW 3036
>LOC_Os09g39580:12009.t03423:unspliced-genomic calmodulin binding protein, putative, expressed| Length = 3877 Score = 35.4 bits (71), Expect(2) = 0.28 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 / +1 Query: 1093 CCLKFYCTLSRLNYLSALSSKAFYLFVLSSLCNFTFGCYPF 1215 C F+ L L +L+ + + + LF+ +CNF F CY F Sbjct: 3013 CACTFHSILFLLPFLTLVCTFSSSLFIFLCICNFNFCCYFF 3135 Score = 24.4 bits (47), Expect(2) = 0.28 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 / +3 Query: 752 STKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPST 874 ST A+ + A TST + P + S TS+P+T Sbjct: 597 STTASASAASMAATSTTASSAPPPGFSTPSATSSGTSSPTT 719
>LOC_Os05g51750:12005.t04600:unspliced-genomic pepsin A, putative, expressed| Length = 2018 Score = 34.1 bits (68), Expect(2) = 0.28 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = -2 / -3 Query: 273 SGAASPACARGSSPRCCGASGTACTRSCRDGFA*SRGPW 157 SG S C RG R G+SG+ TR G S PW Sbjct: 774 SGRGSRRCCRGGPCRRAGSSGSGATRRTWQGGTSS*SPW 658 Score = 24.9 bits (48), Expect(2) = 0.28 Identities = 10/29 (34%), Positives = 11/29 (37%) Frame = -3 / -3 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIRWR 792 RR G + WWWR R WR Sbjct: 1077 RRR*GSWRRCGRWWWRGGRRRGGHRSAWR 991
>LOC_Os02g37160:12002.t03354:unspliced-genomic expressed protein| Length = 1601 Score = 32.2 bits (64), Expect(2) = 0.28 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 / -1 Query: 884 CKRRWRGWRLKTAHWWW 834 C+RRW W ++ WWW Sbjct: 1202 CRRRWWWWWWWSSSWWW 1152 Score = 22.1 bits (42), Expect(2) = 0.28 Identities = 5/10 (50%), Positives = 5/10 (50%) Frame = -3 / -1 Query: 797 WRWWQSLWMG 768 W WW W G Sbjct: 1160 WWWWSGSWGG 1131 Score = 33.6 bits (67), Expect = 3.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -3 / -1 Query: 809 RCIRWRWWQSLWMGRWPWWS 750 RC R WW W W WWS Sbjct: 1205 RCRRRWWWWWWWSSSWWWWS 1146
>LOC_Os01g36620:12001.t03210:unspliced-genomic pectate lyase 4 precursor, putative, expressed| Length = 1494 Score = 36.3 bits (73), Expect(2) = 0.29 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -2 / +2 Query: 249 ARGSSPRCCGASGTACTRSCRDGFA*SRGP 160 ARGS+ R CG+ G CT + R G A +R P Sbjct: 920 ARGSATRGCGSGGRTCTTTTRGGGASTRWP 1009 Score = 22.1 bits (42), Expect(2) = 0.29 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 / +2 Query: 400 CLVTVYPGLPILTDLR 353 CL+T P L + +DLR Sbjct: 74 CLITAAPLLSVWSDLR 121
>LOC_Os12g13890:12012.t01256:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 1067 Score = 31.3 bits (62), Expect(2) = 0.29 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 / +1 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQSLWM 771 WRL T WW R R + IR R W W+ Sbjct: 577 WRLWTRWWWRRWWRTRWWKWIRLRIWIRFWL 669 Score = 23.1 bits (44), Expect(2) = 0.29 Identities = 7/26 (26%), Positives = 11/26 (42%) Frame = -3 / +1 Query: 779 LWMGRWPWWSTRRASCSIWNSPRSCW 702 +W+ W W R + +W R W Sbjct: 649 IWIRFWLWSRWRSSCWRLWTRWRGRW 726 Score = 27.2 bits (53), Expect(2) = 1.7 Identities = 8/23 (34%), Positives = 9/23 (39%) Frame = -3 / +1 Query: 791 WWQSLWMGRWPWWSTRRASCSIW 723 WW+ W RW W R W Sbjct: 598 WWRRWWRTRWWKWIRLRIWIRFW 666 Score = 24.4 bits (47), Expect(2) = 1.7 Identities = 6/14 (42%), Positives = 6/14 (42%) Frame = -3 / +1 Query: 872 WRGWRLKTAHWWWR 831 W W WWWR Sbjct: 565 WSFWWRLWTRWWWR 606
>LOC_Os10g31530:12010.t02476:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 870 Score = 29.9 bits (59), Expect(2) = 0.29 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -3 / +1 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRR 741 WW + R C RW W+ W+ R W +R Sbjct: 325 WWECERRRRRWWCCRWTSWRC*WIRRLWDWHWQR 426 Score = 24.4 bits (47), Expect(2) = 0.29 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = -3 / +1 Query: 884 CKRRWRGWRLKTAHWWW 834 C R GWR W+W Sbjct: 223 CWGRGLGWRWLAVQWYW 273
>LOC_Os11g45908:12011.t04116:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3891 Score = 36.8 bits (74), Expect = 0.32 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIWNS 717 W WW S W+ + WWS R + S W S Sbjct: 177 WIWWNSWWIYQNSWWSRR*SWRSWWRS 257
>LOC_Os09g25420:12009.t02221:unspliced-genomic zinc finger, C2H2 type family protein, expressed| Length = 3002 Score = 36.8 bits (74), Expect = 0.32 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +3 / +1 Query: 177 RNHLGSYECKLCLTLHNNEGNYLAHTQGKRHQTN 278 R H + C +C N E ++ H +GKRHQ N Sbjct: 1525 RAHAARWSCSVCQVHCNGEWHFDTHLKGKRHQAN 1626
>LOC_Os09g25100:12009.t02190:unspliced-genomic CBL-interacting serine/threonine-protein kinase 15, putative,| expressed Length = 1550 Score = 36.8 bits (74), Expect = 0.32 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 / +2 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWNSPRS 708 R RW W R WW++RR + + W++ RS Sbjct: 1262 RSRWAAHAWRRRCSWWTSRRMAATPWSTGRS 1354
>LOC_Os06g43120:12006.t04002:unspliced-genomic zinc finger C-x8-C-x5-C-x3-H type family protein, expressed| Length = 7923 Score = 36.8 bits (74), Expect = 0.32 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 / -2 Query: 797 WRWWQSLWMGRWPWW 753 W WW W GRW WW Sbjct: 206 WWWWWWWWSGRWYWW 162
>LOC_Os12g01730:12012.t00071:unspliced-genomic L-ascorbate oxidase precursor, putative, expressed| Length = 4604 Score = 36.8 bits (74), Expect = 0.32 Identities = 21/53 (39%), Positives = 26/53 (49%) Frame = +2 / +2 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSS 856 T+SS+ +W R S T PST +ATTST G A PA T S+ Sbjct: 4028 TSSSTAPPCRWCSRAPTSSPARTTPSTSTATTSTSSPRGWATSMPAPTRPSST 4186
>LOC_Os06g46440:12006.t04330:unspliced-genomic expressed protein| Length = 1329 Score = 36.8 bits (74), Expect = 0.32 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 / -3 Query: 270 GAASPACARGSSPRCCGASGTACTRS 193 G + A RG SPRCCG+S +C RS Sbjct: 943 GDGAAAPPRGCSPRCCGSSPPSCRRS 866
>LOC_Os12g13840:12012.t01251:unspliced-genomic glycine-rich cell wall structural protein 1 precursor, putative| Length = 501 Score = 35.0 bits (70), Expect(2) = 0.34 Identities = 16/49 (32%), Positives = 19/49 (38%) Frame = -3 / +3 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCWLSI 693 WWR R R R W +W+ W W R W R WLS+ Sbjct: 336 WWRRRRRRGRRWKWTR*WIWIWIWVW*GWWWRWRRRRRWRRRRRRWLSL 482 Score = 21.7 bits (41), Expect(2) = 0.34 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWWW 834 +RR R WR + W W Sbjct: 225 RRRRRRWRWQQWKWKW 272 Score = 25.4 bits (49), Expect(3) = 1.0 Identities = 10/31 (32%), Positives = 12/31 (38%) Frame = -3 / +3 Query: 767 RWPWWSTRRASCSIWNSPRSCWLSIDLRRSW 675 RW W + IW PR W + R W Sbjct: 246 RWQQWKWKWIRLWIWLWPREWWSTRTR*RRW 338 Score = 24.9 bits (48), Expect(3) = 1.0 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRW 789 WWWR G +W+W Sbjct: 102 WWWRRRWGWRGWWRQWQW 155 Score = 21.7 bits (41), Expect(3) = 1.0 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRW 762 WR WQ W+ W Sbjct: 138 WRQWQW*WIRIW 173
>LOC_Os02g57210:12002.t05293:unspliced-genomic hypothetical protein| Length = 1430 Score = 29.9 bits (59), Expect(2) = 0.37 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 / +1 Query: 776 WMGRWPWWSTRRASCSIWNSPR 711 W W W STR + W+SPR Sbjct: 1222 WGSIWGWTSTRSSRTRRWSSPR 1287 Score = 28.1 bits (55), Expect(2) = 0.37 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGR 765 + RWR WR WR + RWR S GR Sbjct: 901 RTRWRRWRAAARSGAWRTWTRRARGSSRWRRAPSRLRGR 1017
>LOC_Os12g02340:12012.t00130:unspliced-genomic nonspecific lipid-transfer protein 3 precursor, putative, expressed| Length = 1609 Score = 29.9 bits (59), Expect(2) = 0.38 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 / +2 Query: 863 WRLKTAHWWWR 831 WRL T WWWR Sbjct: 119 WRL*TVRWWWR 151 Score = 24.0 bits (46), Expect(2) = 0.38 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -3 / +2 Query: 842 WWWRDPRGHSHRCIRW 795 WW R R R +RW Sbjct: 170 WWRRRERRRRSRAVRW 217
>LOC_Os02g36450:12002.t03282:unspliced-genomic sugar transport protein 5, putative, expressed| Length = 4359 Score = 35.0 bits (70), Expect(2) = 0.41 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -2 / +2 Query: 261 SPACARGSSPRCCGASGTACTRSCRDGFA*SRGPW 157 S +C+R S RCC AS TA + + DG+ * R W Sbjct: 3887 SRSCSRSRSWRCCAASSTARSPTTPDGW***RRSW 3991 Score = 24.4 bits (47), Expect(2) = 0.41 Identities = 8/26 (30%), Positives = 11/26 (42%) Frame = -3 / +2 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIW 723 R WW + WW+ SC+ W Sbjct: 3596 RRSWWTAAAGAPCSWWAAPC*SCARW 3673
>LOC_Os08g45150:12008.t04236:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 2336 Score = 33.1 bits (66), Expect(2) = 0.43 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +2 / +1 Query: 764 TVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 T PST S TTST A ++ R +T TPSTS Sbjct: 1198 TAPSTSSGTTSTPPRGPTASSSASSCQPRPTTCTPSTS 1311 Score = 25.4 bits (49), Expect(2) = 0.43 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 / +2 Query: 297 REAKDAPAQPQPNKRKLAPRKSVKIGR 377 R + A QP P + + APR+ +++ R Sbjct: 386 RRIRAALPQPAPGRTQAAPRRQLRLRR 466
>LOC_Os07g36150:12007.t03287:unspliced-genomic formin homology 2 domain-containing protein 5, putative, expressed| Length = 5926 Score = 36.3 bits (73), Expect = 0.44 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 / -2 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRW 762 RW +R W WR + R WRW S W RW Sbjct: 3540 RWACFRRTRHGWRWRARWARASRFWWWRWRCSFWSRRW 3427
>LOC_Os07g36110:12007.t03283:unspliced-genomic expressed protein| Length = 1141 Score = 36.3 bits (73), Expect = 0.44 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -3 / -2 Query: 884 CKRRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQ 783 C R RG R +A W WR RG + R R R W+ Sbjct: 519 CTTR*RGRRTPSAGWAWRGGRGSTRRSTRRRRWR 418
>LOC_Os04g49970:12004.t04510:unspliced-genomic U box, putative, expressed| Length = 1587 Score = 36.3 bits (73), Expect = 0.44 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -3 / +1 Query: 839 WWRDPRGHSHRCIRWRWWQSLWMGRW 762 WWR PR C R WW + W W Sbjct: 1096 WWRAPRPPPRGCWRTWWWAAPWRSCW 1173
>LOC_Os10g08540:12010.t00674:unspliced-genomic cytochrome P450 76B1, putative, expressed| Length = 6858 Score = 36.3 bits (73), Expect = 0.44 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +2 / +1 Query: 722 SKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTP 868 S W R P W S + T P++ +T+ G P P TT S P Sbjct: 250 SAWARSPRWSSPRRTSPASSCRSTTPSSPPGPPPTPPVTTQGTPSRGFP 396
>LOC_Os07g42590:12007.t03910:unspliced-genomic F-box protein, putative, expressed| Length = 1840 Score = 36.3 bits (73), Expect = 0.44 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -2 / +3 Query: 273 SGAASPACARGSSPRCCGASGTACTRSCR 187 S +A PACA GSSP G C R CR Sbjct: 1212 SSSARPACACGSSPAARGGRWPRCRRPCR 1298
>LOC_Os05g02754:12005.t004759:unspliced-genomic expressed protein| Length = 1870 Score = 23.5 bits (45), Expect(3) = 0.48 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 / -2 Query: 842 WWWRDPRGHSHRCIRWRW 789 WW R R RWRW Sbjct: 1446 WWAC*SRWRRRRWWRWRW 1393 Score = 23.1 bits (44), Expect(3) = 0.48 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = -3 / -2 Query: 872 WRGWRLKTAHWWW 834 WR WR + WW Sbjct: 1533 WRAWRRCCSVCWW 1495 Score = 22.6 bits (43), Expect(3) = 0.48 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 / -2 Query: 767 RWPWWSTRRASCSIWNSPRSC 705 RW W R AS S W S C Sbjct: 1413 RWWRWRWR*ASRSGWGSRARC 1351
>LOC_Os02g27060:12002.t02400:unspliced-genomic HMG box family protein, expressed| Length = 4870 Score = 30.9 bits (61), Expect(2) = 0.48 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWWRDPRG 819 +RRWRGWR W R RG Sbjct: 355 RRRWRGWRRGRRAWRMRRGRG 417 Score = 22.6 bits (43), Expect(2) = 0.48 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPWWSTRRAS 735 RW + G WW TRR+S Sbjct: 493 RWWRTRRGLRGTRTWWRTRRSS 558
>LOC_Os04g52560:12004.t04730:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 4346 Score = 28.1 bits (55), Expect(2) = 0.48 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 / -1 Query: 863 WRLKTAHWWWRDPRGHSHRC 804 W + A W WR RG RC Sbjct: 191 WERRGASWGWRRGRGRCARC 132 Score = 25.4 bits (49), Expect(2) = 0.48 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -3 / -1 Query: 800 RWRWWQSLWMGRWPWW 753 R R W RWPWW Sbjct: 68 RRRRWGRRRWRRWPWW 21
>LOC_Os01g22520:12001.t01985:unspliced-genomic dihydrolipoyl dehydrogenase, mitochondrial precursor, putative,| expressed Length = 3624 Score = 29.9 bits (59), Expect(2) = 0.49 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWW 834 RR R WR + A WWW Sbjct: 297 RRTRRWRGRRATWWW 341 Score = 23.5 bits (45), Expect(2) = 0.49 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRWWQS 780 WWW R + R R R W S Sbjct: 336 WWWAAGREGTWRRSRRRSWGS 398
>LOC_Os03g37120:12003.t03173:unspliced-genomic ATP binding protein, putative, expressed| Length = 3314 Score = 28.1 bits (55), Expect(2) = 0.49 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = -3 / -3 Query: 839 WWRDPRGHSHRCIRWRWWQSL 777 WW R RWRWW L Sbjct: 1596 WWCSVTE*PTRVTRWRWWTRL 1534 Score = 25.4 bits (49), Expect(2) = 0.49 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 / -3 Query: 767 RWPWWSTRRASCSIWNSPRSC 705 RW WW+ S S NS C Sbjct: 1557 RWRWWTRLMVSTSARNSFSPC 1495
>LOC_Os12g35710:12012.t03259:unspliced-genomic extensin-like protein, putative, expressed| Length = 2620 Score = 29.5 bits (58), Expect(2) = 0.50 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 / -2 Query: 815 SHRCIRWRWWQSLWMGRWPWW 753 +HRC RWR W + WW Sbjct: 1458 AHRCWRWRAHWCRWWWGFHWW 1396 Score = 24.0 bits (46), Expect(2) = 0.50 Identities = 6/13 (46%), Positives = 6/13 (46%) Frame = -3 / -2 Query: 872 WRGWRLKTAHWWW 834 W GWR WW Sbjct: 1521 WWGWRAHRCRRWW 1483 Score = 34.1 bits (68), Expect = 2.2 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = -3 / -2 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLW 774 W W W WR R R W WW++ W Sbjct: 2076 WCRWWWGFHRWRWRTDRRRRWRRFYWWWWRAHW 1978 Score = 33.1 bits (66), Expect = 4.1 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 / +2 Query: 273 SGAASPACARGSSPRCCGASGTACTRSC 190 +G S AC R SSPR +S + C +C Sbjct: 893 AGTCSSACCRRSSPRWASSSSSTCRGTC 976
>LOC_Os03g25590:12003.t02257:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6195 Score = 28.6 bits (56), Expect(3) = 0.50 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 / +2 Query: 785 QSLWMGRWPWWSTRRASCSIWNSPR 711 QSL+ G WW + S W+S R Sbjct: 2786 QSLFRGIQSWWCNATSGASTWSSKR 2860 Score = 28.1 bits (55), Expect(3) = 0.50 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 / +2 Query: 273 SGAASPACARGSSPRCCGASG 211 S A P C+ GS P C G+ G Sbjct: 3029 SSATMPTCSLGSCPTCRGSPG 3091 Score = 23.5 bits (45), Expect(3) = 0.50 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -3 / +2 Query: 821 GHSHRCIRWRWWQSLWMGR 765 GH R R R+W S+ + R Sbjct: 596 GHRQRARRGRYWLSMTLAR 652
>LOC_Os05g02750:12005.t00174:unspliced-genomic membrane protein, putative, expressed| Length = 1139 Score = 23.5 bits (45), Expect(3) = 0.50 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRW 789 WW R R RWRW Sbjct: 198 WWAC*SRWRRRRWWRWRW 251 Score = 23.1 bits (44), Expect(3) = 0.50 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWW 834 WR WR + WW Sbjct: 111 WRAWRRCCSVCWW 149 Score = 22.6 bits (43), Expect(3) = 0.50 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 / +3 Query: 767 RWPWWSTRRASCSIWNSPRSC 705 RW W R AS S W S C Sbjct: 231 RWWRWRWR*ASRSGWGSRARC 293
>LOC_Os04g35890:12004.t03259:unspliced-genomic protein kinase, putative, expressed| Length = 2846 Score = 29.0 bits (57), Expect(3) = 0.55 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 / +1 Query: 842 WWWRDPRGHSHRCIRWRW 789 W R RG + RC RWRW Sbjct: 805 WRPRRRRGSAARCRRWRW 858 Score = 25.8 bits (50), Expect(3) = 0.55 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = -3 / +1 Query: 878 RRWRGWRLKTAHWWW 834 RRWR A WWW Sbjct: 610 RRWRWVAGSCAGWWW 654 Score = 23.1 bits (44), Expect(3) = 0.55 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = -3 / +1 Query: 770 GRWPWWSTRRASCSIWNSPRSCWLS 696 GRW W+ CS + +C S Sbjct: 2128 GRWGTWTRSTTGCST*RTRATCTAS 2202
>LOC_Os06g12610:12006.t01137:unspliced-genomic auxin efflux carrier component 1c, putative, expressed| Length = 3129 Score = 33.6 bits (67), Expect(2) = 0.56 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 / +3 Query: 707 SSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP 823 S W C RPSW + S ++TS C Y P Sbjct: 1965 SPWRCGS*PARPSWPPPPSPSASAARSSTSPSCRYSTTP 2081 Score = 24.9 bits (48), Expect(2) = 0.56 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +3 / +2 Query: 57 GSKPGSGGAATAQ 95 G++PG GGAA AQ Sbjct: 1061 GAQPGHGGAAQAQ 1099
>LOC_Os06g39370:12006.t03635:unspliced-genomic protein kinase Kelch repeat:Kelch, putative, expressed| Length = 1707 Score = 35.0 bits (70), Expect(2) = 0.59 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -3 / +2 Query: 836 WRDPRGHSHRCIRWRWWQSLWMGRWPWWST 747 W + G RWR W ++W G WWS+ Sbjct: 689 WVERVGACRCSARWRRWMAVWRGGSGWWSS 778 Score = 22.6 bits (43), Expect(2) = 0.59 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = -3 / +2 Query: 884 CKRRWRG 864 C+RRWRG Sbjct: 395 CRRRWRG 415
>LOC_Os10g37500:12010.t03010:unspliced-genomic ATP binding protein, putative, expressed| Length = 1944 Score = 35.9 bits (72), Expect = 0.61 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 / +1 Query: 809 RCIRWRWWQSLWMGRWPWWSTRRASC 732 R RWRWW+ W R W TR C Sbjct: 136 RTRRWRWWRCGWCCRTSRWRTRCGGC 213
>LOC_Os07g02150:12007.t00108:unspliced-genomic 3-5 exonuclease/ nucleic acid binding protein, putative, expressed| Length = 980 Score = 35.9 bits (72), Expect = 0.61 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 / +1 Query: 797 WRWWQSLWMGRWPWWSTRRAS 735 WRW GRWP W TRR S Sbjct: 715 WRWRARWSCGRWPAWGTRRCS 777
>LOC_Os05g09500:12005.t00826:unspliced-genomic hexokinase-1, putative, expressed| Length = 3979 Score = 35.9 bits (72), Expect = 0.61 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = -3 / +1 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRAS 735 WR + + WW R R R W W+ W RW RRA+ Sbjct: 157 WRRRWRRRSRWWRRCGRSARRRRRGWMGWRRRWPARWRRGWRRRAA 294
>LOC_Os04g40100:12004.t03575:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 2627 Score = 35.9 bits (72), Expect = 0.61 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -3 / +2 Query: 809 RCIRWRWWQSLWMGRWPWWSTR 744 R RW W W G W WW R Sbjct: 1562 RTARWSGWGGWWTGSWRWWPQR 1627
>LOC_Os03g42480:12003.t03652:unspliced-genomic expressed protein| Length = 6787 Score = 35.9 bits (72), Expect = 0.61 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQ 783 WRG + WWW R R WRWW+ Sbjct: 1275 WRG*ARRRWFWWWW*RRHGGSRRRGWRWWR 1364
>LOC_Os03g10680:12003.t00869:unspliced-genomic actin binding protein, putative, expressed| Length = 4512 Score = 35.9 bits (72), Expect = 0.61 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -3 / -3 Query: 800 RWRWWQSLWMGRWPW 756 RWRWW W RW W Sbjct: 1222 RWRWWWGRWRWRWRW 1178
>LOC_Os09g34330:12009.t03009:unspliced-genomic transcription factor AtMYC2, putative| Length = 855 Score = 35.9 bits (72), Expect = 0.61 Identities = 19/67 (28%), Positives = 30/67 (44%) Frame = +2 / +2 Query: 680 TAGDQ*TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSST 859 TAG + C W R PS + T PS+ A+ ++ T G P + ++ Sbjct: 371 TAGSATSAPRCLPCPAWTRPPSSPTPPPTSPSSAPASPASSPTRGRPPLRGLSRAPAAAA 550 Query: 860 STPSTSA 880 +TP T+A Sbjct: 551 ATPRTTA 571
>LOC_Os09g27370:12009.t02416:unspliced-genomic gamma-tubulin complex component 3, putative, expressed| Length = 3130 Score = 35.9 bits (72), Expect = 0.61 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +2 / +2 Query: 722 SKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSACK 886 S+ PSWCST+ S T G+ +T + T++P+ SAC+ Sbjct: 497 SRCGSTPSWCSTRRRCRRRRSCATCCTRARGSTAGTCGSTRAATRTTSPTASACR 661
>LOC_Os06g51070:12006.t04790:unspliced-genomic NAC domain-containing protein 68, putative, expressed| Length = 1047 Score = 35.9 bits (72), Expect = 0.61 Identities = 12/45 (26%), Positives = 28/45 (62%) Frame = +2 / +2 Query: 746 WCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 WC +++ ++ +TST T ++P PA+ + ++S+P+T++ Sbjct: 119 WCRGRSSSSTSSPPSTSTATTRASSPDSPASASASGTSSSPATAS 253
>LOC_Os04g32160:12004.t02895:unspliced-genomic conserved hypothetical protein| Length = 2957 Score = 35.9 bits (72), Expect = 0.61 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -2 / -2 Query: 273 SGAASPACARGSSPRCCGASGTACT 199 S AA PAC CCG GTACT Sbjct: 2914 SVAAPPACPSSGCCCCCGGGGTACT 2840
>LOC_Os01g72000:12001.t06491:unspliced-genomic armadillo repeat-containing protein, putative, expressed| Length = 3829 Score = 35.9 bits (72), Expect = 0.61 Identities = 23/85 (27%), Positives = 36/85 (42%) Frame = +2 / -1 Query: 617 VFLILGSGQEIVHSATILQAKTAGDQ*TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTS 796 V +L + + +T ++S S R PS S+ ++P + SA TS Sbjct: 511 VLTLLSQPTQRASRRSAAMTRTLASAPPAAASRASSAGTRTPSSSSSSPSLPCSASAATS 332 Query: 797 TECTYGNAP*DPATTNERSSTSTPS 871 + +A T RSSTSTP+ Sbjct: 331 RATSASSASAPFLTRTRRSSTSTPA 257
>LOC_Os08g37350:12008.t03472:unspliced-genomic ubiquitin-specific protease 16, putative, expressed| Length = 7441 Score = 27.6 bits (54), Expect(2) = 0.62 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 / +1 Query: 803 IRWRWWQSLWMG 768 +RW WW LW G Sbjct: 262 LRWWWWCGLWCG 297 Score = 25.4 bits (49), Expect(2) = 0.62 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWW 834 +RR R W L WWW Sbjct: 229 RRRRRWWWLW*LRWWW 276
>LOC_Os04g32090:12004.t02888:unspliced-genomic expressed protein| Length = 5592 Score = 30.9 bits (61), Expect(2) = 0.64 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 / +2 Query: 767 RWPWWSTRRASCSIWNSPRS 708 RW WW TRR S W R+ Sbjct: 278 RWWWWRTRRRSMRRWRRSRT 337 Score = 22.1 bits (42), Expect(2) = 0.64 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = -3 / +2 Query: 860 RLKTAHWWWRDPR 822 R + WWWR R Sbjct: 242 RRRRRRWWWRRRR 280
>LOC_Os06g03590:12006.t00251:unspliced-genomic conserved hypothetical protein| Length = 525 Score = 34.1 bits (68), Expect(2) = 0.65 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIRWRWW 786 R W WR + + R+ RG R RWRWW Sbjct: 129 RWWWRWRWRRSRRERRERRGRWARRRRWRWW 221 Score = 21.7 bits (41), Expect(2) = 0.65 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -3 / +3 Query: 767 RWPWWSTRR 741 RW WW RR Sbjct: 207 RWRWWWWRR 233
>LOC_Os09g34090:12009.t02985:unspliced-genomic sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating,| putative, expressed Length = 4294 Score = 29.0 bits (57), Expect(2) = 0.65 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -3 / -3 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIWNSPRSCWLSIDLRRS 678 W WW GR W S RR R W RRS Sbjct: 239 WLWWAERGRGRRRWTSGRRRRARRRGGGRGGWSGRR*RRS 120 Score = 24.0 bits (46), Expect(2) = 0.65 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 / -2 Query: 881 KRRWRGWRLKTAHWWW 834 + R G + TA WWW Sbjct: 321 RAREAGSQRSTARWWW 274
>LOC_Os10g04890:12010.t00369:unspliced-genomic expressed protein| Length = 4020 Score = 29.9 bits (59), Expect(2) = 0.70 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -3 / -1 Query: 842 WWWRDPRGHSHRCIRWRWW 786 WW R PR S C R WW Sbjct: 678 WWPRGPRCWSWSCTR*PWW 622 Score = 28.6 bits (56), Expect(2) = 0.70 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = -2 / -1 Query: 246 RGSSPRCCGASGTACTRSCRDGFA*SRGPWL 154 R P C R CR G A R PWL Sbjct: 168 RRGMPAPAPGRAAGCGRRCRSGTAAGRRPWL 76 Score = 33.6 bits (67), Expect = 3.0 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +2 / +1 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPST 874 TTSS+ CS W R + P +G A+++ A T R S S+P+T Sbjct: 112 TTSSTTCCSAWRRSRHTSPWRRPCPPSGGASSTARPASAAASAWTTTGRRRCSASSPTT 288
>LOC_Os04g54630:12004.t04935:unspliced-genomic SEP2, putative, expressed| Length = 1341 Score = 27.6 bits (54), Expect(2) = 0.70 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 / +3 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHR 807 R + WR + WW R PR + R Sbjct: 129 RSYARWRRRGGRWWRRRPRRNRRR 200 Score = 25.4 bits (49), Expect(2) = 0.70 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 / +3 Query: 776 WMGRWPWWSTRRASCSIWNSPRS 708 W WW RRA+ + PRS Sbjct: 279 WWRGGGWWRRRRAAAAARGPPRS 347
>LOC_Os06g22050:12006.t02020:unspliced-genomic loricrin, putative| Length = 690 Score = 30.9 bits (61), Expect(2) = 0.73 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 / +3 Query: 863 WRLKTAHWWWRDPRGHSHRCIRWRWWQ 783 WR + H D RG RWRWW+ Sbjct: 135 WRRRQWHVVQCDQRGRPEGWWRWRWWR 215 Score = 22.1 bits (42), Expect(2) = 0.73 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWW 753 RW+ W+ R WW Sbjct: 285 RWKQWRRRRRRRGRWW 332
>LOC_Os07g03680:12007.t00257:unspliced-genomic pathogenesis-related protein PRMS precursor, putative| Length = 549 Score = 30.9 bits (61), Expect(2) = 0.74 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 / -3 Query: 767 RWPWWSTRRASCSIWNSP 714 RWPWW + A+CS +P Sbjct: 454 RWPWWRSTPAACSGRTTP 401 Score = 22.1 bits (42), Expect(2) = 0.74 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / -3 Query: 833 RDPRGHSHRCIRWRWWQS 780 R R R RW WW+S Sbjct: 487 RRRRRRRPRRSRWPWWRS 434
>LOC_Os06g12910:12006.t01167:unspliced-genomic XPA-binding protein 2, putative| Length = 2406 Score = 34.5 bits (69), Expect(2) = 0.80 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 / +2 Query: 734 RRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTST 865 RRP CST+ + ++ S + S CT P PA T+ S+ T Sbjct: 1790 RRPCTCSTRGSRRTSASPSVS*RCTRRPRPPSPAATSSPSTRRT 1921 Score = 23.1 bits (44), Expect(2) = 0.80 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +2 / +2 Query: 947 SWSASATPSDAWLPWT 994 SW + ++P+ W WT Sbjct: 2249 SWPSRSSPTTPWNRWT 2296
>LOC_Os10g34840:12010.t02780:unspliced-genomic ripening-related protein 3 precursor, putative, expressed| Length = 840 Score = 35.4 bits (71), Expect = 0.83 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 / +2 Query: 881 KRRWRGWRLKTAHWWWRDPRGHS 813 +R RG TA WWWR PRG S Sbjct: 368 RRPARGGSTTTASWWWRCPRGGS 436
>LOC_Os10g25200:12010.t01942:unspliced-genomic expressed protein| Length = 7978 Score = 35.4 bits (71), Expect = 0.83 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -3 / +2 Query: 767 RWPWWSTRRASCSIWNSPRSCWLSIDLR 684 RW W++++ C +W+ CW++ +LR Sbjct: 4628 RWMAWTSQKTPCKLWHLKILCWINNNLR 4711
>LOC_Os06g03710:12006.t00263:unspliced-genomic DELLA protein SLR1, putative, expressed| Length = 3102 Score = 35.4 bits (71), Expect = 0.83 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -3 / -2 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWNSPR 711 R RWW+ W R P RR C W S R Sbjct: 947 RSRWWRRSWRRRRPAGRRRRRGCRAWRSRR 858
>LOC_Os05g27590:12005.t02410:unspliced-genomic wound-induced protein WI12 containing protein, expressed| Length = 818 Score = 35.4 bits (71), Expect = 0.83 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 / +3 Query: 884 CKRRWRGWRLKTAHWWWRDPRGHS 813 C+ RWR W WW + RGH+ Sbjct: 300 CRGRWRRWGAAAGGWWRKGGRGHA 371
>LOC_Os05g22550:12005.t01915:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1869 Score = 35.4 bits (71), Expect = 0.83 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 / -1 Query: 821 GHSHRCIRWRWWQSLWMGRWPW 756 G C+RWRWW RW W Sbjct: 1203 GEDGVCVRWRWWWRRGRWRWRW 1138
>LOC_Os04g25970:12004.t02304:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative| Length = 1491 Score = 35.4 bits (71), Expect = 0.83 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -3 / -3 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIWNSPRSCWLSIDLRRS 678 WR + GRW WWS+R C W R RRS Sbjct: 328 WRGARRGGGGRWSWWSSRARGCPGWRRGRRAGGRRGCRRS 209
>LOC_Os03g04560:12003.t00333:unspliced-genomic expressed protein| Length = 3686 Score = 35.4 bits (71), Expect = 0.83 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 / +3 Query: 884 CKRRWRGWRLKTAHWWWRDPRGHSHRCIRW 795 C R GWR + WWWR R + RW Sbjct: 1926 CCTRRGGWRRRWCRWWWRTWRTATTAASRW 2015
>LOC_Os01g46340:12001.t04085:unspliced-genomic pherophorin like protein, putative, expressed| Length = 5822 Score = 35.4 bits (71), Expect = 0.83 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = -3 / -3 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASC 732 RRWRG R R G C RW W + W GR TR C Sbjct: 1020 RRWRGRRSTRKRHARRGRVGLGLECRRWHWRRGRWNGRSTLN*TRGIGC 874
>LOC_Os12g04180:12012.t00308:unspliced-genomic heterogeneous nuclear ribonucleoprotein R, putative, expressed| Length = 4136 Score = 35.4 bits (71), Expect = 0.84 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +1 / +2 Query: 1087 LHCCLKFYCTLSRLNYLSALSSKAFYLFVLSSLCNFTFGCYPF 1215 L+CC Y + L +S ++ +L VL SLC F F +PF Sbjct: 638 LNCCHVIYSGIRFLLQISYYANCILFLIVLLSLCLFLFFSFPF 766
>LOC_Os10g06950:12010.t00558:unspliced-genomic extracellular signal-regulated kinase 1, putative, expressed| Length = 1270 Score = 35.4 bits (71), Expect = 0.84 Identities = 19/56 (33%), Positives = 27/56 (48%) Frame = +2 / +2 Query: 704 SSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPS 871 SSSW + S ST T P+T + + S AP P ++ R+S+ TPS Sbjct: 233 SSSWRATAAPAARSRSSTSPTAPATSTPSGSRLPASTRAPATPTSSRSRTSSPTPS 400
>LOC_Os06g09230:12006.t00802:unspliced-genomic serine threonine kinase, putative, expressed| Length = 4511 Score = 35.4 bits (71), Expect = 0.84 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 / +1 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTST 799 ++S W CS + +WCS+ A ST ++ TST Sbjct: 2671 SSSKRWRCSAASATRTWCSSSAPARSTAASCTST 2772
>LOC_Os01g39970:12001.t03523:unspliced-genomic serine threonine kinase 1, putative, expressed| Length = 3232 Score = 35.4 bits (71), Expect = 0.84 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 / +1 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECT 808 ++S W CS + +WCS+ A +T +++TST T Sbjct: 2191 SSSRRWRCSAASATQTWCSSSAPARTTAASSTSTWTT 2301
>LOC_Os07g10250:12007.t00899:unspliced-genomic ATP-dependent RNA helicase DED1, putative, expressed| Length = 6296 Score = 27.6 bits (54), Expect(2) = 0.85 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 / +2 Query: 794 RWWQSLWMGRWPWWSTR 744 +WW +W RW W R Sbjct: 5702 QWWWRVWWWRWRLWRWR 5752 Score = 24.9 bits (48), Expect(2) = 0.85 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = -3 / +2 Query: 872 WRGWRLKTAHWWWR 831 W G + WWWR Sbjct: 5675 WPGLPTRQRQWWWR 5716 Score = 32.7 bits (65), Expect = 5.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 / -2 Query: 255 ACARGSSPRCCGASGTACTRSC 190 A A GS+P C GA+G A R C Sbjct: 673 AAAEGSAPACAGAAGAAWPRRC 608
>LOC_Os06g19570:12006.t01776:unspliced-genomic conserved hypothetical protein| Length = 1425 Score = 28.6 bits (56), Expect(2) = 0.91 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 / +2 Query: 881 KRRWRGWRLKTAHWWWRDPR 822 ++RWRG R + WW R R Sbjct: 1064 RQRWRGARWRRIQWWGRRRR 1123 Score = 28.1 bits (55), Expect(2) = 0.91 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWWSTRR 741 R RWW+ R WW RR Sbjct: 1269 RRRWWRGARWRRIQWWGRRR 1328
>LOC_Os12g42820:12012.t03955:unspliced-genomic SWITCH1 splice variant S, putative| Length = 2103 Score = 29.0 bits (57), Expect(2) = 0.92 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +2 / +2 Query: 773 STGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 ++G TTS T NAP P T R + P T A Sbjct: 266 TSGGTTTSRATTLPNAPWTPRGTTTRRAPPRPRTRA 373 Score = 23.5 bits (45), Expect(2) = 0.92 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 / +2 Query: 722 SKWNRRPSWCSTKATVPSTGSAT 790 S+W R S CS A+ +GS + Sbjct: 194 SRWRRASSRCSAAASGGGSGSGS 262
>LOC_Os05g38320:12005.t03374:unspliced-genomic avr9/Cf-9 rapidly elicited protein 137, putative, expressed| Length = 1491 Score = 29.0 bits (57), Expect(2) = 0.94 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 / -3 Query: 734 RRPSWCSTKATVPSTGSAT 790 R P+WCST A+ P + +AT Sbjct: 196 RPPAWCSTAASPPPSPTAT 140 Score = 23.5 bits (45), Expect(2) = 0.94 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 / -1 Query: 682 RRRSIDNQQLLGLFQMEQEALL 747 RRR + + LG Q EQE L+ Sbjct: 285 RRRGVQRRHRLGAGQPEQERLV 220
>LOC_Os11g43630:12011.t03893:unspliced-genomic loricrin, putative| Length = 926 Score = 26.7 bits (52), Expect(2) = 0.96 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 / +2 Query: 866 GWRLKTAHWWWR 831 GWR WWWR Sbjct: 578 GWRDDRCWWWWR 613 Score = 25.8 bits (50), Expect(2) = 0.96 Identities = 6/15 (40%), Positives = 7/15 (46%) Frame = -3 / +2 Query: 797 WRWWQSLWMGRWPWW 753 WR + W W WW Sbjct: 608 WRLHRRRWQDNWCWW 652
>LOC_Os05g01950:12005.t00094:unspliced-genomic expressed protein| Length = 829 Score = 27.2 bits (53), Expect(2) = 0.97 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 / +3 Query: 866 GWRLKTAHWWWRDPRGHSHRCIRWRWW 786 G R + W R R S RWRWW Sbjct: 222 GGRRRWGRWRRRGTRT*SRGRWRWRWW 302 Score = 25.4 bits (49), Expect(2) = 0.97 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -3 / +3 Query: 767 RWPWWSTRRASCS 729 RW WW R CS Sbjct: 288 RWRWWGRRSRYCS 326
>LOC_Os09g24330:12009.t02116:unspliced-genomic ATP binding protein, putative, expressed| Length = 865 Score = 29.5 bits (58), Expect(2) = 1.0 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +2 / +2 Query: 752 STKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPST 874 +T T P+T S++TST T + R TST ST Sbjct: 362 ATAPTAPTTSSSSTSTSPTRASTRSSSPPLRRRPETSTVST 484 Score = 26.3 bits (51), Expect(2) = 1.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 315 PAQPQPNKRKLAPRKSVKIGRP 380 P + +P R+ APR+ V GRP Sbjct: 231 PPRRRPGGRRQAPRRRVPPGRP 296
>LOC_Os07g45170:12007.t04156:unspliced-genomic catalytic/ protein phosphatase type 2C/ protein serine/threonine| phosphatase, putative, expressed Length = 1819 Score = 33.6 bits (67), Expect(2) = 1.1 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -3 / +2 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIRWR 792 RRW GWR + W W R C R R Sbjct: 86 RRWGGWRCRGRGWCWSTRRWRWRGCTRTR 172 Score = 23.1 bits (44), Expect(2) = 1.1 Identities = 7/17 (41%), Positives = 7/17 (41%) Frame = -3 / +2 Query: 797 WRWWQSLWMGRWPWWST 747 WR W WP W T Sbjct: 473 WRRWWRGVRSTWPTWGT 523 Score = 32.2 bits (64), Expect = 7.7 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -3 / +2 Query: 869 RGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRW 762 RG R WWWR PR S R R R + RW Sbjct: 338 RGRREGGGWWWWRTPRRRSGRRSRRRTRRCTRRTRW 445
>LOC_Os10g42410:12010.t03466:unspliced-genomic expressed protein| Length = 2487 Score = 35.0 bits (70), Expect = 1.1 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = -3 / -2 Query: 836 WRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRSC 705 WR RG WR W+ W RW + R CS + SC Sbjct: 1595 WRPWRGRGVVSSSWRRWRWRWRRRWRRGGSSRRPCSRGSRSGSC 1464
>LOC_Os09g23530:12009.t02037:unspliced-genomic mannitol dehydrogenase, putative, expressed| Length = 1622 Score = 35.0 bits (70), Expect = 1.1 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 / +2 Query: 770 GRWPWWSTRRASCSIWNSPRS 708 GRW WW+ RR CS SP S Sbjct: 1112 GRWWWWARRRRRCSCPRSPSS 1174
>LOC_Os09g20860:12009.t01820:unspliced-genomic calmodulin binding protein, putative, expressed| Length = 3658 Score = 35.0 bits (70), Expect = 1.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 / -3 Query: 881 KRRWRGWRLKTAHWWWRDPR 822 +RRWRG + WWWR PR Sbjct: 170 RRRWRGGCPGGSWWWWRPPR 111
>LOC_Os08g09350:12008.t00820:unspliced-genomic protein gar2, putative, expressed| Length = 4417 Score = 35.0 bits (70), Expect = 1.1 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPWWSTRRASC 732 RW WWQ W R W + +A C Sbjct: 3913 RWTWWQRWWQKRRTWRFSEQAEC 3981
>LOC_Os08g07380:12008.t00627:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 11067 Score = 35.0 bits (70), Expect = 1.1 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -3 / +1 Query: 824 RGHSHRCIRWRWWQSLWMGRWPWW 753 +G + R W WW W+ R PWW Sbjct: 2215 QGVNSRRAWWIWWNPWWIWRRPWW 2286
>LOC_Os04g25380:12004.t02247:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative, expressed| Length = 1662 Score = 35.0 bits (70), Expect = 1.1 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = -3 / -1 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIWNSPR 711 WR + GRW WWS+R C W R Sbjct: 381 WRGARRGGGGRWSWWSSRARGCPGWRRGR 295
>LOC_Os01g69230:12001.t06276:unspliced-genomic protein binding protein, putative, expressed| Length = 3256 Score = 35.0 bits (70), Expect = 1.1 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 / +3 Query: 884 CKRRWRGWRLKTAHWW 837 C+RRWRGWR +A W Sbjct: 453 CRRRWRGWRTSSATCW 500
>LOC_Os09g03110:12009.t00210:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 10233 Score = 35.0 bits (70), Expect = 1.1 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 / +2 Query: 752 STKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSAC 883 +TKAT + GSA + P D T +RS+ S P S C Sbjct: 4349 TTKATTSAAGSADATKAAASAADPTDSVETADRSADSAPGVSEC 4480
>LOC_Os05g30390:12005.t02638:unspliced-genomic glycosyl hydrolase family 1 protein| Length = 6794 Score = 35.0 bits (70), Expect = 1.1 Identities = 18/56 (32%), Positives = 29/56 (51%) Frame = -1 / +2 Query: 1246 FFFDNNTIVCQKGNIQK*SYKEMTTQTDRMPYLKAHLNNLICLKYSKISDNNVAHI 1079 FF+ N I+C K I +YKE +T T + + L+ K SK+ NN+ ++ Sbjct: 3119 FFY*NIRIICNKIIIF*SAYKEKSTHTTFIFFSILIFRELLIDKISKVRQNNIVYL 3286
>LOC_Os03g42790:12003.t03680:unspliced-genomic ubiquitin-protein ligase/ zinc ion binding protein, putative,| expressed Length = 3526 Score = 35.0 bits (70), Expect = 1.1 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 / +2 Query: 261 SPACARGSSPRCCGASGTACTR 196 SPA +RG +P C GAS T+C R Sbjct: 3107 SPASSRGCAPGCTGASRTSCCR 3172
>LOC_Os02g40440:12002.t03680:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 1827 Score = 35.0 bits (70), Expect = 1.1 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 / +2 Query: 746 WCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 WCS++ ++ + TTS C G A TT+ SS ST +S Sbjct: 782 WCSSRWEATTS*TTTTSCPCPCGRASTPSRTTSRSSSPSTGKSS 913
>LOC_Os02g36440:12002.t03281:unspliced-genomic sugar transport protein 5, putative, expressed| Length = 4628 Score = 35.0 bits (70), Expect = 1.1 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -2 / +3 Query: 261 SPACARGSSPRCCGASGTACTRSCRDGFA*SRGPW 157 S +C+R S RCC AS TA + + DG+ * R W Sbjct: 4152 SRSCSRSHSWRCCAASSTAPSPTTPDGW***RRSW 4256
>LOC_Os01g41990:12001.t03719:unspliced-genomic calmodulin, putative, expressed| Length = 1410 Score = 35.0 bits (70), Expect = 1.1 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 / +2 Query: 740 PSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 PSW S +++ S + T T + P P T SSTS+P S Sbjct: 353 PSWSSPRSSALSASARPRGTRSTPSSPPSTPTATAPSSSTSSPPPS 490
>LOC_Os04g50800:12004.t04558:unspliced-genomic expressed protein| Length = 1853 Score = 26.3 bits (51), Expect(2) = 1.2 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 / -1 Query: 878 RRWRGWRLKTAHWWW 834 RRW R + WWW Sbjct: 107 RRWLALRSSSPPWWW 63 Score = 25.8 bits (50), Expect(2) = 1.2 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -3 / -1 Query: 842 WWWRDPRGHSHRCIRW 795 WWWR R C+ W Sbjct: 65 WWWRRRRRR*SVCVGW 18
>LOC_Os06g10870:12006.t00964:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 858 Score = 27.2 bits (53), Expect(2) = 1.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = -3 / +3 Query: 887 ICKRRWRGWRLKTAHWWW 834 IC RRW WR WW Sbjct: 453 ICSRRWPRWRRWGWTKWW 506 Score = 24.9 bits (48), Expect(2) = 1.3 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRWPW 756 W W LW RW W Sbjct: 549 WGIWSLLWSLRW*W 590 Score = 24.0 bits (46), Expect(3) = 8.4 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = -3 / +3 Query: 782 SLWMGRWPWW 753 S W RW WW Sbjct: 600 SRWRPRWRWW 629 Score = 23.1 bits (44), Expect(3) = 8.4 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = -3 / +3 Query: 887 ICKRRWRGWRLKTAHWWW 834 IC W GWR WW Sbjct: 201 IC*WGWWGWRWWRRTKWW 254 Score = 23.1 bits (44), Expect(3) = 8.4 Identities = 7/20 (35%), Positives = 9/20 (45%) Frame = -3 / +3 Query: 842 WWWRDPRGHSHRCIRWRWWQ 783 WWWR R W W++ Sbjct: 345 WWWRWRRWTKRWVWVWFWFR 404
>LOC_Os05g35460:12005.t03139:unspliced-genomic patellin-1, putative, expressed| Length = 2997 Score = 30.9 bits (61), Expect(2) = 1.3 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWR 792 RW WR T W WR P R WR Sbjct: 238 RWWWWRRPTRWWRWRRPWRWRRRRRSWR 321 Score = 26.3 bits (51), Expect(2) = 1.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 / +1 Query: 246 RGSSPRCCGASGTACTRS 193 R S RCCGAS +A T S Sbjct: 1021 RCSRRRCCGASASASTPS 1074
>LOC_Os04g55680:12004.t05040:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative, expressed| Length = 1832 Score = 29.0 bits (57), Expect(3) = 1.4 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPWWSTRR 741 RWR W S GRW W R Sbjct: 1132 RWRTWGSSACGRWARWRRTR 1191 Score = 24.0 bits (46), Expect(3) = 1.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 / +1 Query: 219 ASGTACTRSCRDGFA*SRGPW 157 A+GT C R G RGPW Sbjct: 1513 AAGTRCWRRWPPGCRCWRGPW 1575 Score = 22.1 bits (42), Expect(3) = 1.4 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = -1 / +1 Query: 355 RGASLRLFGWGCAG 314 RG R GW CAG Sbjct: 1414 RGRRRRRAGWWCAG 1455
>LOC_Os09g23200:12009.t02004:unspliced-genomic myb-like DNA-binding domain, SHAQKYF class family protein| Length = 6838 Score = 25.8 bits (50), Expect(2) = 1.5 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 / +2 Query: 875 RWRGWRLKTAHWWWRDPRG 819 R RG + A WWW + G Sbjct: 1145 RRRGEGVAAAGWWWEEEEG 1201 Score = 25.8 bits (50), Expect(2) = 1.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 / +3 Query: 770 GRWPWWSTRRA 738 GRW WWS R A Sbjct: 1281 GRWWWWSGRAA 1313
>LOC_Os04g54810:12004.t04954:unspliced-genomic beta-D-xylosidase, putative, expressed| Length = 6793 Score = 29.5 bits (58), Expect(2) = 1.5 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = -3 / +1 Query: 824 RGHSHRCIRWRWWQSLWMGRWPWWSTRRASCSIWNSPRS 708 R + R R W W RW W T R C W S R+ Sbjct: 313 RRAARRGRRTCWGG*RWRRRWGSW*TSRRRCRGWGSRRT 429 Score = 22.1 bits (42), Expect(2) = 1.5 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWWR 831 +R W R + WWWR Sbjct: 160 QRPWPWRRGECWPWWWR 210
>LOC_Os03g13920:12003.t01185:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6251 Score = 26.7 bits (52), Expect(2) = 1.5 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -3 / -2 Query: 836 WRDPRGHSHRCIRWRWWQSLWMGR 765 WR R RWR W+S W R Sbjct: 4900 WRRRARWRRRRARWRRWRSRWRWR 4829 Score = 24.9 bits (48), Expect(2) = 1.5 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 / -2 Query: 878 RRWRGWRLKTAHW 840 RRW WR + A W Sbjct: 5044 RRWSEWRAEEARW 5006 Score = 25.4 bits (49), Expect(2) = 3.7 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = -3 / -2 Query: 839 WWRDPRGHSHRCIRWRWW 786 WWR + +RWR W Sbjct: 5089 WWRRRQARWGSSVRWRRW 5036 Score = 24.9 bits (48), Expect(2) = 3.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 / -2 Query: 767 RWPWWSTRRASCSIWNSPRS 708 RW WS RA + W PR+ Sbjct: 5050 RWRRWSEWRAEEARWRRPRA 4991
>LOC_Os03g19900:12003.t01752:unspliced-genomic AP2 domain containing protein, expressed| Length = 5170 Score = 26.3 bits (51), Expect(2) = 1.6 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = -3 / -1 Query: 869 RGWRLKTAHWWW 834 R W+ K+ WWW Sbjct: 4747 RSWQRKSLWWWW 4712 Score = 25.4 bits (49), Expect(2) = 1.6 Identities = 7/17 (41%), Positives = 7/17 (41%) Frame = -3 / -1 Query: 797 WRWWQSLWMGRWPWWST 747 W WW W W W T Sbjct: 4723 WWWWWWWWWWWWCVWGT 4673
>LOC_Os01g59180:12001.t05308:unspliced-genomic cyclin-like F-box, putative, expressed| Length = 4573 Score = 27.2 bits (53), Expect(2) = 1.6 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 / -1 Query: 776 WMGRWPWWSTRRASC 732 W RW WW R C Sbjct: 589 WWWRWWWWCNERQRC 545 Score = 24.4 bits (47), Expect(2) = 1.6 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -3 / -1 Query: 860 RLKTAHWWWR 831 R + A WWWR Sbjct: 607 RCRCARWWWR 578
>LOC_Os10g34270:12010.t02725:unspliced-genomic expressed protein| Length = 1005 Score = 34.5 bits (69), Expect = 1.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -3 / -2 Query: 803 IRWRWWQSLWMGRWPW 756 + WRWW+ W WPW Sbjct: 401 MEWRWWRLGWAWPWPW 354
>LOC_Os03g55080:12003.t04772:unspliced-genomic OsWRKY3 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 3737 Score = 34.5 bits (69), Expect = 1.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 / +1 Query: 824 RGHSHRCIRWRWWQSLWMGRWPWWSTRR 741 R + + R W++ W+ RW WW RR Sbjct: 184 RRRARKAARG*WYRRRWICRWMWWGRRR 267
>LOC_Os01g65220:12001.t05888:unspliced-genomic XRN3, putative, expressed| Length = 7877 Score = 34.5 bits (69), Expect = 1.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 / +2 Query: 887 ICKRRWRGWRLKTAHWWW 834 +C+R GWR T WWW Sbjct: 176 VCRRSTGGWRRSTRWWWW 229
>LOC_Os01g38970:12001.t03430:unspliced-genomic carbamoyl-phosphate synthase large chain, putative, expressed| Length = 5160 Score = 34.5 bits (69), Expect = 1.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 / -2 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMGR 765 WWWR +G R RWW+ GR Sbjct: 113 WWWRRGKGRREERWRRRWWEGDGEGR 36
>LOC_Os12g05050:12012.t00393:unspliced-genomic stem-specific protein TSJT1, putative, expressed| Length = 3617 Score = 34.5 bits (69), Expect = 1.6 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = +2 / -2 Query: 710 SWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTST 865 +W+ ++W R PS T + P T+S +G+ PA T+ +++T Sbjct: 349 AWE*ARWPRSPSCTDTAGSAPPRKRLTSSDARVFGDGVRLPAATSSAGTSTT 194
>LOC_Os12g02250:12012.t00121:unspliced-genomic mitogen-activated protein kinase, putative, expressed| Length = 6317 Score = 34.5 bits (69), Expect = 1.6 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = +2 / +3 Query: 704 SSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 +SS S W R + +T + ST SA + C+ + P ATT RS+ +P S+ Sbjct: 3915 ASSARRSSWPPRCTTSATASASTSTPSACACSRCSPTSTPTASATTQRRSTRRSPPASS 4091
>LOC_Os08g40280:12008.t03759:unspliced-genomic lectin-like protein kinase, putative, expressed| Length = 4298 Score = 34.5 bits (69), Expect = 1.6 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 / +3 Query: 734 RRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPST 874 R W ST+ + +T + TTS + ++P P ++ +S S PST Sbjct: 939 RSSPWSSTRRSSRTTRTTTTSASTSTASSPSPPPRSSRSASRSPPST 1079
>LOC_Os07g13660:12007.t01231:unspliced-genomic cytokinin-N-glucosyltransferase 1, putative, expressed| Length = 2495 Score = 34.5 bits (69), Expect = 1.6 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +2 / -3 Query: 197 RVQAVPDAPQQRGELPRAHAGEAA 268 RV AV DAP++ EL AHAG+AA Sbjct: 1038 RVSAVGDAPRRLDELAGAHAGDAA 967
>LOC_Os04g52660:12004.t04740:unspliced-genomic expressed protein| Length = 4548 Score = 34.5 bits (69), Expect = 1.6 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 / +3 Query: 740 PSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTP 868 P+W ST ++ +T S +S T G PAT+ +T TP Sbjct: 519 PAWSSTSSSTSTTSSTASSPATTCGALRWPPATSATSGTTPTP 647
>LOC_Os02g12850:12002.t01082:unspliced-genomic heterogeneous nuclear ribonucleoprotein A3, putative, expressed| Length = 4158 Score = 27.2 bits (53), Expect(2) = 1.6 Identities = 11/33 (33%), Positives = 12/33 (36%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWWSTRRASCSIWNSPRSCW 702 R WW LW W R W+ R CW Sbjct: 3474 RCLWWWCLWWRSGCLWWCWRIWQLWWSWSRRCW 3572 Score = 24.4 bits (47), Expect(2) = 1.6 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWW 834 WRG + WWW Sbjct: 3453 WRGCLWRRCLWWW 3491
>LOC_Os11g47870:12011.t04279:unspliced-genomic chitin-inducible gibberellin-responsive protein 2, putative,| expressed Length = 2449 Score = 29.0 bits (57), Expect(2) = 1.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 / -3 Query: 881 KRRWRGWRLKTAHWWWR 831 +RRWR R WWWR Sbjct: 383 RRRWRRRRSWLCCWWWR 333 Score = 22.6 bits (43), Expect(2) = 1.6 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = -3 / -2 Query: 797 WRWWQSLWMGRW 762 W W ++ W G W Sbjct: 261 WAWRRAGWSGNW 226
>LOC_Os04g02850:12004.t00179:unspliced-genomic expressed protein| Length = 2424 Score = 28.6 bits (56), Expect(2) = 1.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 / -3 Query: 767 RWPWWSTRRASCSIWNSPRS 708 RWPWWS R S + S R+ Sbjct: 1003 RWPWWSRRARSRPLPPSART 944 Score = 23.1 bits (44), Expect(2) = 1.6 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -3 / -3 Query: 833 RDPRGHSHRCIRWRWW 786 R PR RW WW Sbjct: 1036 RTPRSARTPAARWPWW 989
>LOC_Os07g43660:12007.t04011:unspliced-genomic hypothetical protein| Length = 2302 Score = 29.0 bits (57), Expect(2) = 1.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -3 / -1 Query: 818 HSHRCIRWRWWQSLWMGRWPWWSTRR 741 H RC RW W RW WS R Sbjct: 1891 HRRRCCWRRWRAWSWSRRWRAWSWSR 1814 Score = 22.6 bits (43), Expect(2) = 1.6 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = -3 / -2 Query: 884 CKRRWRGW 861 C RRWR W Sbjct: 2004 CWRRWRAW 1981
>LOC_Os03g51990:12003.t04527:unspliced-genomic amino acid binding protein, putative, expressed| Length = 1999 Score = 27.2 bits (53), Expect(2) = 1.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 / +1 Query: 182 PSRQLRVQAVPDAPQQRGELPRA 250 P RQ V V D P+QRG RA Sbjct: 595 PRRQRAVAQVHDVPRQRGRAGRA 663 Score = 24.4 bits (47), Expect(2) = 1.7 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 / +3 Query: 258 GKRHQTNLAKRAAREAKDAPAQPQPNKRK 344 G+R +T A RA ++ A P+P +R+ Sbjct: 771 GRRGRTAGAPRACSTSRRPAAAPRPRRRR 857 Score = 30.4 bits (60), Expect(2) = 9.7 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 / -3 Query: 249 ARGSSPRCCGASGTACTRSCRDGFA*SRGP 160 AR + PRC G S T T CR G R P Sbjct: 662 ARPARPRCRGTS*TWATARCRRGAGTGRAP 573 Score = 23.1 bits (44), Expect(2) = 9.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 / -2 Query: 743 RASCSIWNSPRSCW 702 R+SC W S RS W Sbjct: 1017 RSSCISWCSRRSVW 976
>LOC_Os09g35630:12009.t03041:unspliced-genomic protein binding protein, putative, expressed| Length = 2838 Score = 31.8 bits (63), Expect(2) = 1.7 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +2 / +1 Query: 740 PSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTP 868 P WCS++ +++++ T +AP P+ + +STS+P Sbjct: 1147 PRWCSSRTQRRRPSASSSNAAPTRPSAPPSPSPASASTSTSSP 1275 Score = 24.9 bits (48), Expect(2) = 1.7 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 / +3 Query: 291 AAREAKDAPAQPQPNKRKLAPRKSVKIGRPGYTVTKQYDPD 413 AA K++ A P P A R+ RPG + ++ PD Sbjct: 681 AAAAMKESSAPPPPAAAAAAAREDEWEVRPGGMLVQKRSPD 803
>LOC_Os01g08220:12001.t00700:unspliced-genomic gibberellin 3-beta-dioxygenase 2-2, putative, expressed| Length = 1288 Score = 28.6 bits (56), Expect(2) = 1.7 Identities = 11/30 (36%), Positives = 12/30 (40%) Frame = -3 / +1 Query: 884 CKRRWRGWRLKTAHWWWRDPRGHSHRCIRW 795 C+RR RG T WW RC W Sbjct: 121 CRRRTRGRGWTTTRWWTAAAAAARTRCRWW 210 Score = 23.1 bits (44), Expect(2) = 1.7 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPWWSTRRAS 735 R RWW S R W RR+S Sbjct: 196 RCRWWTSGRATRRRGWRGRRSS 261
>LOC_Os07g39700:12007.t03631:unspliced-genomic expressed protein| Length = 1032 Score = 29.5 bits (58), Expect(2) = 1.7 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -3 / +2 Query: 878 RRWRGWRLKTAHWWWRDPRGHSHRCIRWR 792 RRW R + WW PR +RWR Sbjct: 296 RRWPRRRGRACRWWSSRPRRVRAGLVRWR 382 Score = 22.1 bits (42), Expect(2) = 1.7 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = -3 / +2 Query: 797 WRWWQSLWMGRWPWWS 750 WRW G W WS Sbjct: 431 WRWRTRTRRGAWCSWS 478
>LOC_Os09g27270:12009.t02406:unspliced-genomic RRNA methyltransferase 3, putative| Length = 477 Score = 31.3 bits (62), Expect(2) = 2.0 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +2 / +2 Query: 704 SSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYG 814 SSS S RR + CST A P GS ST C +G Sbjct: 92 SSSTRGSASCRRRARCSTSARRPGDGSRWPSTTCLWG 202 Score = 22.6 bits (43), Expect(2) = 2.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 / +3 Query: 221 PQQRGELPRAHAGEAAP 271 P+Q ELP + +AAP Sbjct: 45 PRQEAELPESRGLQAAP 95
>LOC_Os10g01560:12010.t00052:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor,| putative, expressed Length = 3466 Score = 32.2 bits (64), Expect(2) = 2.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 / -1 Query: 767 RWPWWSTRRASCSIWNSPRSC 705 RW WW+ S S WNS C Sbjct: 2149 RWRWWTRLMMSTSAWNSRSPC 2087 Score = 24.4 bits (47), Expect(2) = 2.0 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = -3 / -2 Query: 800 RWRWWQS 780 RWRWW S Sbjct: 2952 RWRWWSS 2932
>LOC_Os09g16950:12009.t01482:unspliced-genomic protein kinase, putative, expressed| Length = 3209 Score = 25.8 bits (50), Expect(2) = 2.2 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -3 / -3 Query: 863 WRLKTAHWWWR 831 WR K WWWR Sbjct: 420 WR*KWIWWWWR 388 Score = 25.4 bits (49), Expect(2) = 2.2 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = -3 / -3 Query: 797 WRWWQSLWMGRWPW 756 W WQ W RW W Sbjct: 396 WWRWQWRWRWRWRW 355
>LOC_Os12g29160:12012.t02626:unspliced-genomic fibroin heavy chain precursor, putative| Length = 4576 Score = 34.1 bits (68), Expect = 2.2 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = -3 / +1 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWW 753 R R W W W R R W W W G + WW Sbjct: 4225 RCRCWFFTNRRWRWNPLRWWRTRRCAWWGWFWWWCGTYWWW 4347
>LOC_Os11g28360:12011.t02449:unspliced-genomic ubiquitin carboxyl-terminal hydrolase 5, putative, expressed| Length = 4457 Score = 34.1 bits (68), Expect = 2.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -3 / +1 Query: 800 RWRWWQSLWMGRWPWW 753 RWRW W RW WW Sbjct: 226 RWRWRWRRWRWRWRWW 273
>LOC_Os10g38040:12010.t03058:unspliced-genomic lysM domain containing protein, expressed| Length = 1203 Score = 34.1 bits (68), Expect = 2.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRW 762 RW WW+ W GRW Sbjct: 117 RWAWWRCCWWGRW 155
>LOC_Os10g03690:12010.t00258:unspliced-genomic F-box domain containing protein, expressed| Length = 3089 Score = 34.1 bits (68), Expect = 2.2 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 / -3 Query: 462 DNSKPRHRFMASYEQKIQSWDKRYQYL 542 ++SK RHR A +EQKI W K +Q + Sbjct: 240 ESSKIRHRSKARFEQKIDGWVKIFQQI 160
>LOC_Os09g33610:12009.t02937:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9084 Score = 34.1 bits (68), Expect = 2.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 / +2 Query: 857 LKTAHWWWRDPRGHSHRCIRWRWWQ 783 L TA WW R RG + WRW Q Sbjct: 4484 LSTARWWGRHGRGRTRCFSSWRWRQ 4558
>LOC_Os09g23560:12009.t02040:unspliced-genomic mannitol dehydrogenase, putative, expressed| Length = 1991 Score = 34.1 bits (68), Expect = 2.2 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -3 / +1 Query: 770 GRWPWWSTRRASCSIWNSPRS 708 GRW WW+ RR CS +P S Sbjct: 1183 GRWWWWARRRCRCSCPRTPSS 1245
>LOC_Os08g37490:12008.t03486:unspliced-genomic 14-3-3-like protein A, putative, expressed| Length = 2240 Score = 34.1 bits (68), Expect = 2.2 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = -3 / +2 Query: 860 RLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRR 741 R + W R G R WR W+S G WWS+ R Sbjct: 80 RERERRWRRRREEGRGRRWCTWRSWRSRRRGTRRWWSSWR 199
>LOC_Os07g44690:12007.t04109:unspliced-genomic AT-HSFB4, putative, expressed| Length = 3262 Score = 34.1 bits (68), Expect = 2.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 / -1 Query: 842 WWWRDPRGHSHRCIRWRWWQSLWMG 768 WW+ G S + +RW WW W G Sbjct: 2260 WWYAGGGGGSEKGLRWWWWW*GWCG 2186 Score = 33.1 bits (66), Expect = 4.1 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 / +1 Query: 734 RRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 RR SW +T A S A T+ + G PAT++ +S++T S ++ Sbjct: 232 RRTSWWTTPAPTTSCRGARTTPPSSCGGRRSSPATSSPTTSSTTTSPAS 378
>LOC_Os07g03530:12007.t00243:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3275 Score = 34.1 bits (68), Expect = 2.2 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -3 / -2 Query: 869 RGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRWPWWSTRRAS 735 R WR W R + + R R RW + W R W + RR S Sbjct: 1786 RRWRRSRRRWCRRTWQRNRRRWCRRRWCRRRWRSRRRWCTRRRLS 1652
>LOC_Os05g38070:12005.t03349:unspliced-genomic conserved hypothetical protein| Length = 657 Score = 34.1 bits (68), Expect = 2.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 / +2 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIWNS 717 WR S W R WW++RR + + W++ Sbjct: 509 WRPTSSAWRHRCSWWTSRRMAATPWST 589
>LOC_Os03g42040:12003.t03611:unspliced-genomic HEAT repeat family protein, expressed| Length = 7449 Score = 34.1 bits (68), Expect = 2.2 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +3 / +3 Query: 261 KRHQTNLAKRAAREAKDAPAQPQPNKRKLAPRKSVKIGRPGYTVTKQYDP 410 +RH +R A + P P+P +L PR + GRPG ++ P Sbjct: 87 RRHPLPRRRRRAAQGPSPPQAPRPLPPRLPPRPPLPPGRPGAAPLRRRRP 236
>LOC_Os02g43330:12002.t03918:unspliced-genomic homeobox-leucine zipper protein ATHB-6, putative, expressed| Length = 1415 Score = 34.1 bits (68), Expect = 2.2 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -3 / +2 Query: 872 WRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLWMGRW 762 W WR + WW R R + R RW + GRW Sbjct: 89 WEKWRATASSWWRRRSRTCTTTRRRRRWTRRSSCGRW 199
>LOC_Os11g02300:12011.t00124:unspliced-genomic mitogen-activated protein kinase, putative, expressed| Length = 6263 Score = 34.1 bits (68), Expect = 2.2 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = +2 / +3 Query: 704 SSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 +SS S W R + +T + ST SA + C+ + P ATT RS+ +P S+ Sbjct: 3528 ASSARRSSWPPRCTTSATASASTSTPSACACSRCSPTSIPTASATTRRRSTRRSPPASS 3704
>LOC_Os10g34480:12010.t02744:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 4422 Score = 34.1 bits (68), Expect = 2.2 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +2 / +3 Query: 719 CSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSAC 883 C++ S CS+ + STGS TTS+ +P A TS+PS+ C Sbjct: 903 CARSASGTSACSSARSPASTGSPTTSSASARRRSPPAAAAAAGGGPTSSPSSPRC 1067
>LOC_Os08g28750:12008.t02631:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6728 Score = 34.1 bits (68), Expect = 2.2 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +2 / -1 Query: 749 CSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 CS+ A+ PS+ ++ S+ T P P + S +TP TS Sbjct: 182 CSSPASAPSSSTSAPSSSTTSTTPPSSPCAASPPSPATTPGTS 54
>LOC_Os06g19390:12006.t01760:unspliced-genomic expressed protein| Length = 3174 Score = 34.1 bits (68), Expect = 2.2 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -2 / +2 Query: 273 SGAASPACARGSSPRCCGASGTACTRSCRDGFA*SR 166 +G ++P C+R SPRC A+ + TR+ R A SR Sbjct: 386 AGGSAPPCSRSRSPRCARAAPRSPTRAPRSCGARSR 493
>LOC_Os06g12870:12006.t01163:unspliced-genomic expressed protein| Length = 2054 Score = 34.1 bits (68), Expect = 2.2 Identities = 19/62 (30%), Positives = 28/62 (45%) Frame = +2 / +1 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 TT+ SW S P W ++ + +G+ + S T A ATT S+T P +S Sbjct: 1120 TTTCSWTRSTSGGCPGWGASTPSCSPSGTGS*SRASTTTPARSSAATTAPSSTTPRPPSS 1299 Query: 878 AC 883 C Sbjct: 1300 PC 1305
>LOC_Os05g51570:12005.t04582:unspliced-genomic vacuolar processing enzyme precursor, putative, expressed| Length = 1655 Score = 34.1 bits (68), Expect = 2.2 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +2 / +2 Query: 752 STKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 S + T +T ++TTS+ + AP PA RSS + P+T++ Sbjct: 458 SPRITPATTSTSTTSSPSSSATAPPSPAPAAARSSPAAPTTTS 586
>LOC_Os05g49930:12005.t04426:unspliced-genomic DELLA protein GAI, putative, expressed| Length = 1736 Score = 34.1 bits (68), Expect = 2.2 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +2 / +1 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 + SSS ++ R S +++ T PS+ + +T CT +P A++ RSS PS Sbjct: 508 SASSSAGSTRRGRTSSSPTSRRTRPSSRRSRGATACT*STSPSPMASSGRRSSRPWPSAP 687 Query: 878 ACK 886 A + Sbjct: 688 AAR 696
>LOC_Os04g56130:12004.t05085:unspliced-genomic ATP binding protein, putative| Length = 1360 Score = 34.1 bits (68), Expect = 2.2 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +2 / +3 Query: 698 TTSSSWDCSKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 T S+ CS RRP ST+ T S+ CT + TT+ R + +P+T+ Sbjct: 612 TARSTASCSTPPRRPPSSSTRCTASSSARRAG*GTCTRSASTGSSTTTSSRGTCCSPATT 791
>LOC_Os04g51180:12004.t04595:unspliced-genomic protein GPR89A, putative, expressed| Length = 4757 Score = 34.1 bits (68), Expect = 2.2 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +2 / +3 Query: 746 WCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 WC + + S AT+S+ + ++P P+T + TST S S+ Sbjct: 279 WCRSSSASSSPSPATSSSSSSSRSSPSSPSTPASSTGTSTSSASS 413
>LOC_Os04g38660:12004.t03436:unspliced-genomic amino acid/polyamine transporter II, putative| Length = 1120 Score = 34.1 bits (68), Expect = 2.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -2 / +2 Query: 270 GAASPACARGSSPRCCGASGTACTRSC 190 G A+ AC+R S PR C ++C+ C Sbjct: 527 GCAASACSRTSPPRACSRPSSSCSACC 607
>LOC_Os04g20960:12004.t005550:unspliced-genomic expressed protein| Length = 33278 Score = 34.1 bits (68), Expect = 2.2 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +2 / +2 Query: 752 STKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 S P+ ATTST + + P P T + + T+TPSTS Sbjct: 23183 SPPTPTPTHPRATTSTTTSSSSTPPQPVTPHAPAPTATPSTS 23308
>LOC_Os03g44780:12003.t03863:unspliced-genomic GTP binding protein, putative, expressed| Length = 3357 Score = 34.1 bits (68), Expect = 2.2 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +2 / +2 Query: 740 PSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 P CST ST S +T + +P + RSS+STPS ++ Sbjct: 335 PPSCSTTGATASTSSTPRATSTSAPRSPPPRGSPTRRSSSSTPSRAS 475
>LOC_Os02g46680:12002.t04255:unspliced-genomic multidrug resistance protein 2, putative, expressed| Length = 11127 Score = 34.1 bits (68), Expect = 2.2 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +2 / +2 Query: 746 WCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTSA 880 WCST+++ ++ S + + C G P++ ++TP+T A Sbjct: 9029 WCSTRSSTSASASWGSGSRCASGRGCSRPSSGTRSGGSTTPATRA 9163
>LOC_Os01g67090:12001.t06065:unspliced-genomic SF16 protein, putative, expressed| Length = 4128 Score = 34.1 bits (68), Expect = 2.2 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -2 / -1 Query: 273 SGAASPACARGSSPRCCGASGTACTRSCR 187 +GAA+P+ R S RCC A GTA S R Sbjct: 1497 AGAAAPSRRRRGSSRCCSARGTAGC*SAR 1411
>LOC_Os01g37690:12001.t03309:unspliced-genomic vacuolar cation/proton exchanger 1a, putative, expressed| Length = 5361 Score = 34.1 bits (68), Expect = 2.2 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +2 / +2 Query: 722 SKWNRRPSWCSTKATVPSTGSATTSTECTYGNAP*DPATTNERSSTSTPSTS 877 S+W+ P W + T S+ + +S + +AP P T +S S+S Sbjct: 2915 SRWSSAPCWAPSSPTSSSSSAPPSSAAASSTSAPASPTTATSPTSAPPSSSS 3070
>LOC_Os02g16220:12002.t01415:unspliced-genomic transposon protein, putative, unclassified| Length = 7585 Score = 29.5 bits (58), Expect(2) = 2.2 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 / +2 Query: 1099 LKFYCTLSRLNYLSALSSKAFYLFVLSSLCNFTFGC 1206 LK + +R N+L Y+F LS +C TF C Sbjct: 7067 LKKHFDQTRANHLDHKELVRKYIFQLSMICKVTFSC 7174 Score = 28.1 bits (55), Expect(2) = 2.2 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 / +1 Query: 944 YSWSASATPSDAWLPW 991 Y W AT WLPW Sbjct: 3589 YEWRTKATNRGGWLPW 3636
>LOC_Os04g43420:12004.t03886:unspliced-genomic peptidoglycan binding domain containing protein, putative,| expressed Length = 2465 Score = 27.2 bits (53), Expect(2) = 2.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 / +3 Query: 800 RWRWWQSLWMGRWPWWSTRR 741 RW W + GR WWS+RR Sbjct: 633 RWWWRRRSR*GRRWWWSSRR 692 Score = 24.0 bits (46), Expect(2) = 2.2 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWWWR 831 +RR R R WWWR Sbjct: 597 RRRLRRRRRPGHRWWWR 647
>LOC_Os03g40720:12003.t03495:unspliced-genomic UDP-glucose 6-dehydrogenase, putative, expressed| Length = 15801 Score = 33.1 bits (66), Expect(2) = 2.3 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = -3 / +2 Query: 764 WPWWSTRRASCSIWNSPRS 708 W WW++RR + ++W++ RS Sbjct: 7004 WSWWTSRRMAVTLWSTGRS 7060 Score = 25.4 bits (49), Expect(2) = 2.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -3 / +1 Query: 797 WRWWQSLWMGRW 762 WR W L MGRW Sbjct: 3532 WR*WLGLAMGRW 3567
>LOC_Os10g28420:12010.t02194:unspliced-genomic IQ calmodulin-binding motif family protein| Length = 1542 Score = 27.6 bits (54), Expect(2) = 2.3 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / -2 Query: 881 KRRWRGWRLKTAHWWW 834 +RR RGW WWW Sbjct: 746 ERRCRGWCGDDRRWWW 699 Score = 23.5 bits (45), Expect(2) = 2.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -3 / -2 Query: 776 WMGRWPWWSTRRASCSI 726 W WPW S+ +S S+ Sbjct: 704 WWWPWPWTSSSSSSSSM 654
>LOC_Os06g21250:12006.t01942:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 1240 Score = 26.3 bits (51), Expect(2) = 2.3 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -3 / +3 Query: 809 RCIRWRWWQSLWMGRWPWW 753 R I W W W+ W WW Sbjct: 909 RRIWWWWLSRRWILWWWWW 965 Score = 24.9 bits (48), Expect(2) = 2.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWW 837 +RRW WR+ WW Sbjct: 819 RRRWWIWRIWWIWWW 863 Score = 33.1 bits (66), Expect = 4.1 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = -3 / +3 Query: 875 RWRGWRLKTAHWWWRDPRGHSHRCIRWRWWQSLW 774 R R W + WW R R WRWW+ +W Sbjct: 819 RRRWWIWRIWWIWWWRIRRIRQRIRWWRWWRRIW 920 Score = 25.4 bits (49), Expect(2) = 5.6 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRWPWW 753 W WW S W WW Sbjct: 918 WWWWLSRRWILWWWW 962 Score = 24.4 bits (47), Expect(2) = 5.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 881 KRRWRGWRLKTAHWWW 834 ++R R WR WWW Sbjct: 879 RQRIRWWRWWRRIWWW 926
>LOC_Os06g21310:12006.t01948:unspliced-genomic glycine-rich cell wall structural protein precursor, putative| Length = 1017 Score = 27.2 bits (53), Expect(2) = 2.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 / +1 Query: 878 RRWRGWRLKTAHWWW 834 RRW W ++ WWW Sbjct: 763 RRWLWWWVRWWIWWW 807 Score = 24.0 bits (46), Expect(2) = 2.3 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = -3 / +3 Query: 797 WRWWQSLWMGRWPW 756 WR W W+ W W Sbjct: 921 WRIWCRCWLWWWIW 962
>LOC_Os03g07640:12003.t00625:unspliced-genomic sulfated surface glycoprotein 185 precursor, putative| Length = 630 Score = 29.0 bits (57), Expect(2) = 2.4 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -3 / -1 Query: 797 WRWWQSLWMGRWPWWSTRRASCSIW 723 W WW++ RW W +RA W Sbjct: 258 WWWWRACDRRRWRWRRHQRAGRRRW 184 Score = 22.1 bits (42), Expect(2) = 2.4 Identities = 6/13 (46%), Positives = 6/13 (46%) Frame = -3 / -1 Query: 872 WRGWRLKTAHWWW 834 WR R WWW Sbjct: 309 WRRRRAGRRWWWW 271
>LOC_Os10g30580:12010.t02390:unspliced-genomic cell division control protein 48 homolog E, putative, expressed| Length = 4567 Score = 29.5 bits (58), Expect(2) = 2.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 / +1 Query: 881 KRRWRGWRLKTAHWWWRDP 825 +R WRG +T WW R P Sbjct: 307 RRSWRGRSRRTGWWWTRPP 363 Score = 27.2 bits (53), Expect(2) = 2.5 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 / +3 Query: 682 GLGLKYSCRMYDFLSGSQYEKNLSVDLSI 596 G GL+ SC+++ L +Y +NLS + I Sbjct: 3504 GCGLERSCQVHPRLQWCRYYRNLSACMQI 3590
>LOC_Os10g42490:12010.t03475:unspliced-genomic OCL4 protein, putative, expressed| Length = 5738 Score = 26.3 bits (51), Expect(2) = 2.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 764 WPWWSTRRASCSIWNS 717 WPW STR S W + Sbjct: 2052 WPWRSTRGCSAGRWTA 2099 Score = 24.4 bits (47), Expect(2) = 2.8 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 / +3 Query: 872 WRGWRLKTAHWWWRDP 825 WR R +T+ WW P Sbjct: 1926 WRPCRSRTSSWWSTSP 1973
>LOC_Os06g37000:12006.t03395:unspliced-genomic heterogeneous nuclear ribonucleoprotein A3, putative, expressed| Length = 4840 Score = 28.6 bits (56), Expect(2) = 2.8 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -3 / +2 Query: 764 WPWWSTRRASCSIWNSPRSCWL 699 W WW + CS+ R CWL Sbjct: 3497 WIWWWLSVSCCSLLR*HRLCWL 3562 Score = 22.1 bits (42), Expect(2) = 2.8 Identities = 6/18 (33%), Positives = 7/18 (38%) Frame = -3 / +2 Query: 839 WWRDPRGHSHRCIRWRWW 786 WW R + W WW Sbjct: 3455 WWWQFWKQQQRWLWWIWW 3508
>LOC_Os03g36700:12003.t03138:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3505 Score = 25.8 bits (50), Expect(2) = 2.9 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = -3 / +1 Query: 827 PRGHSHRCIRWRWWQSLW 774 PR RW+WW+ W Sbjct: 3430 PRDQDPGARRWQWWRWRW 3483 Score = 24.9 bits (48), Expect(2) = 2.9 Identities = 6/11 (54%), Positives = 6/11 (54%) Frame = -3 / +1 Query: 776 WMGRWPWWSTR 744 W RW WW R Sbjct: 3469 WRWRWQWWQWR 3501
>LOC_Os12g41720:12012.t03848:unspliced-genomic patatin-like phospholipase family protein, expressed| Length = 1916 Score = 30.9 bits (61), Expect(2) = 2.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 / -1 Query: 881 KRRWRGWRLKTAHWWWRDPRGHSHR 807 +RRW+GWR + + WR G R Sbjct: 980 RRRWKGWRRRRSRSRWRRRGGRRRR 906 Score = 24.4 bits (47), Expect(2) = 2.9 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 / -1 Query: 246 RGSSPRCCGASG 211 RG +P CCG G Sbjct: 902 RGGTPACCGGRG 867
>LOC_Os01g19590:12001.t01749:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2602 Score = 28.6 bits (56), Expect(2) = 2.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 / +2 Query: 794 RWWQSLWMGRWPWWSTRRASCS 729 R WQ WM WP R SC+ Sbjct: 497 RRWQGRWMNVWPHIGPRIPSCT 562 Score = 22.1 bits (42), Expect(2) = 2.9 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = -3 / +2 Query: 884 CKRRWRG 864 CKRRW+G Sbjct: 491 CKRRWQG 511
>LOC_Os02g11890:12002.t00987:unspliced-genomic syntaxin 124, putative| Length = 1406 Score = 29.9 bits (59), Expect(2) = 2.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 / -3 Query: 94 CAVAAPPLPGLEPHSRSMASARL 26 C++AAPP P P S S A AR+ Sbjct: 978 CSIAAPPSPCTPPPSDSSAPARI 910 Score = 24.9 bits (48), Expect(2) = 2.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 / -2 Query: 788 WQSLWMGRWPWWSTRRA 738 W S+ + WPW ST A Sbjct: 1231 WLSMSLSWWPWASTSAA 1181 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 421,806,295 Number of extensions: 6845128 Number of successful extensions: 60161 Number of sequences better than 10.0: 471 Length of query: 417 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 367 Effective length of database: 52,799,986 Effective search space: 19377594862 Effective search space used: 19377594862 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
