ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf114f20 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os04g24340:12004.t02147:unspliced-genomic phytase, putative| Length = 1202 Score = 58.8 bits (122), Expect(4) = 1e-17 Identities = 28/59 (47%), Positives = 37/59 (62%) Frame = +3 / +3 Query: 774 GVAVLVFTAAAMVWDIYTAEDKLEAAVRDSVNALTAVVNLEVGEIVTTAVEAGFVALDI 950 GVAVL+ TA MVWDI+TAE +EA +R+S+NAL V V +V AV L++ Sbjct: 825 GVAVLLATAGLMVWDIFTAEHTVEAVLRNSLNALAEVGAFAVQVVVEGAVTEAVADLEL 1001 Score = 47.8 bits (98), Expect(4) = 1e-17 Identities = 19/35 (54%), Positives = 27/35 (77%) Frame = +3 / +3 Query: 639 SKLGFRGAFKNLDDIQKLQVYDNIIAEAGQGKSVV 743 +KLGF G F++L D QKL+VY++II E+G+ K V Sbjct: 696 NKLGFEGEFEHLTDAQKLEVYNSIIEESGRAKMPV 800 Score = 24.0 bits (46), Expect(4) = 1e-17 Identities = 17/56 (30%), Positives = 22/56 (39%) Frame = +3 / +1 Query: 102 GDLVDLSPGQLHKLADLIHRQEVQKLQELEFNSYAEQQKYLRDANDARDKVYHILD 269 GDLV L K L+ R + S E+ KYL N A + +LD Sbjct: 25 GDLVMLMEVSQLKKLALLLRNNEEAQITQAVKSQNERVKYLHSVNHAYNHAVDLLD 192 Score = 22.6 bits (43), Expect(4) = 1e-17 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 / +1 Query: 495 QRLALEAGMYKKATLENAKKFQHFAPNQFSK 587 +RLA + M+K+ E+ K + + SK Sbjct: 427 RRLAKDTAMFKECMFEHCNKLRSGSARAMSK 519
>LOC_Os04g24460:12004.t02158:unspliced-genomic phytase, putative| Length = 1202 Score = 58.8 bits (122), Expect(2) = 3e-17 Identities = 28/59 (47%), Positives = 37/59 (62%) Frame = +3 / +3 Query: 774 GVAVLVFTAAAMVWDIYTAEDKLEAAVRDSVNALTAVVNLEVGEIVTTAVEAGFVALDI 950 GVAVL+ TA MVWDI+TAE +EA +R+S+NAL V V +V AV L++ Sbjct: 825 GVAVLLATAGLMVWDIFTAEHTVEAVLRNSLNALAEVGAFAVQVVVEGAVTEAVADLEL 1001 Score = 50.6 bits (104), Expect(2) = 3e-17 Identities = 22/47 (46%), Positives = 30/47 (63%) Frame = +3 / +3 Query: 639 SKLGFRGAFKNLDDIQKLQVYDNIIAEAGQGKSVVTYSFEALGKVGV 779 +KLGF G F++L D QKL+VY++II E+G+ K VT V V Sbjct: 696 NKLGFEGEFEHLTDAQKLEVYNSIIEESGRAKMPVTEMVSTAAGVAV 836
>LOC_Os01g33300:12001.t02900:unspliced-genomic exopolygalacturonase precursor, putative, expressed| Length = 1688 Score = 29.5 bits (58), Expect(2) = 0.070 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -1 / +2 Query: 366 RWPWCSSHRHPCQYLAWWHPSQPRFVLSCP 277 RW W + PC+ +W PS +CP Sbjct: 737 RWCWTT*RTGPCRGSSW*TPSSSTSTCTCP 826 Score = 27.2 bits (53), Expect(2) = 0.070 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -1 / +3 Query: 276 VHCQGCDTPYRGHH 235 VH QGCD R HH Sbjct: 816 VHVQGCDDQERDHH 857
>LOC_Os07g09420:12007.t00817:unspliced-genomic ATPase 2, putative, expressed| Length = 1753 Score = 29.9 bits (59), Expect(2) = 0.094 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +2 / -2 Query: 983 RSRRFWNWCAHWDSCRCAA 1039 RSR W W W +CRC A Sbjct: 948 RSRGSWPWRRSWWTCRCRA 892 Score = 26.3 bits (51), Expect(2) = 0.094 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 / -2 Query: 920 CRSWIRSTRHRNCFCGC 970 CRSW R +C C C Sbjct: 1122 CRSWRRRRPSSSCSCAC 1072
>LOC_Os06g28390:12006.t02543:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6594 Score = 36.3 bits (73), Expect = 0.49 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 / -2 Query: 950 RNCFCGCHGNWRSRRFWNWCAHWDSC 1027 R C CGCH W + R W W C Sbjct: 1151 RRCCCGCHRRWPAVRSKQWWRPWSLC 1074
>LOC_Os01g51520:12001.t04584:unspliced-genomic hypothetical protein| Length = 507 Score = 36.3 bits (73), Expect = 0.49 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 / +2 Query: 929 WIRSTRHRNCFCGCHGNWRSRRFWNWCAHWDSCRCA 1036 W R R R C C G+WR + W W + +C A Sbjct: 359 WTRRARRRACRRICFGSWRRSKGWAWRSWRSACSWA 466
>LOC_Os07g40290:12007.t03690:unspliced-genomic indole-3-acetic acid-amido synthetase GH3.8, putative, expressed| Length = 2431 Score = 35.9 bits (72), Expect = 0.67 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +2 / -2 Query: 890 P*GGRNSYYCCRSWIRSTRHRNCFCGCHGNWRSRRFWNWCAHWDSCRC 1033 P GG S C W R+ R + G G +R WC W++ RC Sbjct: 1395 PRGGTRSSPC*A*WCRTPRRGRTWGGG*GRSSTRMTRTWCTPWEARRC 1252
>LOC_Os08g32370:12008.t02982:unspliced-genomic mucin-associated surface protein, putative| Length = 5752 Score = 30.4 bits (60), Expect(2) = 0.70 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 / +1 Query: 717 EAGQGKSVVTYSFEALGKVGVAVLVFTAAAMVWDIYTAEDKLEAAVRDSVNAL 875 EA +V +FEA GVAV A + A+D +EAA +++ A+ Sbjct: 415 EAATAVAVAKTAFEAAAAKGVAVAKALAKEAAEVVAMAKDLVEAAAKEAAEAV 573 Score = 22.6 bits (43), Expect(2) = 0.70 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +2 Query: 983 RSRRFWNWCAHW 1018 RSRR W W W Sbjct: 629 RSRRRWRWRRTW 664
>LOC_Os01g55000:12001.t04913:unspliced-genomic expressed protein| Length = 1493 Score = 35.4 bits (71), Expect = 0.93 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 / -3 Query: 357 WCSSHRHPCQYLAWWHPSQPRFVLSCPVHCQ 265 W + HP + +WWHP+ +S P CQ Sbjct: 417 WTAEKTHPTRGWSWWHPAPLPLPVSLPPPCQ 325
>LOC_Os12g39980:12012.t03677:unspliced-genomic kinesin like protein, putative, expressed| Length = 16108 Score = 35.0 bits (70), Expect = 1.3 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 / +1 Query: 977 NWRSRRFWNWCAH 1015 +WR RR+W WCAH Sbjct: 862 SWRRRRWWTWCAH 900
>LOC_Os06g19480:12006.t01767:unspliced-genomic expressed protein| Length = 2498 Score = 35.0 bits (70), Expect = 1.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 / -3 Query: 363 WPWCSSHRHPCQYLAWWHPS 304 WP C+ H C AWWH S Sbjct: 699 WPVCAPHPQSCSCSAWWHRS 640
>LOC_Os04g41189:12004.t03680:unspliced-genomic hypothetical protein| Length = 264 Score = 35.0 bits (70), Expect = 1.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 / -3 Query: 363 WPWCSSHRHPCQYLAWWHPSQPR 295 W +CS+H PC +A HPS P+ Sbjct: 139 WLFCSTHPSPCHSIAHLHPSPPQ 71
>LOC_Os09g24220:12009.t02105:unspliced-genomic DNA mismatch repair protein MSH6-1, putative, expressed| Length = 8715 Score = 34.5 bits (69), Expect = 1.7 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 / +2 Query: 896 GGRNSYYCCRSWIRSTRHRNCFCGC 970 G + SYY ++ S H NCFC C Sbjct: 7706 GSKGSYYGWAKYVLSGAHGNCFCAC 7780
>LOC_Os03g13750:12003.t01168:unspliced-genomic erwinia induced protein 2, putative, expressed| Length = 3622 Score = 34.5 bits (69), Expect = 1.7 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +3 / -2 Query: 375 LQFIRSYNTRLTYLDKLKTHSDDLIKQLKFLNPATQQKEAQRL 503 LQF+++Y ++L K+ TH L K LK LN K AQ L Sbjct: 672 LQFLKAYIFGRSHLSKMDTHKTKLHKTLKILNTN*N*KGAQDL 544
>LOC_Os02g02700:12002.t00169:unspliced-genomic AMP binding protein, putative, expressed| Length = 2200 Score = 34.5 bits (69), Expect = 1.7 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 / +1 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFWNW 1006 R W R + R GC G WR R+W W Sbjct: 1828 RGWWRRS*WRTAGRGCRGTWRRGRWWWW 1911
>LOC_Os03g18330:12003.t01605:unspliced-genomic conserved hypothetical protein| Length = 645 Score = 34.5 bits (69), Expect = 1.8 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 / -2 Query: 1326 SSSWHHEYNSFPTGAGGIILG 1264 +SSWH +SF T AGGI+LG Sbjct: 410 ASSWHSSSSSFLTEAGGIVLG 348
>LOC_Os02g47620:12002.t04346:unspliced-genomic catalytic/ hydrolase, putative, expressed| Length = 2296 Score = 33.1 bits (66), Expect(2) = 2.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 / +1 Query: 968 CHGNWRSRRFWNWCAHWDSCR 1030 C G+WR+R W W SCR Sbjct: 1669 CRGSWRTRAGTRWTGCWASCR 1731 Score = 23.1 bits (44), Expect(2) = 2.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 / +2 Query: 298 RLRRMPPSKILARMSMTTAPR 360 R R PPS+ R + T APR Sbjct: 83 RSRARPPSRPPPRAAATAAPR 145
>LOC_Os10g26330:12010.t02045:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 718 Score = 34.1 bits (68), Expect = 2.4 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 / -3 Query: 950 RNCFCGCHGNWRSRRFWNWCAHWDSC 1027 R C CGC + W+W + W SC Sbjct: 632 RRCRCGCRCRLKQAGRWSW*SGWSSC 555
>LOC_Os06g37640:12006.t03459:unspliced-genomic expressed protein| Length = 8785 Score = 34.1 bits (68), Expect = 2.4 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -3 / +2 Query: 379 WRDIPMALVQ*S*TSLPISCLVASFSASVCAIMSRALSRM 260 W +P+A +Q + +SLP+ LV+S S S+ +S +L M Sbjct: 2699 WTKLPLAFLQSAFSSLPVIPLVSSLSLSLSLSLSLSLGEM 2818
>LOC_Os01g19500:12001.t01740:unspliced-genomic hypothetical protein| Length = 312 Score = 30.4 bits (60), Expect(2) = 2.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 / -1 Query: 240 HHWRHGDTFVALH 202 H W+HGD F ALH Sbjct: 189 HTWKHGDEFTALH 151 Score = 22.6 bits (43), Expect(2) = 2.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 / -2 Query: 555 TFWHSPAWLSYTCQPQGQGAGPP 487 T+W S + + P G+GA PP Sbjct: 302 TWWASRSVGASPGAPSGRGASPP 234
>LOC_Os12g06820:12012.t00567:unspliced-genomic neurofilament protein H form H2, putative, expressed| Length = 2235 Score = 33.6 bits (67), Expect = 3.3 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 / +2 Query: 896 GGRNSYYCCRSWIRSTRHRNCFCGCHGNWRSRRFWNWCAHWDSCRCAA 1039 GGR ++ R + +R R + G WR+ R+W A +CR A+ Sbjct: 752 GGRWAWSSARGRMTRSRWRRRWSGGASGWRTGRWWRGSAGCSTCRQAS 895
>LOC_Os05g04520:12005.t00348:unspliced-genomic pto kinase interactor 1, putative, expressed| Length = 4418 Score = 33.6 bits (67), Expect = 3.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 / +2 Query: 932 IRSTRHRNCFCGCHGNWR 985 +RS RHR C CGC W+ Sbjct: 4187 LRSMRHRYCSCGCVAGWK 4240
>LOC_Os11g36280:12011.t03175:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 12369 Score = 33.1 bits (66), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 10485 RRWCRRTWRRNRRIWCSRRWRSRRRW 10408
>LOC_Os10g20410:12010.t01534:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3166 Score = 33.1 bits (66), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -3 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 1283 RRWCRRTWRRNWRRWCRRRWRSRRRW 1206
>LOC_Os10g08370:12010.t00659:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2191 Score = 33.1 bits (66), Expect = 4.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -2 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 300 RRWCRGTWRRNRKI*CRRRWRSRRRW 223
>LOC_Os03g55750:12003.t04836:unspliced-genomic hypothetical protein| Length = 1831 Score = 33.1 bits (66), Expect = 4.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 / -3 Query: 362 HRNISPIHPELQHPSHLP*QAQDP 433 HR +SP+ EL HP P*++Q P Sbjct: 1574 HRRLSPVDDELLHPPPSP*RSQQP 1503
>LOC_Os03g41190:12003.t03537:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3312 Score = 33.1 bits (66), Expect = 4.5 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 / -1 Query: 902 RNSYYCCRSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R S R W R T RN C WRSRR W Sbjct: 1656 RRSRRSRRRWCRRTWRRNRRRWCRRRWRSRRRW 1558
>LOC_Os03g24440:12003.t02139:unspliced-genomic adenylate isopentenyltransferase, putative, expressed| Length = 987 Score = 33.1 bits (66), Expect = 4.5 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 / +2 Query: 920 CRSWIRSTRHRNCFCGCHGNWRSRRFW 1000 CR W RS C G G W RR+W Sbjct: 698 CRRWPRSGASARCPGGTSGAWTRRRWW 778
>LOC_Os02g12660:12002.t01063:unspliced-genomic receptor-like kinase, putative, expressed| Length = 4821 Score = 33.1 bits (66), Expect = 4.5 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 / -2 Query: 938 STRHRNCFCGCHGNWRSRRFWNW 1006 S+ H +C C HG WR +R +W Sbjct: 4454 SSIHCSCRCSSHGGWRQQRL*SW 4386
>LOC_Os01g64320:12001.t05800:unspliced-genomic hypothetical protein| Length = 387 Score = 33.1 bits (66), Expect = 4.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 / -3 Query: 362 HRNISPIHPELQHPSHLP*QAQDP 433 HR +SP+ EL HP P*++Q P Sbjct: 130 HRRLSPVDDELLHPPPSP*RSQQP 59
>LOC_Os12g19880:12012.t01831:unspliced-genomic hypothetical protein| Length = 264 Score = 33.1 bits (66), Expect = 4.5 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +1 / +2 Query: 607 SCLRILCKKICQSLVLGGLSKTWMI 681 S L ++CKK C+ V+G L+ TW++ Sbjct: 32 STLILVCKKCCKMKVMGSLTLTWIL 106
>LOC_Os12g40660:12012.t03745:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2928 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -3 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 1051 RRWCRMTWRRNRRRWCRRRWRSRRRW 974
>LOC_Os11g26070:12011.t02223:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5068 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -2 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 4620 RRWCRRTWRRNRRRWCRRRWRSRRRW 4543
>LOC_Os11g09329:12011.t00824:unspliced-genomic VHS and GAT domain protein, putative, expressed| Length = 12864 Score = 32.7 bits (65), Expect = 6.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 / +2 Query: 926 SWIRSTRHRNCFCGCHGNWRSRRFW 1000 SW RS R R C C G W R +W Sbjct: 4724 SWRRSRRARRSGCWCWGAWGCRLWW 4798
>LOC_Os09g09420:12009.t00734:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8357 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 6458 RRWCRRTWRRNRRRWCRRRWRSRRRW 6381
>LOC_Os09g04190:12009.t00315:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1720 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 1144 RRWCRRTWRRNRRRWCRRRWRSRRRW 1067
>LOC_Os08g24410:12008.t02211:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5337 Score = 32.7 bits (65), Expect = 6.2 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 / -2 Query: 926 SWIRSTRHRNCFCGCHGNWRSRRFW 1000 SW RS R R C C G W R +W Sbjct: 3608 SWRRSRRARRSGCWCWGAWGCRLWW 3534
>LOC_Os08g19220:12008.t01743:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7346 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -3 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 5826 RRWCRRTWRRNRRRWCRRRWRSRRRW 5749
>LOC_Os07g25270:12007.t02223:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4850 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / +2 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 4715 RRWCRRTWRRNRRRWCRRRWRSRRRW 4792
>LOC_Os07g11840:12007.t01057:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1926 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 1542 RRWCRRTWRRNRRRWCRKRWRSRRRW 1465
>LOC_Os07g03440:12007.t00234:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4559 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -2 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 1750 RRWCRRTWRRNRRRWCRRRWRSRRRW 1673
>LOC_Os07g03350:12007.t00225:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4559 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -2 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 1750 RRWCRRTWRRNRRRWCRRRWRSRRRW 1673
>LOC_Os06g06440:12006.t00529:unspliced-genomic multidrug resistance-associated protein 14, putative, expressed| Length = 8146 Score = 32.7 bits (65), Expect = 6.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 / +2 Query: 959 FCGCHGNWRSRRFWNWCAHWDSCR 1030 FC CHG+ SR F W A + +C+ Sbjct: 5150 FCSCHGDSSSRNF*PW*AVYGNCK 5221
>LOC_Os05g46260:12005.t04114:unspliced-genomic expressed protein| Length = 4710 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 / +2 Query: 920 CRSWIRSTRHRNCFCGCHGNWRSRR 994 CRSW R R R GC W SRR Sbjct: 560 CRSWWRRRRARRSSEGCTSGWWSRR 634
>LOC_Os05g09220:12005.t00798:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2748 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -2 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 1766 RRWCRRTWRRNRRRWCRRRWRSRRRW 1689
>LOC_Os02g48760:12002.t04460:unspliced-genomic hypothetical protein| Length = 486 Score = 32.7 bits (65), Expect = 6.2 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 / -3 Query: 956 CFCGCHGNWRSRRFWNWCAHWDS 1024 C C G R RR+W WC W S Sbjct: 241 CMDDCGGRPRKRRWW*WCQIWCS 173
>LOC_Os01g28370:12001.t02533:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 14121 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -3 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 9829 RRWCRRTWRRNRRRWCRRRWRSRRRW 9752
>LOC_Os01g19960:12001.t01784:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9160 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -2 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 6675 RRWCRRTWRRNRRRWCRRRWRSRRRW 6598
>LOC_Os01g18190:12001.t01614:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1705 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 1144 RRWCRRTCRRNRRRWCRRRWRSRRRW 1067
>LOC_Os01g04140:12001.t00303:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2989 Score = 32.7 bits (65), Expect = 6.2 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 923 RSWIRSTRHRNCFCGCHGNWRSRRFW 1000 R W R T RN C WRSRR W Sbjct: 1144 RRWCRRTWRRNRRRWCRRRWRSRRRW 1067
>LOC_Os06g35200:12006.t03217:unspliced-genomic receptor-like kinase, putative, expressed| Length = 2856 Score = 32.7 bits (65), Expect = 6.2 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / -3 Query: 28 PCARGEADPSIAWCPQATPR 87 PC G DP+ WC A+PR Sbjct: 2149 PCTTGRPDPAHPWCRNASPR 2090
>LOC_Os03g13110:12003.t01106:unspliced-genomic transposon protein, putative, Mariner sub-class| Length = 2734 Score = 32.7 bits (65), Expect = 6.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 / +2 Query: 607 SCLRILCKKICQSLVLGGLSKTWMI 681 S L ++CKK C+ V+G L+ TW + Sbjct: 32 STLILVCKKCCKMKVMGSLTLTWFL 106
>LOC_Os01g64270:12001.t05795:unspliced-genomic expressed protein| Length = 1389 Score = 26.7 bits (52), Expect(2) = 8.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 / +3 Query: 363 WPWCSSHRHP 334 WPW SSHR P Sbjct: 222 WPWPSSHRAP 251 Score = 22.6 bits (43), Expect(2) = 8.2 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = -3 / +3 Query: 499 RWASFCWVAGLRNFSCLM 446 RW CW G +CL+ Sbjct: 99 RW*GSCWSTGSPAVACLL 152
>LOC_Os12g29650:12012.t02674:unspliced-genomic expressed protein| Length = 1893 Score = 32.2 bits (64), Expect = 8.5 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +2 / +2 Query: 902 RNSYYCCRSWIRSTRHRNCFCGCHGNWRSRRFWNWCA 1012 R +C W + R R C GC W R W A Sbjct: 1598 RRGAWCTTRWGATRRWRGCSAGCRATWCWSRGARWTA 1708
>LOC_Os10g07290:12010.t00588:unspliced-genomic glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed| Length = 2529 Score = 32.2 bits (64), Expect = 8.5 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 / -1 Query: 941 TRHRNCFCGCHGNWRSRRFWNWCAHWDSCRCA 1036 TR R +C C R RR +WC W R A Sbjct: 1317 TRRRRQWCRCRRRCRRRRRRSWCCPWAGGRRA 1222
>LOC_Os08g43050:12008.t04033:unspliced-genomic disease resistance protein RGA2, putative, expressed| Length = 4079 Score = 32.2 bits (64), Expect = 8.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 / +1 Query: 968 CHGNWRSRRFWNWCAHWDSCR 1030 C+ WR+R F WC W + R Sbjct: 97 CNATWRNRYFSRWCVGWPARR 159
>LOC_Os03g08960:12003.t00751:unspliced-genomic homeodomain-leucine zipper transcription factor TaHDZipI-1, putative,| expressed Length = 1895 Score = 32.2 bits (64), Expect = 8.5 Identities = 16/43 (37%), Positives = 19/43 (44%) Frame = +2 / -3 Query: 902 RNSYYCCRSWIRSTRHRNCFCGCHGNWRSRRFWNWCAHWDSCR 1030 R S R+ R+ R C R+RRFWN A W CR Sbjct: 939 RASQSARRASWRARRAAKSRSSCFVFHRARRFWNQTATWRGCR 811
>LOC_Os02g09690:12002.t00816:unspliced-genomic expressed protein| Length = 10310 Score = 32.2 bits (64), Expect = 8.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 / -3 Query: 190 SSS*SFWTSCRWIRSASLCNCPG 122 S++ FW SC W AS+C C G Sbjct: 4017 STNREFWCSCVWRHPASICICHG 3949
>LOC_Os06g28820:12006.t02586:unspliced-genomic cycloartenol synthase, putative, expressed| Length = 31712 Score = 32.2 bits (64), Expect = 8.6 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 / +3 Query: 28 PCARGEADPSIAWCPQATPRLTSC 99 P G A P I WC ++PR+ SC Sbjct: 13833 PVLPGHACPKIFWCVNSSPRVDSC 13904
>LOC_Os05g07070:12005.t00596:unspliced-genomic zinc finger, C3HC4 type family protein, expressed| Length = 7143 Score = 32.2 bits (64), Expect = 8.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -1 / -3 Query: 357 WCSSHRHPCQYLAWWH 310 WC+S R C ++ WWH Sbjct: 5377 WCTSKRTICIWMVWWH 5330 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 497,533,127 Number of extensions: 7759481 Number of successful extensions: 36431 Number of sequences better than 10.0: 60 Length of query: 459 Length of database: 55,613,886 Length adjustment: 51 Effective length of query: 408 Effective length of database: 52,743,708 Effective search space: 21519432864 Effective search space used: 21519432864 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
