ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf110k09 |
|---|---|
| Clone Library Name | barley_pub |
>Q8VWF8:RPOT2_NICSY DNA-directed RNA polymerase 2, chloroplast/mitochondrial precursor -| Nicotiana sylvestris (Wood tobacco) Length = 1020 Score = 54.3 bits (129), Expect = 7e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +1 Query: 106 QLLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 +LLE FQT +PT+ FPP P +G+FD+R+VL S YFFN Sbjct: 984 KLLESFQTSYPTLLFPPLPERGDFDMRDVLESPYFFN 1020
>P92969:RPOT1_ARATH DNA-directed RNA polymerase 1, mitochondrial precursor - Arabidopsis| thaliana (Mouse-ear cress) Length = 976 Score = 54.3 bits (129), Expect = 7e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 109 LLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 LLE FQ FP + FPP P +G+FD+R+VL STYFFN Sbjct: 941 LLESFQKSFPDISFPPLPERGDFDLRKVLESTYFFN 976
>Q8L6J3:RPO2B_TOBAC DNA-directed RNA polymerase 2B, chloroplast/mitochondrial precursor -| Nicotiana tabacum (Common tobacco) Length = 1021 Score = 54.3 bits (129), Expect = 7e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +1 Query: 106 QLLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 +LLE FQT +PT+ FPP P +G+FD+R+VL S YFFN Sbjct: 985 KLLESFQTSYPTLLFPPLPERGDFDLRDVLESPYFFN 1021
>Q8L6J2:RPO2A_TOBAC DNA-directed RNA polymerase 2A - Nicotiana tabacum (Common tobacco)| Length = 332 Score = 54.3 bits (129), Expect = 7e-07 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = +1 Query: 106 QLLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 +LLE FQT +PT+ FPP P +G+FD+R+VL S YFFN Sbjct: 296 KLLESFQTSYPTLLFPPLPERGDFDMRDVLESPYFFN 332
>Q93Y94:RPOT1_NICSY DNA-directed RNA polymerase 1, mitochondrial precursor - Nicotiana| sylvestris (Wood tobacco) Length = 1002 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 109 LLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 LLE FQ FP ++FPP P +G+FD+REVL S YFFN Sbjct: 967 LLESFQQSFPDLQFPPLPERGDFDLREVLESPYFFN 1002
>Q8L6J5:RPO1B_TOBAC DNA-directed RNA polymerase 1B, mitochondrial precursor - Nicotiana| tabacum (Common tobacco) Length = 1002 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 109 LLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 LLE FQ FP ++FPP P +G+FD+REVL S YFFN Sbjct: 967 LLESFQQSFPDLQFPPLPERGDFDLREVLESPYFFN 1002
>Q8L6J4:RPO1A_TOBAC DNA-directed RNA polymerase 1A - Nicotiana tabacum (Common tobacco)| Length = 155 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = +1 Query: 109 LLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 LLE FQ FP ++FPP P +G+FD+REVL S YFFN Sbjct: 120 LLESFQQSFPDLQFPPLPERGDFDLREVLESPYFFN 155
>Q8L6J1:RPO3B_TOBAC DNA-directed RNA polymerase 3B, chloroplast precursor - Nicotiana| tabacum (Common tobacco) Length = 977 Score = 50.4 bits (119), Expect = 1e-05 Identities = 24/45 (53%), Positives = 31/45 (68%), Gaps = 4/45 (8%) Frame = +1 Query: 94 LYSI----QLLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 LYS+ LLE FQ +P + FPP P +G+F++REVL S YFFN Sbjct: 933 LYSLPILEDLLENFQKSYPALTFPPLPKRGDFNLREVLESPYFFN 977
>P69242:RPOT3_NICSY DNA-directed RNA polymerase 3, chloroplast precursor - Nicotiana| sylvestris (Wood tobacco) Length = 977 Score = 49.3 bits (116), Expect = 2e-05 Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = +1 Query: 94 LYSI----QLLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 LYS+ LLE FQ +P + FPP P +G+FD+ EVL S YFFN Sbjct: 933 LYSMPILEDLLESFQNSYPALTFPPLPKRGDFDLVEVLESPYFFN 977
>P69243:RPO3A_TOBAC DNA-directed RNA polymerase 3A, chloroplast precursor - Nicotiana| tabacum (Common tobacco) Length = 977 Score = 49.3 bits (116), Expect = 2e-05 Identities = 24/45 (53%), Positives = 30/45 (66%), Gaps = 4/45 (8%) Frame = +1 Query: 94 LYSI----QLLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 LYS+ LLE FQ +P + FPP P +G+FD+ EVL S YFFN Sbjct: 933 LYSMPILEDLLESFQNSYPALTFPPLPKRGDFDLVEVLESPYFFN 977
>O24600:RPOT3_ARATH DNA-directed RNA polymerase 3, chloroplast precursor - Arabidopsis| thaliana (Mouse-ear cress) Length = 993 Score = 48.9 bits (115), Expect = 3e-05 Identities = 20/36 (55%), Positives = 27/36 (75%) Frame = +1 Query: 109 LLEEFQTLFPTVEFPPCPAQGNFDVREVLTSTYFFN 216 LL+ FQ +P + FPP P +G+FD++EVL S YFFN Sbjct: 958 LLQSFQESYPNLVFPPVPKRGDFDLKEVLKSQYFFN 993
>Q9LFV6:RPOT2_ARATH DNA-directed RNA polymerase 2, chloroplast/mitochondrial precursor -| Arabidopsis thaliana (Mouse-ear cress) Length = 1011 Score = 46.2 bits (108), Expect = 2e-04 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Frame = +1 Query: 28 LLSKQYFVQLY-Q*IISCSFSYILYSIQLLEEFQTLFPTVEFPPCPAQGNFDVREVLTST 204 ++ ++ FV+LY Q I+ LLE F+ FP ++FPP P +G+ D++ VL S Sbjct: 958 IILREKFVELYSQPILE----------NLLESFEQSFPHLDFPPLPERGDLDLKVVLDSP 1007 Query: 205 YFFN 216 YFFN Sbjct: 1008 YFFN 1011
>O13993:RPOM_SCHPO DNA-directed RNA polymerase, mitochondrial precursor -| Schizosaccharomyces pombe (Fission yeast) Length = 1120 Score = 35.8 bits (81), Expect = 0.26 Identities = 14/25 (56%), Positives = 20/25 (80%) Frame = +1 Query: 142 VEFPPCPAQGNFDVREVLTSTYFFN 216 +EFPP PA+G D+++VL S YFF+ Sbjct: 1096 LEFPPLPARGALDLKKVLESKYFFS 1120
>P38671:RPOM_NEUCR DNA-directed RNA polymerase, mitochondrial precursor - Neurospora| crassa Length = 1423 Score = 35.8 bits (81), Expect = 0.26 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +1 Query: 148 FPPCPAQGNFDVREVLTSTYFFN 216 FPP P +G+FDVR + STYFF+ Sbjct: 1401 FPPIPEKGDFDVRSLKDSTYFFS 1423 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 153,003,509 Number of extensions: 3151728 Number of successful extensions: 6621 Number of sequences better than 10.0: 14 Number of HSP's gapped: 6620 Number of HSP's successfully gapped: 14 Length of query: 315 Length of database: 100,686,439 Length adjustment: 113 Effective length of query: 202 Effective length of database: 69,691,104 Effective search space: 14077603008 Effective search space used: 14077603008 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
