ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf106n06 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g09850:12002.t00832:unspliced-genomic expressed protein| Length = 770 Score = 77.6 bits (163), Expect(3) = 2e-32 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 / +1 Query: 144 PPPFWSTPTPYLFIGFAVVMSLIAVALAVLLCS 242 PPPFWSTPTPYLFIGF VVM+LIAVALAVLLC+ Sbjct: 181 PPPFWSTPTPYLFIGFGVVMALIAVALAVLLCT 279 Score = 55.6 bits (115), Expect(3) = 2e-32 Identities = 24/28 (85%), Positives = 25/28 (89%) Frame = +3 / +1 Query: 333 PKVVVVMAGDDMPSFLASATPLDFAEAA 416 P+VVVVMAGDD PSFLASATPL FA AA Sbjct: 391 PRVVVVMAGDDSPSFLASATPLAFAAAA 474 Score = 44.1 bits (90), Expect(3) = 2e-32 Identities = 18/35 (51%), Positives = 19/35 (54%) Frame = +1 / +2 Query: 244 AAGREAARTRRLSRPG*CLCAC*RRWTGRCPRWWW 348 AA + SR G*C CAC RRWTGR WW Sbjct: 299 AASAARSAATSSSRRG*CRCACWRRWTGRRRPGWW 403 Score = 58.8 bits (122), Expect(3) = 2e-22 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -3 / -1 Query: 229 TARATAMRLITTAKPMNRYGVGVDQNGGG 143 TA ATAM ITT PMNRYGVGVDQNGGG Sbjct: 266 TASATAMSAITTPNPMNRYGVGVDQNGGG 180 Score = 43.2 bits (88), Expect(3) = 2e-22 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -2 / -3 Query: 326 PVQRRQHAHRHHPGRD 279 PVQRRQHAHRHHP RD Sbjct: 381 PVQRRQHAHRHHPRRD 334 Score = 40.9 bits (83), Expect(3) = 2e-22 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 / -1 Query: 415 AASAKSSGVALARKDGMSSPAI 350 AA+AK+SGVALAR DG SSPAI Sbjct: 473 AAAAKASGVALARNDGESSPAI 408 Score = 46.0 bits (94), Expect = 3e-04 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = +3 / +1 Query: 279 VPAGMMSVRVLTPLDREVPKVVVVMAGDD 365 VP GMMSVRVL PLDRE P VVV+ D Sbjct: 334 VPPGMMSVRVLAPLDREAPPRVVVVMAGD 420 Score = 43.2 bits (88), Expect = 0.002 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -2 / -3 Query: 236 EEHGQSHRDEAHHHGEADEQV 174 ++HG+ HRDE HHH E DEQV Sbjct: 273 QQHGERHRDERHHHPEPDEQV 211
>LOC_Os06g42660:12006.t03957:unspliced-genomic expressed protein| Length = 707 Score = 60.6 bits (126), Expect(2) = 4e-16 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +3 / +2 Query: 147 PPFWSTPTPYLFIGFAVVMSLIAVALAVLLCS 242 P W TPTPYLF+GFAV+M LIAVAL VL+C+ Sbjct: 143 PGMWRTPTPYLFLGFAVMMGLIAVALLVLVCT 238 Score = 43.7 bits (89), Expect(2) = 4e-16 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = +3 / +2 Query: 333 PKVVVVMAGDDMPSFLASATPL 398 PKVVV+MAGD PSFLASA PL Sbjct: 320 PKVVVIMAGDTAPSFLASAKPL 385 Score = 38.6 bits (78), Expect(2) = 1e-05 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 / -2 Query: 236 EEHGQSHRDEAHHHGEADEQV 174 ++H Q HRDEAHHH E E+V Sbjct: 232 DQHEQRHRDEAHHHREPQEKV 170 Score = 29.9 bits (59), Expect(2) = 1e-05 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 / -3 Query: 403 KSSGVALARKDGMSSPAI 350 + SG+ALARKDG SPA+ Sbjct: 390 EESGLALARKDGAVSPAM 337 Score = 37.3 bits (75), Expect = 0.12 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -3 / -3 Query: 229 TARATAMRLITTAKPMNRYGVGV 161 T+ ATAMR I TA P RYGVGV Sbjct: 225 TSSATAMRPIITANPRKRYGVGV 157
>LOC_Os02g08170:12002.t00713:unspliced-genomic GDU1, putative| Length = 814 Score = 41.8 bits (85), Expect(3) = 1e-08 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 / +1 Query: 156 WSTPTPYLFIGFAVVMSLIAVALAVLLCS 242 W +P PYLF G A ++ LIA++L L CS Sbjct: 127 WQSPVPYLFGGLAAMLGLIALSLLALACS 213 Score = 30.4 bits (60), Expect(3) = 1e-08 Identities = 11/16 (68%), Positives = 15/16 (93%) Frame = +3 / +1 Query: 339 VVVVMAGDDMPSFLAS 386 VVV+MAGD+ P+FLA+ Sbjct: 358 VVVIMAGDERPTFLAT 405 Score = 23.1 bits (44), Expect(3) = 1e-08 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +1 / +3 Query: 313 RRWTGRCPRWWW*W 354 RR G WWW W Sbjct: 258 RRRRGEPGWWWWWW 299
>LOC_Os06g44420:12006.t04130:unspliced-genomic GDU1, putative, expressed| Length = 2544 Score = 43.7 bits (89), Expect(2) = 6e-06 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +3 / +1 Query: 156 WSTPTPYLFIGFAVVMSLIAVALAVLLCS 242 W +P PYLF G A ++ LIA AL +L CS Sbjct: 79 WQSPVPYLFGGLAAMLGLIAFALLILACS 165 Score = 29.9 bits (59), Expect(2) = 6e-06 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = +3 / +1 Query: 339 VVVVMAGDDMPSFLA 383 VVV+MAGD+ P+FLA Sbjct: 307 VVVIMAGDERPTFLA 351
>LOC_Os08g15070:12008.t01381:unspliced-genomic GDU1, putative, expressed| Length = 459 Score = 42.3 bits (86), Expect(2) = 9e-06 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 / +1 Query: 156 WSTPTPYLFIGFAVVMSLIAVALAVLLCS 242 W +P PYLF G A ++ LI +AL +L CS Sbjct: 16 WHSPVPYLFGGLAAMLGLITLALLILACS 102 Score = 28.1 bits (55), Expect(2) = 9e-06 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +3 / +1 Query: 339 VVVVMAGDDMPSFLAS 386 V VVMAG+ MP+FLA+ Sbjct: 250 VAVVMAGERMPTFLAA 297
>LOC_Os08g34700:12008.t03210:unspliced-genomic GDU1, putative, expressed| Length = 1076 Score = 43.2 bits (88), Expect = 0.002 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +3 / +3 Query: 156 WSTPTPYLFIGFAVVMSLIAVALAVLLCS 242 W +P PYLF G A ++ LIA AL +L CS Sbjct: 234 WHSPVPYLFGGLAAMLGLIAFALLILACS 320
>LOC_Os12g44370:12012.t04103:unspliced-genomic expressed protein| Length = 1519 Score = 29.9 bits (59), Expect(2) = 0.15 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 / -3 Query: 259 AARTRRLSRPG*CLCAC*RRWTGRCPRWWW*W 354 AA R R C C+C GR WWW W Sbjct: 479 AAAAWRRRRFSGCSCSCLLAGGGRPWWWWWWW 384 Score = 24.4 bits (47), Expect(2) = 0.15 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +1 / -3 Query: 340 WWW*WP 357 WWW WP Sbjct: 392 WWWWWP 375
>LOC_Os03g07450:12003.t00608:unspliced-genomic homeobox-leucine zipper protein HAT7, putative, expressed| Length = 2651 Score = 32.2 bits (64), Expect(2) = 0.32 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +1 / -1 Query: 295 CLCAC*RRWTGRCPRWWW*W 354 C C C W P WWW W Sbjct: 230 CCCCCCSWWWPWWPWWWWWW 171 Score = 24.9 bits (48), Expect(2) = 0.32 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 / -1 Query: 123 SSSPTMIPPPFWSTPTP 173 SS + PPPF S+P P Sbjct: 431 SSDSSSSPPPFTSSPPP 381
>LOC_Os07g04990:12007.t00384:unspliced-genomic aldo-keto reductase/ oxidoreductase, putative, expressed| Length = 3242 Score = 35.0 bits (70), Expect = 0.57 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 / -1 Query: 127 EEAPPAFICASTAAFLMVLCNAWCAF*CAC 38 ++ PPA C++ AA + +L WC C C Sbjct: 98 QQPPPATTCSAMAAAIALLLRVWCVRACCC 9
>LOC_Os04g40030:12004.t03568:unspliced-genomic sel1-like repeat, putative, expressed| Length = 2375 Score = 28.6 bits (56), Expect(2) = 0.64 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 / -2 Query: 226 PCSSAPAAGREAARTRRLSR 285 PC+ APAA R + R RR R Sbjct: 298 PCARAPAAARRSPRRRRRRR 239 Score = 23.5 bits (45), Expect(2) = 0.64 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +1 / -1 Query: 319 WTGRCPRWWW*W 354 W R WWW W Sbjct: 158 WRWRRRWWWWWW 123
>LOC_Os05g40220:12005.t03561:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 4376 Score = 34.5 bits (69), Expect = 0.78 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = -3 / +3 Query: 502 SAGGERATVSYTAAATSLAPHWQYDLCTLAASAKSSGVALARKDGMSSPAI 350 +A RA S T ++ S +P +YD CT+AA+ KS+ A +D + P + Sbjct: 3915 TASPTRAHCSTTGSSRSQSPSARYDECTVAAACKSAVPWSALQDVYAIPYV 4067
>LOC_Os08g04400:12008.t00335:unspliced-genomic CRR2, putative| Length = 2558 Score = 34.5 bits (69), Expect = 0.79 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 / +2 Query: 295 CLCAC*RRWTGRCPRWWW*WPA 360 C +C RRW G + WW WP+ Sbjct: 608 CSGSCGRRWAGMLRQGWWWWPS 673
>LOC_Os07g01630:12007.t00061:unspliced-genomic disease resistance response protein 206, putative, expressed| Length = 821 Score = 34.5 bits (69), Expect = 0.79 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +1 / +1 Query: 232 SSAPAAGREAARTRRLSRPG*CLCAC*RRWTGRCPRWWW 348 SS+P+ RR+ R C C C W GR R WW Sbjct: 76 SSSPSRPPWRRWARRVGRRCGCGCTCTTSWAGRGRRRWW 192
>LOC_Os02g56250:12002.t05198:unspliced-genomic GATA zinc finger family protein, expressed| Length = 5317 Score = 34.5 bits (69), Expect = 0.79 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 / +2 Query: 217 WLWPCSSAPAAGREAARTRRLSRPG*CLCAC*RRWTGRCPR 339 W P +++ + + R SRP C C+ RR RCPR Sbjct: 2528 WRRPAATSSTTSTTCSTSPRRSRPPTCSCSTRRRQGARCPR 2650
>LOC_Os07g45170:12007.t04156:unspliced-genomic catalytic/ protein phosphatase type 2C/ protein serine/threonine| phosphatase, putative, expressed Length = 1819 Score = 34.1 bits (68), Expect = 1.1 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 / -3 Query: 87 AAVDAQMNAGGASSSPTMIPPPFWSTPTP 173 AA A NA SS+ T++PPP PTP Sbjct: 413 AAGSASRNAAAGSSTTTILPPPSSPAPTP 327
>LOC_Os01g08160:12001.t00694:unspliced-genomic myb-like DNA-binding domain, SHAQKYF class family protein, expressed| Length = 2449 Score = 27.6 bits (54), Expect(2) = 1.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 / -3 Query: 325 GRCPRWWW*W 354 G C RWWW W Sbjct: 1544 GWCCRWWWWW 1515 Score = 23.5 bits (45), Expect(2) = 1.2 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +1 / -1 Query: 223 WPCSSAPAAGREAARTRRLSRPG 291 W C PAA AA L R G Sbjct: 1633 WRCREGPAAAEAAAAGAGLRRGG 1565
>LOC_Os07g34870:12007.t03162:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative, expressed| Length = 1509 Score = 26.7 bits (52), Expect(2) = 1.2 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +1 / -3 Query: 232 SSAPAAGREAARTRRLSRPG*CLCAC*RRWTGRCPRW 342 ++APAA R R SR G C C RR RW Sbjct: 394 TAAPAARRTRCTARTASR*GCCRCRPGRRR*RAACRW 284 Score = 24.4 bits (47), Expect(2) = 1.2 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +1 / -3 Query: 340 WWW*WP 357 WWW WP Sbjct: 214 WWWWWP 197
>LOC_Os03g29480:12003.t02570:unspliced-genomic nodulation signaling pathway 1 protein, putative, expressed| Length = 1572 Score = 24.9 bits (48), Expect(3) = 1.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 / -2 Query: 120 ASSSPTMIPPPFWSTPTP 173 A++SP +PP +TPTP Sbjct: 1226 AANSPAALPPSPPTTPTP 1173 Score = 24.4 bits (47), Expect(3) = 1.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 / -3 Query: 214 RWLWPCSSAPAAGREAARTR 273 RW WP + GR AAR R Sbjct: 910 RWPWPRARPR*GGRTAARGR 851 Score = 22.6 bits (43), Expect(3) = 1.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 / -1 Query: 482 GSLAAGRRPSIYVSVKSNGG 541 G+L AGR P S +NGG Sbjct: 618 GALGAGRHPHGRCSRGANGG 559
>LOC_Os12g06840:12012.t00569:unspliced-genomic protein binding protein, putative, expressed| Length = 2494 Score = 31.3 bits (62), Expect(2) = 1.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 / -2 Query: 322 TGRCPRWWW*WPA 360 + R P WWW WPA Sbjct: 252 SSRLPSWWWWWPA 214 Score = 23.5 bits (45), Expect(2) = 1.3 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +3 / -2 Query: 75 TMRNAAVDAQMNAGGASSSPTMIPPPFWSTPTP 173 T + + D+ +G S P PPP S P P Sbjct: 444 TNASISTDSAARSGTPPSPPPPSPPPPPSPPPP 346
>LOC_Os04g34040:12004.t03079:unspliced-genomic hypothetical protein| Length = 3734 Score = 28.6 bits (56), Expect(2) = 1.4 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 / +3 Query: 223 WPCSSAPAAGREAARTR 273 WP +SAPAAG AA R Sbjct: 657 WPMASAPAAGATAATPR 707 Score = 26.7 bits (52), Expect(2) = 1.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 / +2 Query: 117 GASSSPTMIPPPFWSTPT 170 GA +P +IP P W PT Sbjct: 56 GARLTPVLIPFPLWPPPT 109
>LOC_Os10g33810:12010.t02682:unspliced-genomic myb-related protein Myb4, putative, expressed| Length = 2691 Score = 30.9 bits (61), Expect(2) = 1.4 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 / -2 Query: 322 TGRCPRWWW*W 354 T R PRWWW W Sbjct: 197 TARIPRWWWWW 165 Score = 24.0 bits (46), Expect(2) = 1.4 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +1 / -2 Query: 295 CLCAC*RRWT 324 C+C C RRW+ Sbjct: 2183 CVCCCCRRWS 2154
>LOC_Os10g16410:12010.t01206:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2433 Score = 33.6 bits (67), Expect = 1.5 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 / -2 Query: 123 SSSPTMIPPPFWSTPTPYLFIGF 191 S+ P + P P+W+ P P+L +GF Sbjct: 860 SAEPGVRPNPWWAQPAPFLVVGF 792
>LOC_Os08g31760:12008.t02921:unspliced-genomic expressed protein| Length = 2124 Score = 33.6 bits (67), Expect = 1.5 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +1 / +3 Query: 244 AAGREAARTRRLSRPG*CLCAC*RRWTGRCPR 339 A GR R R R C C+C RRW G PR Sbjct: 1098 AGGRRPPRRRPPLRCCSCRCSCSRRWCGAWPR 1193
>LOC_Os01g52880:12001.t04714:unspliced-genomic too many mouths protein precursor, putative, expressed| Length = 1496 Score = 25.4 bits (49), Expect(2) = 1.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 / -1 Query: 144 PPPFWSTPTP 173 PPP W PTP Sbjct: 1232 PPPAWQAPTP 1203 Score = 25.4 bits (49), Expect(2) = 1.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 / -2 Query: 229 CSSAPAAGREAARTRR 276 C S +GR AARTRR Sbjct: 1153 CRSGRGSGRAAARTRR 1106
>LOC_Os11g47500:12011.t04246:unspliced-genomic xylanase inhibitor protein 1 precursor, putative, expressed| Length = 1718 Score = 27.2 bits (53), Expect(2) = 1.7 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 / -2 Query: 223 WPCSSAPAAGREAARTRRLSR 285 +PCS+ PAA AR RR R Sbjct: 1057 YPCSAPPAAACRGARRRRPCR 995 Score = 26.7 bits (52), Expect(2) = 1.7 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 265 RTRRLSRPG*CLCAC*RRWTGRCPRWW 345 R RR R G + + RRW G C R W Sbjct: 583 RRRRTWRKGGSIGSRRRRWRGACRRPW 503
>LOC_Os06g41190:12006.t03813:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 1284 Score = 29.0 bits (57), Expect(2) = 1.8 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 / -3 Query: 217 WLWPCSSAPAAGREAARTRRLSRP 288 W WP SS P+ + R +R +RP Sbjct: 1168 WYWPGSSRPSEPAQEGRLKRGARP 1097 Score = 24.4 bits (47), Expect(2) = 1.8 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +1 / -3 Query: 319 WTGRCPRW 342 W G CPRW Sbjct: 379 WRGTCPRW 356
>LOC_Os10g41290:12010.t03365:unspliced-genomic protein kinase PVPK-1, putative, expressed| Length = 2980 Score = 33.1 bits (66), Expect = 2.0 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +1 / -1 Query: 244 AAGREAARTRRLSRPG*CLCAC*RRWTGRCPRWWW 348 AA R + R RR R C RRW C RW W Sbjct: 613 AASRRSLRRRRCRRRPCCCSTRCRRWPRCC*RWSW 509
>LOC_Os10g12080:12010.t00995:unspliced-genomic cytochrome P450 98A1, putative| Length = 723 Score = 33.1 bits (66), Expect = 2.0 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 / -3 Query: 214 RWLWPCSSAPAAGREAARTRRLSRP 288 RW WPC+ A AA AA T RP Sbjct: 622 RWCWPCAGASAASVGAAGTTPSRRP 548
>LOC_Os02g35780:12002.t03216:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 2506 Score = 33.1 bits (66), Expect = 2.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 / +3 Query: 307 C*RRWTGRCPRWWW*WP 357 C* RW +C WW*WP Sbjct: 447 C*CRWQWQCQLQWW*WP 497
>LOC_Os10g28420:12010.t02194:unspliced-genomic IQ calmodulin-binding motif family protein| Length = 1542 Score = 25.8 bits (50), Expect(2) = 2.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 / -2 Query: 313 RRWTGRCPRWWW 348 R W G RWWW Sbjct: 734 RGWCGDDRRWWW 699 Score = 24.4 bits (47), Expect(2) = 2.2 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +1 / -2 Query: 340 WWW*WP 357 WWW WP Sbjct: 704 WWWPWP 687
>LOC_Os08g31080:12008.t02857:unspliced-genomic expressed protein| Length = 1610 Score = 30.4 bits (60), Expect(2) = 2.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 / +3 Query: 317 RRQHAHRHHPGRDS 276 RR+HAH H PGRD+ Sbjct: 420 RRRHAHAHLPGRDA 461 Score = 23.1 bits (44), Expect(2) = 2.2 Identities = 6/17 (35%), Positives = 8/17 (47%) Frame = -2 / +1 Query: 230 HGQSHRDEAHHHGEADE 180 H Q HHHG+ + Sbjct: 766 HNQDESQREHHHGQPQQ 816
>LOC_Os10g37340:12010.t02999:unspliced-genomic O-succinylhomoserine sulfhydrylase, putative, expressed| Length = 3809 Score = 27.6 bits (54), Expect(2) = 2.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 / -2 Query: 295 CLCAC*RRWTGRCPRWW 345 C C C RR +GR WW Sbjct: 136 CRCCCCRRRSGRGA*WW 86 Score = 26.7 bits (52), Expect(2) = 2.6 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 / -1 Query: 75 TMRNAAVDAQMNAGGASSSPTMIPPPFWSTPTP 173 T R AA AGGA +P PP+ S+ P Sbjct: 2732 TRRRAASAPASGAGGAGGAPRARRPPWRSSSGP 2634
>LOC_Os12g43530:12012.t04021:unspliced-genomic no apical meristem protein| Length = 2031 Score = 27.6 bits (54), Expect(2) = 2.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 / -2 Query: 328 RCPRWWW*WPA 360 R RWWW WP+ Sbjct: 1703 RWRRWWWPWPS 1671 Score = 25.8 bits (50), Expect(2) = 2.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 / -3 Query: 123 SSSPTMIPPPFWSTPTP 173 SSSP PPP +T TP Sbjct: 1930 SSSPRSTPPPSTTTTTP 1880
>LOC_Os11g10320:12011.t00924:unspliced-genomic expressed protein| Length = 2020 Score = 32.7 bits (65), Expect = 2.8 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 / +1 Query: 313 RRWTGRCPRWWW*W 354 RRW R RWWW W Sbjct: 1684 RRWWQRSKRWWWQW 1725
>LOC_Os09g20540:12009.t01788:unspliced-genomic expressed protein| Length = 1333 Score = 32.7 bits (65), Expect = 2.8 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +1 / +3 Query: 250 GREAARTRRLSRPG*CLCAC*RRWTG 327 GR R RR R C CAC RRW G Sbjct: 753 GRPWRRPRRRRRSCCCRCACSRRWCG 830
>LOC_Os05g35266:12005.t004767:unspliced-genomic beta-1,3-galactosyltransferase sqv-2, putative, expressed| Length = 3359 Score = 32.7 bits (65), Expect = 2.8 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 / +1 Query: 301 CAC*RRWTGRCPRWWW*W 354 C RWT RC RW W W Sbjct: 1627 CCYLGRWTSRCRRWRWSW 1680
>LOC_Os04g57430:12004.t05209:unspliced-genomic leucine-rich repeat, plant specific, putative, expressed| Length = 2221 Score = 32.7 bits (65), Expect = 2.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 / +3 Query: 217 WLWPCSSAPAAGREAARTRRLSRP 288 W WP +S+PA R + TRR + P Sbjct: 867 WWWPTTSSPARSRAPSTTRRRTSP 938
>LOC_Os03g22360:12003.t01987:unspliced-genomic expressed protein| Length = 633 Score = 32.7 bits (65), Expect = 2.8 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 / +2 Query: 313 RRWTGRCPRWWW*W 354 RR TG C RWWW W Sbjct: 101 RRRTGCCWRWWWGW 142
>LOC_Os03g53890:12003.t04703:unspliced-genomic expressed protein| Length = 2141 Score = 27.2 bits (53), Expect(2) = 2.8 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 / -1 Query: 26 QRRTAGTLESTPRVTQYHEECGS* 97 +RRTA T TP + H+ C S* Sbjct: 413 RRRTARTARRTPAAARSHQGCSS* 342 Score = 26.3 bits (51), Expect(2) = 2.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 / -3 Query: 81 RNAAVDAQMNAGGASSSPTMIPPPFWSTP 167 R+A+ A ++ G +SSSP P STP Sbjct: 120 RSASAAAALSCGRSSSSPLTSPLTLSSTP 34
>LOC_Os04g58710:12004.t05332:unspliced-genomic peroxisomal-coenzyme A synthetase, putative, expressed| Length = 2220 Score = 29.9 bits (59), Expect(2) = 2.9 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 / +2 Query: 123 SSSPTMIPPPFWSTPTP 173 ++SP PPP W++PTP Sbjct: 698 ATSPRRRPPPSWASPTP 748 Score = 23.5 bits (45), Expect(2) = 2.9 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 / +2 Query: 265 RTRRLSRPG*CLCAC*RRWTGRCPRWWW 348 RTRR S G A WT R WW Sbjct: 1496 RTRRRSGSGGSTPATSASWTRRGTCGWW 1579
>LOC_Os07g43140:12007.t03961:unspliced-genomic VQ motif family protein| Length = 759 Score = 26.3 bits (51), Expect(2) = 3.0 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 / -2 Query: 214 RWLWPCSSAPAAGREAARTRR 276 RW C+ A AAG R+RR Sbjct: 197 RWYCSCAPAAAAGMTPGRSRR 135 Score = 23.5 bits (45), Expect(2) = 3.0 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +1 / -3 Query: 337 RWWW*W 354 RWWW W Sbjct: 31 RWWWRW 14
>LOC_Os12g40360:12012.t03715:unspliced-genomic F-box domain containing protein, expressed| Length = 2338 Score = 31.3 bits (62), Expect(2) = 3.1 Identities = 16/29 (55%), Positives = 16/29 (55%) Frame = +1 / -3 Query: 253 REAARTRRLSRPG*CLCAC*RRWTGRCPR 339 REAAR RR PG A RWTGR R Sbjct: 221 REAARGRRAEWPGCASRAAEGRWTGRWRR 135 Score = 22.1 bits (42), Expect(2) = 3.1 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +3 / -2 Query: 105 MNAGGASSSPTMIPPPFWSTPTP 173 + A AS PT P P+ P P Sbjct: 564 VTASSASPPPTSAPSPWPPPPPP 496
>LOC_Os10g01134:12010.t00013:unspliced-genomic serine carboxypeptidase 1 precursor, putative, expressed| Length = 6317 Score = 32.2 bits (64), Expect = 3.8 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 / +1 Query: 29 RRTAGTLESTPRVTQYHEECGS*RADERRRRL 124 RR T E TQ H+ CG R D R RRL Sbjct: 3790 RRWPATREEEAGSTQTHDTCGHGREDSRARRL 3885
>LOC_Os04g44740:12004.t04012:unspliced-genomic transferase/ transferase, transferring glycosyl groups, putative,| expressed Length = 3616 Score = 32.2 bits (64), Expect = 3.8 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 / +3 Query: 120 ASSSPTMIPPPFWSTPTPYLFIGFAVVMSLIAVALAVLL 236 A PTM PPP P P L + ++ L+ ++L LL Sbjct: 297 APPPPTMAPPPTPRKPLPLLLLSLSLPFLLLLLSLVFLL 413
>LOC_Os12g28880:12012.t02598:unspliced-genomic lipid binding protein, putative| Length = 519 Score = 32.2 bits (64), Expect = 3.9 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +1 / -1 Query: 298 LCAC*RRWTGRCPRWWW*W 354 LC C RC WWW*W Sbjct: 240 LCGCYD*RLARCYNWWW*W 184
>LOC_Os10g32760:12010.t02584:unspliced-genomic protein binding protein, putative, expressed| Length = 2403 Score = 32.2 bits (64), Expect = 3.9 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +1 / -2 Query: 223 WPCSSAPAAGREAARTRRLSRPG*CLCAC*RR 318 WP S+APA +R+RR PG A RR Sbjct: 893 WPASAAPACSPPCSRSRRARSPGRAAPAAPRR 798
>LOC_Os06g15959:12006.t01469:unspliced-genomic ligA, putative| Length = 2152 Score = 32.2 bits (64), Expect = 3.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 / +3 Query: 328 RCPRWWW*WP 357 RC RWWW WP Sbjct: 1704 RCRRWWWRWP 1733
>LOC_Os06g15939:12006.t01467:unspliced-genomic ligA, putative| Length = 2152 Score = 32.2 bits (64), Expect = 3.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 / +3 Query: 328 RCPRWWW*WP 357 RC RWWW WP Sbjct: 1704 RCRRWWWRWP 1733
>LOC_Os05g40330:12005.t03572:unspliced-genomic auxin hydrogen symporter, putative, expressed| Length = 2933 Score = 32.2 bits (64), Expect = 3.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 / +3 Query: 313 RRWTGRCPRWWW 348 R W GRC RWWW Sbjct: 162 R*WGGRCWRWWW 197
>LOC_Os02g45054:12002.t04095:unspliced-genomic INDETERMINATE-related protein 9, putative, expressed| Length = 9644 Score = 32.2 bits (64), Expect = 3.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 / -2 Query: 313 RRWTGRCPRWWW*WP 357 RR +G P WWW WP Sbjct: 8056 RRRSGEAP*WWWWWP 8012
>LOC_Os01g48960:12001.t04338:unspliced-genomic glutamate synthase, chloroplast precursor, putative, expressed| Length = 11723 Score = 32.2 bits (64), Expect = 3.9 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 / +2 Query: 319 WTGRCPRWWW*WP 357 W RC WWW WP Sbjct: 380 WVVRCGWWWWWWP 418
>LOC_Os08g31580:12008.t02903:unspliced-genomic DRE binding factor 1, putative, expressed| Length = 1706 Score = 25.4 bits (49), Expect(2) = 3.9 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +1 / -2 Query: 217 WLWPCSSAPAAGREAARTRRLSR 285 W WPC P + TRR R Sbjct: 1114 WAWPCRRRPWTWMRRSWTRRWCR 1046 Score = 24.0 bits (46), Expect(2) = 3.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 / -1 Query: 126 SSPTMIPPPFWSTP 167 S P PPP WS P Sbjct: 1193 SEPPSSPPPEWSEP 1152
>LOC_Os08g30830:12008.t02834:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 1199 Score = 26.7 bits (52), Expect(2) = 4.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 / +2 Query: 313 RRWTGRCPRWWW 348 RR +GRCP WW Sbjct: 356 RRSSGRCPGRWW 391 Score = 22.6 bits (43), Expect(2) = 4.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / +3 Query: 185 RLRRGDEPHRGG 220 R RRG+EP GG Sbjct: 249 RRRRGEEPRDGG 284
>LOC_Os03g57640:12003.t05028:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1357 Score = 28.6 bits (56), Expect(2) = 4.6 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 / -2 Query: 11 TSIDPQRRTAGTLESTPRVTQYHEECGS*RADERR 115 TS P+RR+ GT TPR G R RR Sbjct: 738 TSSSPRRRSTGTAARTPRRAPGRRRSGPTRGGGRR 634 Score = 23.5 bits (45), Expect(2) = 4.6 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +3 / -2 Query: 111 AGGASSSPTMIPPPFWSTPTP 173 AGG SP P W TP P Sbjct: 159 AGG*GRSPRRRTAPAWWTPWP 97
>LOC_Os04g58600:12004.t05323:unspliced-genomic L-asparaginase 4 precursor, putative, expressed| Length = 3841 Score = 29.9 bits (59), Expect(2) = 4.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 / +3 Query: 223 WPCSSAPAAGREAARTR 273 WPC+SAPA+ R R R Sbjct: 180 WPCTSAPASTRRRTRRR 230 Score = 23.5 bits (45), Expect(2) = 4.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 / +3 Query: 295 CLCAC*RRWTGRCPRWW 345 CLC C +++ R +WW Sbjct: 2475 CLC*CLWKYSIRSIQWW 2525
>LOC_Os11g35040:12011.t03053:unspliced-genomic tyrosine aminotransferase, putative, expressed| Length = 3683 Score = 26.3 bits (51), Expect(2) = 4.9 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 / +3 Query: 325 GRCPRWWW*W 354 GR RWWW W Sbjct: 138 GRRRRWWWWW 167 Score = 22.6 bits (43), Expect(2) = 4.9 Identities = 10/30 (33%), Positives = 11/30 (36%) Frame = +1 / +2 Query: 253 REAARTRRLSRPG*CLCAC*RRWTGRCPRW 342 R +R G* C C W G P W Sbjct: 44 RRGTSSRTARCSG*RRCRCAACWAGSRPGW 133
>LOC_Os02g46560:12002.t04243:unspliced-genomic helix-loop-helix DNA-binding domain containing protein, expressed| Length = 3079 Score = 25.8 bits (50), Expect(2) = 5.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 / -1 Query: 214 RWLWPCSSAPAAGREAARTRRLSRPG 291 RW W S A + A TRR +R G Sbjct: 1204 RWWWWWSRAASGTTRTAGTRRTARTG 1127 Score = 23.1 bits (44), Expect(2) = 5.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +3 / -1 Query: 123 SSSPTMIPPPFWSTPT 170 S +PT PPP W T Sbjct: 1285 SGAPTGAPPPPWPATT 1238
>LOC_Os03g55070:12003.t04771:unspliced-genomic UDP-glucose 6-dehydrogenase, putative, expressed| Length = 2589 Score = 25.4 bits (49), Expect(3) = 5.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 / +1 Query: 220 LWPCSSAPAAGREAARTRRLSRP 288 L CSS A+ AAR RR RP Sbjct: 1225 LTTCSSPTASSSAAARRRRGGRP 1293 Score = 23.5 bits (45), Expect(3) = 5.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 / +2 Query: 168 TPYLFIGFAVVMSLIAVALAVLL 236 TP+L GF+++ IA+ LA LL Sbjct: 368 TPFLDHGFSLLPLKIAILLANLL 436 Score = 22.1 bits (42), Expect(3) = 5.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 / +1 Query: 610 *FWCNDANAMM*P 648 * WC ANAM P Sbjct: 1564 *IWCTSANAMASP 1602
>LOC_Os09g36580:12009.t03134:unspliced-genomic pathogenesis-related protein 5 precursor, putative, expressed| Length = 2947 Score = 24.9 bits (48), Expect(2) = 5.0 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +1 / +1 Query: 319 WTGRCPRWWW 348 WTG WWW Sbjct: 763 WTGTTCPWWW 792 Score = 24.0 bits (46), Expect(2) = 5.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +2 / +2 Query: 185 RLRRGDEPHRGG 220 RLRRG P RGG Sbjct: 647 RLRRGGVPRRGG 682
>LOC_Os03g44530:12003.t03840:unspliced-genomic expressed protein| Length = 4173 Score = 29.9 bits (59), Expect(2) = 5.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 / +2 Query: 214 RWLWPCSSAPAAGREAARTRRLSRPG 291 RW W ++A A GR AAR PG Sbjct: 56 RWRWEAAAAAAGGRTAARGSAAR*PG 133 Score = 23.5 bits (45), Expect(2) = 5.1 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = +1 / +3 Query: 334 PRWWW 348 PRWWW Sbjct: 276 PRWWW 290
>LOC_Os04g06500:12004.t00533:unspliced-genomic conserved hypothetical protein| Length = 2707 Score = 31.8 bits (63), Expect = 5.3 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 / -1 Query: 233 EHGQSHRDEAHH 198 EHG+SHRDE HH Sbjct: 2059 EHGRSHRDEEHH 2024
>LOC_Os08g43530:12008.t04078:unspliced-genomic F-box protein interaction domain containing protein| Length = 2103 Score = 31.8 bits (63), Expect = 5.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 / +2 Query: 313 RRWTGRCPRWWW 348 RRW G C WWW Sbjct: 818 RRWRGSCAWWWW 853
>LOC_Os07g02490:12007.t00140:unspliced-genomic retrotransposon protein, putative, LINE subclass| Length = 6589 Score = 31.8 bits (63), Expect = 5.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 / +2 Query: 316 RWTGRCPRWWW 348 RW RC RWWW Sbjct: 1085 RWWWRCERWWW 1117
>LOC_Os06g33940:12006.t03090:unspliced-genomic NAC domain-containing protein 76, putative, expressed| Length = 2593 Score = 31.8 bits (63), Expect = 5.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +1 / -2 Query: 319 WTGRCPRWWW*WP 357 W C RWWW WP Sbjct: 1737 WWCGCMRWWWWWP 1699
>LOC_Os05g32070:12005.t02803:unspliced-genomic LRP1, putative, expressed| Length = 1337 Score = 31.8 bits (63), Expect = 5.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 / -2 Query: 316 RWTGRCPRWWW 348 RW RC RWWW Sbjct: 595 RWRWRCGRWWW 563
>LOC_Os02g39380:12002.t03576:unspliced-genomic calmodulin, putative, expressed| Length = 845 Score = 27.6 bits (54), Expect(2) = 5.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 / -3 Query: 328 RCPRWWW*W 354 R PRWWW W Sbjct: 33 RRPRWWWWW 7 Score = 23.5 bits (45), Expect(2) = 5.4 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 / -1 Query: 29 RRTAGTLESTPRVTQYHEECGS*RADERRRR 121 RR +G TPR H R RRRR Sbjct: 440 RRRSGRTRRTPRACSPHPRRRRRRRRRRRRR 348
>LOC_Os09g06570:12009.t03490:unspliced-genomic expressed protein| Length = 559 Score = 26.7 bits (52), Expect(2) = 5.6 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 / -1 Query: 81 RNAAVDAQMNAGGASSSPTMIPP 149 R + + + + GGAS SP+ +PP Sbjct: 169 RRGSAEMEESGGGASFSPSPLPP 101 Score = 22.1 bits (42), Expect(2) = 5.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 / -2 Query: 214 RWLWPCSSAPAAGREA 261 RW +++PAAGR A Sbjct: 63 RWWQTAAASPAAGRGA 16
>LOC_Os12g10630:12012.t00941:unspliced-genomic ZF-HD homeobox protein, putative, expressed| Length = 3221 Score = 26.3 bits (51), Expect(2) = 6.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -3 / +3 Query: 172 GVGVDQNGGGIMVGD 128 G GV+ GGG++VGD Sbjct: 1341 GGGVEGGGGGVVVGD 1385 Score = 22.1 bits (42), Expect(2) = 6.6 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -2 / +1 Query: 218 HRDEAHHHG 192 H D HHHG Sbjct: 1252 HHDHHHHHG 1278
>LOC_Os06g50840:12006.t04768:unspliced-genomic zinc ion binding protein, putative, expressed| Length = 5714 Score = 27.6 bits (54), Expect(2) = 6.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 / +3 Query: 316 RWTGRCPRW 342 RW G+CPRW Sbjct: 642 RWCGQCPRW 668 Score = 25.8 bits (50), Expect(2) = 6.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 / +3 Query: 123 SSSPTMIPPPFWSTPTP 173 ++SPT PPP S PTP Sbjct: 144 TTSPTPRPPPRRSPPTP 194
>LOC_Os02g47470:12002.t04331:unspliced-genomic cytochrome P450 90D2, putative, expressed| Length = 2865 Score = 26.3 bits (51), Expect(2) = 6.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 / +1 Query: 229 CSSAPAAGREAARTRRLSRPG*CLC 303 C SAP+A R RR R C C Sbjct: 157 CLSAPSAAAAGRRARRKRRRAACRC 231 Score = 22.1 bits (42), Expect(2) = 6.7 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 / +2 Query: 144 PPPFWSTPTPYLFIGFAVVMSLI 212 PP P P+LF+ F +++ L+ Sbjct: 8 PPQQHHRPFPFLFLFFFLLLLLL 76
>LOC_Os02g56610:12002.t05233:unspliced-genomic expressed protein| Length = 2100 Score = 28.6 bits (56), Expect(2) = 6.8 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 / -3 Query: 223 WPCSSAPAAGREAARTRR 276 WP S AP AGR R RR Sbjct: 1189 WPASRAPRAGRGGRRGRR 1136 Score = 23.5 bits (45), Expect(2) = 6.8 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = +1 / -2 Query: 340 WWW*W 354 WWW*W Sbjct: 626 WWW*W 612
>LOC_Os02g39600:12002.t03598:unspliced-genomic outer envelope protein, putative, expressed| Length = 4170 Score = 26.7 bits (52), Expect(2) = 6.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 / -3 Query: 337 RWWW*WP 357 RWWW WP Sbjct: 106 RWWWWWP 86 Score = 26.3 bits (51), Expect(2) = 6.8 Identities = 12/40 (30%), Positives = 14/40 (35%) Frame = +1 / -3 Query: 226 PCSSAPAAGREAARTRRLSRPG*CLCAC*RRWTGRCPRWW 345 P + AP +RP C C R W RC W Sbjct: 424 PPTPAPTGRSGTTAAAWRARPRPCTTPCARTWPPRCRTPW 305
>LOC_Os04g58840:12004.t05345:unspliced-genomic aspartic proteinase nepenthesin-2 precursor, putative, expressed| Length = 2098 Score = 24.4 bits (47), Expect(2) = 6.9 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +3 / +3 Query: 75 TMRNAAVDAQMNAGGASSSPTMIPPPFWSTPT 170 T R+ +A SSS PPP S+PT Sbjct: 651 TARHGTPTPTTSARPTSSSTAQDPPPACSSPT 746 Score = 24.0 bits (46), Expect(2) = 6.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 / +3 Query: 226 PCSSAPAAGREAARTRRLSRP 288 PC+S A +A RRL RP Sbjct: 804 PCTSRRPASPVSAAARRLCRP 866
>LOC_Os11g44500:12011.t03978:unspliced-genomic ATP binding protein, putative, expressed| Length = 1894 Score = 24.4 bits (47), Expect(2) = 6.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 / -1 Query: 144 PPPFWSTPTPYLFIGFA 194 P P +STP P L I F+ Sbjct: 1879 PSPIFSTPLPSLSISFS 1829 Score = 24.0 bits (46), Expect(2) = 6.9 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 / -2 Query: 232 SSAPAAGREAARTRRLSRP 288 ++APAAGR A+ RR + P Sbjct: 1731 AAAPAAGRRASPRRRGALP 1675
>LOC_Os08g44300:12008.t04154:unspliced-genomic recombination protein O, RecO, putative, expressed| Length = 1808 Score = 31.3 bits (62), Expect = 7.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / +2 Query: 61 WCAF*CACSPALRINGGVCG 2 WCA C C+PA R G CG Sbjct: 998 WCAATCRCTPARRRRRG*CG 1057
>LOC_Os08g09320:12008.t00817:unspliced-genomic vacuolar protein sorting protein 72, putative, expressed| Length = 3434 Score = 31.3 bits (62), Expect = 7.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 / +1 Query: 115 PAFICASTAAFLMVLCNAWCAF*CA 41 PAF C S+ FL+ +W F*CA Sbjct: 268 PAFCCFSSYHFLISFSGSWILF*CA 342
>LOC_Os05g18660:12005.t01633:unspliced-genomic F-box domain containing protein, expressed| Length = 3046 Score = 31.3 bits (62), Expect = 7.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 / +1 Query: 87 AAVDAQMNAGGASSSPTMIPPPFWSTPTPY 176 AAV + GGA SP I PP + P PY Sbjct: 118 AAVHRRETGGGAPVSPFCIAPPSFLLPHPY 207
>LOC_Os12g29040:12012.t02614:unspliced-genomic 36.4 kDa proline-rich protein, putative| Length = 1613 Score = 31.3 bits (62), Expect = 7.3 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +1 / -1 Query: 298 LCAC*RRWTGRCPRWWW*W 354 L C W RC WWW W Sbjct: 1334 LRGCYGWWLARCYNWWWRW 1278
>LOC_Os12g01220:12012.t00021:unspliced-genomic expressed protein| Length = 5741 Score = 31.3 bits (62), Expect = 7.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 / -3 Query: 301 CAC*RRWTGRCPRWWW*W 354 CAC RR +GR RWW W Sbjct: 5610 CACGRRCSGRRWRWWRGW 5557
>LOC_Os12g01210:12012.t00020:unspliced-genomic HCF152, putative, expressed| Length = 2464 Score = 31.3 bits (62), Expect = 7.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 / +2 Query: 301 CAC*RRWTGRCPRWWW*W 354 CAC RR +GR RWW W Sbjct: 1958 CACGRRCSGRRWRWWRGW 2011
>LOC_Os11g01210:12011.t00021:unspliced-genomic HCF152, putative| Length = 1632 Score = 31.3 bits (62), Expect = 7.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 / +2 Query: 301 CAC*RRWTGRCPRWWW*W 354 CAC RR +GR RWW W Sbjct: 1367 CACGRRCSGRRWRWWRGW 1420
>LOC_Os10g40620:12010.t03304:unspliced-genomic expressed protein| Length = 2621 Score = 31.3 bits (62), Expect = 7.3 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +1 / -2 Query: 226 PCSSAPAAGREAARTRRLSRPG*CLCAC*RRWT 324 PC SAPAA RR R C +C RR T Sbjct: 454 PCCSAPAAAAPPPSRRRRRRRRRCTASCRRRRT 356
>LOC_Os10g31510:12010.t02474:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 792 Score = 31.3 bits (62), Expect = 7.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 / +1 Query: 295 CLCAC*RRWTGRCPRWW 345 C C C*R W G +WW Sbjct: 514 CRCLC*RWWNGWWSKWW 564
>LOC_Os09g38070:12009.t03281:unspliced-genomic PRLI-interacting factor A, putative, expressed| Length = 1570 Score = 31.3 bits (62), Expect = 7.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 / +1 Query: 307 C*RRWTGRCPRWWW*WP 357 C RR R RWWW WP Sbjct: 571 CRRRSCRRRARWWWRWP 621
>LOC_Os01g21650:12001.t01902:unspliced-genomic expressed protein| Length = 3605 Score = 31.3 bits (62), Expect = 7.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 / -2 Query: 226 PCSSAPAAGREAARTRRLSRPG 291 PC +PAAGR R RR R G Sbjct: 2425 PCRRSPAAGRRGGRCRRRRRAG 2360
>LOC_Os01g05680:12001.t00452:unspliced-genomic geranylgeranyl transferase type-1 beta subunit, putative, expressed| Length = 4267 Score = 31.3 bits (62), Expect = 7.3 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 / +1 Query: 693 FFFFFSSCKQQATSTRLHH 637 FFFF++SCK+Q + R H Sbjct: 727 FFFFWNSCKEQLLAARFKH 783
>LOC_Os05g27370:12005.t02388:unspliced-genomic hypothetical protein| Length = 761 Score = 26.3 bits (51), Expect(2) = 7.4 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 / +2 Query: 340 WWW*WPA 360 WWW WPA Sbjct: 230 WWWSWPA 250 Score = 22.1 bits (42), Expect(2) = 7.4 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 / +2 Query: 271 RRLSRPG*CLCAC*RRWTGRCPRWWW 348 RRL RPG L RR G W W Sbjct: 20 RRLRRPGGELLQRQRRGGGGEKSWQW 97
>LOC_Os07g45410:12007.t04179:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 9379 Score = 29.5 bits (58), Expect(2) = 7.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 / -3 Query: 217 WLWPCSSAPAAGREAARTRRLSRP 288 W WP SS P+ + R +R +RP Sbjct: 4982 WYWPGSSGPSEPAQEGRPKRGARP 4911 Score = 24.4 bits (47), Expect(2) = 7.5 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +1 / -3 Query: 319 WTGRCPRW 342 W G CPRW Sbjct: 4193 WRGTCPRW 4170
>LOC_Os04g56120:12004.t05084:unspliced-genomic receptor-like kinase, putative, expressed| Length = 1752 Score = 25.8 bits (50), Expect(2) = 7.8 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 / -2 Query: 23 PQRRTAGTLESTPRVTQYHEECG 91 P R +GT TPR T+ CG Sbjct: 470 PPARRSGTRRGTPRRTRRSRPCG 402 Score = 25.8 bits (50), Expect(2) = 7.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 / -2 Query: 232 SSAPAAGREAARTRRLSRPG*CLCAC*RRW 321 S + R R RR RPG C C RW Sbjct: 326 SGSCCPSRRRPRPRRRFRPGCCCCRRRWRW 237
>LOC_Os12g25200:12012.t02242:unspliced-genomic chloride channel protein CLC-a, putative, expressed| Length = 3632 Score = 28.6 bits (56), Expect(2) = 8.1 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 / +2 Query: 316 RWTGRCPRWW 345 RW CPRWW Sbjct: 2261 RWWSACPRWW 2290 Score = 24.0 bits (46), Expect(2) = 8.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 / +2 Query: 226 PCSSAPAAGREAARTRRLSR 285 PC + A R AAR RR R Sbjct: 1625 PCRARRATRRSAARARRWGR 1684
>LOC_Os06g11860:12006.t01063:unspliced-genomic transcription factor DRE-binding factor 2, putative, expressed| Length = 2074 Score = 28.1 bits (55), Expect(2) = 9.0 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 / -3 Query: 87 AAVDAQMNAGGASSSPTMIPPPFWSTPTPYLF 182 AAV A SPT +PP WS+ T L+ Sbjct: 1592 AAVAAAGEEANRRRSPTRLPPTSWSSSTRSLW 1497 Score = 23.5 bits (45), Expect(2) = 9.0 Identities = 6/11 (54%), Positives = 6/11 (54%) Frame = +1 / -3 Query: 322 TGRCPRWWW*W 354 T R WWW W Sbjct: 827 TSRRREWWWWW 795
>LOC_Os01g51400:12001.t04572:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 2337 Score = 24.9 bits (48), Expect(2) = 9.1 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +1 / +2 Query: 229 CSSAPAAGREAARTRRLSRPG*CLCAC*RRWTGRCPRWWW 348 CSS P R+R +R G *R R W W Sbjct: 1733 CSSRPRRRTRPRRSRTCTRSGSSCLRS*RGGRRRTATWTW 1852 Score = 23.1 bits (44), Expect(2) = 9.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 / +2 Query: 120 ASSSPTMIPPPFWSTPTP 173 A+SSPT PP S+ TP Sbjct: 1640 AASSPTGTSPPPTSSSTP 1693
>LOC_Os02g29510:12002.t02644:unspliced-genomic non-imprinted in Prader-Willi/Angelman syndrome region protein 1,| putative, expressed Length = 11896 Score = 29.5 bits (58), Expect(2) = 9.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 / -1 Query: 217 WLWPCSSAPAAGREAARTRRLSRP 288 W WP SS P+ + R +R +RP Sbjct: 3676 WYWPGSSGPSEPAQEGRPKRGARP 3605 Score = 24.4 bits (47), Expect(2) = 9.1 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +1 / -1 Query: 319 WTGRCPRW 342 W G CPRW Sbjct: 2887 WRGTCPRW 2864
>LOC_Os11g06070:12011.t00499:unspliced-genomic expressed protein| Length = 1729 Score = 24.0 bits (46), Expect(2) = 9.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 / +3 Query: 326 PVQRRQHAHRHHPGRD 279 P +RR+ H H GRD Sbjct: 129 PRRRRRRRHHHRRGRD 176 Score = 24.0 bits (46), Expect(2) = 9.3 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 / +3 Query: 230 HGQSHRDEAHHHGEADEQ 177 H + RD+ HH DEQ Sbjct: 156 HHRRGRDDRHHRRRGDEQ 209
>LOC_Os12g05550:12012.t00443:unspliced-genomic sialyltransferase-like protein, putative, expressed| Length = 1579 Score = 26.3 bits (51), Expect(2) = 9.5 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 / +3 Query: 81 RNAAVDAQMNAGGASSSPTMIPPPFWSTPTP 173 R + A+S PTM P P S+P P Sbjct: 240 RRRPATPSVTPSSAASRPTMAPDPARSSPRP 332 Score = 24.9 bits (48), Expect(2) = 9.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 / +3 Query: 229 CSSAPAAGREAART 270 CSSAPA R + RT Sbjct: 651 CSSAPAVARRSTRT 692
>LOC_Os05g23440:12005.t02001:unspliced-genomic solute carrier family 35, member F1, putative, expressed| Length = 5502 Score = 26.3 bits (51), Expect(3) = 9.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 / +1 Query: 298 LCAC*RRWTGRCPR 339 LC C*R+W CP+ Sbjct: 5158 LCLC*RKWPLSCPQ 5199 Score = 23.1 bits (44), Expect(3) = 9.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 / +1 Query: 114 GGASSSPTMIPPPFWSTPT 170 G A+SSP+ PPP P+ Sbjct: 124 GWANSSPSSSPPPASPPPS 180 Score = 22.6 bits (43), Expect(3) = 9.6 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 / +1 Query: 153 FWSTPTPYLFIGFAVVMSLIAVALAVLL 236 F +T FIGFAV M + + +LL Sbjct: 4024 FLATSQVVPFIGFAVAMFMFYSLVPILL 4107
>LOC_Os10g41460:12010.t03382:unspliced-genomic expressed protein| Length = 1554 Score = 30.9 bits (61), Expect = 9.9 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 / +1 Query: 87 AAVDAQMNAGGASSSPTMIPPPFWS 161 AA A +++GGA S +PPP W+ Sbjct: 202 AAAAAAVSSGGAGGSGRRLPPPCWT 276
>LOC_Os09g32220:12009.t02838:unspliced-genomic protein pob, putative, expressed| Length = 3524 Score = 30.9 bits (61), Expect = 9.9 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 / -3 Query: 218 HRDEAHHHGEADE 180 H DE HHHGE DE Sbjct: 258 HADEHHHHGERDE 220
>LOC_Os07g43020:12007.t03950:unspliced-genomic expressed protein| Length = 905 Score = 30.9 bits (61), Expect = 9.9 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 / +1 Query: 78 MRNAAVDAQMNAGGASSSPTMIPPPFWSTPTP 173 +R D + GA S T PPPF S P P Sbjct: 4 LRGGVTDMWAHTCGAHMSATQSPPPFSSRPIP 99
>LOC_Os06g42520:12006.t03943:unspliced-genomic transposon protein, putative, unclassified| Length = 6133 Score = 30.9 bits (61), Expect = 9.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 / -3 Query: 102 QMNAGGASSSPTMIPPPFWSTPTPYLFIG 188 Q AGG S +M+PPP+ S+ TP +G Sbjct: 5567 QTCAGGCSDKFSMMPPPYPSSTTPPSALG 5481
>LOC_Os06g42420:12006.t03933:unspliced-genomic transposon protein, putative, unclassified| Length = 4115 Score = 30.9 bits (61), Expect = 9.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 / -3 Query: 102 QMNAGGASSSPTMIPPPFWSTPTPYLFIG 188 Q AGG S +M+PPP+ S+ TP +G Sbjct: 3549 QTCAGGCSDKFSMMPPPYPSSKTPPSALG 3463
>LOC_Os06g11450:12006.t01022:unspliced-genomic RING-H2 finger protein ATL3B precursor, putative, expressed| Length = 1816 Score = 30.9 bits (61), Expect = 9.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 / -3 Query: 236 EEHGQSHRDEAHHHGEAD 183 EE G+ R E HHHG A+ Sbjct: 278 EEEGRDERHEEHHHGRAE 225
>LOC_Os05g39480:12005.t03489:unspliced-genomic transposon protein, putative, unclassified| Length = 4116 Score = 30.9 bits (61), Expect = 9.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 / -3 Query: 102 QMNAGGASSSPTMIPPPFWSTPTPYLFIG 188 Q AGG S +M+PPP+ S+ TP +G Sbjct: 3550 QTCAGGCSDKFSMMPPPYPSSTTPPSALG 3464
>LOC_Os05g18230:12005.t01591:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6611 Score = 30.9 bits (61), Expect = 9.9 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 / +1 Query: 142 IMVGDEEAPPAFICASTAAFLMVLCNAW 59 + V DE+ +C+S+ FL+ LC AW Sbjct: 1888 VAVVDEQLVGLRVCSSSFVFLLELCGAW 1971
>LOC_Os03g12490:12003.t01048:unspliced-genomic transposon protein, putative, unclassified| Length = 4119 Score = 30.9 bits (61), Expect = 9.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +3 / -3 Query: 102 QMNAGGASSSPTMIPPPFWSTPTPYLFIG 188 Q AGG S +M+PPP+ S+ TP +G Sbjct: 3553 QTCAGGCSDKFSMMPPPYPSSTTPPSALG 3467
>LOC_Os03g08490:12003.t00706:unspliced-genomic ethylene-responsive element binding protein 2, putative, expressed| Length = 1283 Score = 30.9 bits (61), Expect = 9.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 / +1 Query: 81 RNAAVDAQMNAGGASSSPTMIPPPFWSTPTP 173 R +A ++ +A G++ SP PPP +TP P Sbjct: 388 RRSATPSRASASGSARSPPPRPPPTPTTPPP 480
>LOC_Os12g44100:12012.t04076:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 4568 Score = 30.9 bits (61), Expect = 10.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 / +2 Query: 319 WTGRCPRWWW*WPA 360 W GRC RW W W A Sbjct: 3908 WRGRCRRWRWRWRA 3949
>LOC_Os10g02500:12010.t00141:unspliced-genomic serine/threonine-protein kinase BRI1-like 2 precursor, putative,| expressed Length = 3612 Score = 30.9 bits (61), Expect = 10.0 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 / -3 Query: 226 PCSSAPAAGREAARTRRLSRPG*CLCAC*RRWTGRCPRWW 345 P + AP A R A+R R +R C C+ RR RW+ Sbjct: 1372 PAAGAPPAPRRASRARPGARRRSCCCSGRRRGGSCSGRWY 1253
>LOC_Os09g34230:12009.t02999:unspliced-genomic indole-3-acetate beta-glucosyltransferase, putative, expressed| Length = 1804 Score = 30.9 bits (61), Expect = 10.0 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +1 / +3 Query: 232 SSAPAAGREAARTRRLSRPG*CLCAC*RRWTGRCPRWW 345 SSA A R ++ RR R C+ RR GR RWW Sbjct: 294 SSAATAARTSSGWRRPGRCPWTSCSAGRRSGGRRRRWW 407
>LOC_Os08g42790:12008.t04008:unspliced-genomic hypothetical protein| Length = 510 Score = 30.9 bits (61), Expect = 10.0 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 / +2 Query: 232 SSAPAAGREAARTRRLSRPG*CLCAC*RRWTGRCPRWWW 348 ++A +A R A + + G C C+ *RR GR RW W Sbjct: 227 AAAASARRCGAWSTSTTTTGPCCCSR*RRRRGRRRRWRW 343
>LOC_Os07g40910:12007.t03750:unspliced-genomic expressed protein| Length = 633 Score = 30.9 bits (61), Expect = 10.0 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 / +3 Query: 253 REAARTRRLSRPG*CLCAC*RRWTGRCPRWW 345 R+ R+R P C C RCPRWW Sbjct: 204 RKIRRSRTTRPPSSRSCRCRSTSCRRCPRWW 296
>LOC_Os04g53930:12004.t04866:unspliced-genomic organic cation transporter protein, putative, expressed| Length = 3366 Score = 30.9 bits (61), Expect = 10.0 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 / +1 Query: 232 SSAPAAGREAARTRRLSRPG*CLCAC*RRWTGRCPRW 342 ++APA R + R RR P RR +G C RW Sbjct: 2113 TTAPAQARSSTRQRRRRAPSSTCSGRGRRGSGWCSRW 2223
>LOC_Os03g50080:12003.t04352:unspliced-genomic FK506 binding protein, putative, expressed| Length = 1358 Score = 30.9 bits (61), Expect = 10.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 / -2 Query: 217 WLWPCSSAPAAGREAARTRRLSR 285 W WP ++ P +G AAR RR R Sbjct: 499 WCWPAAARPRSGS*AARRRRRRR 431
>LOC_Os03g18630:12003.t01633:unspliced-genomic receptor-like kinase RHG1, putative, expressed| Length = 2786 Score = 30.9 bits (61), Expect = 10.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 / -1 Query: 214 RWLWPCSSAPAAGREAARTRRLSRPG*CLCA 306 RW WP S A GR RR R C C+ Sbjct: 2018 RWSWPWRS*GATGRSRRSWRRSPRRAGCCCS 1926
>LOC_Os03g16334:12003.t01418:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 4996 Score = 30.9 bits (61), Expect = 10.0 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 / -2 Query: 235 SAPAAGREAARTRRLSRP 288 +APA GR A+RTRR RP Sbjct: 3771 AAPAGGRPASRTRRRGRP 3718
>LOC_Os01g52250:12001.t04652:unspliced-genomic glycogen synthase, putative, expressed| Length = 10480 Score = 30.9 bits (61), Expect = 10.0 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 / +1 Query: 265 RTRRLSRPG*CLCAC*RRWTGRCPRWWW*W 354 R RR RPG + C RW GR R W W Sbjct: 9649 RGRRGGRPGSPVAPCR*RWPGRRTRTWRTW 9738
>LOC_Os01g52240:12001.t04651:unspliced-genomic chlorophyll a-b binding protein 2, chloroplast precursor, putative,| expressed Length = 1057 Score = 30.9 bits (61), Expect = 10.0 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 / -2 Query: 265 RTRRLSRPG*CLCAC*RRWTGRCPRWWW*W 354 R RR RPG + C RW GR R W W Sbjct: 831 RGRRGGRPGSPVAPCR*RWPGRRTRTWRTW 742
>LOC_Os01g35990:12001.t03149:unspliced-genomic expressed protein| Length = 3035 Score = 30.9 bits (61), Expect = 10.0 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 / +3 Query: 214 RWLWPCSSAPAAGREAAR 267 RW WPC A GRE R Sbjct: 132 RWPWPCPGGAAQGREPGR 185
>LOC_Os01g34470:12001.t03005:unspliced-genomic hypothetical protein| Length = 1566 Score = 30.9 bits (61), Expect = 10.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 / -3 Query: 313 RRWTGRCPRWWW*W 354 RR RC RWWW W Sbjct: 256 RRRRPRCRRWWWWW 215 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 229,791,705 Number of extensions: 3462503 Number of successful extensions: 22466 Number of sequences better than 10.0: 119 Length of query: 232 Length of database: 55,613,886 Length adjustment: 49 Effective length of query: 183 Effective length of database: 52,856,264 Effective search space: 9672696312 Effective search space used: 9672696312 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
