| Clone Name | FLbaf108n20 |
|---|---|
| Clone Library Name | barley_pub |
>P50492:AMA1_PLAF8 Apical membrane antigen 1 precursor - Plasmodium falciparum| (isolate 7G8) Length = 622 Score = 32.0 bits (71), Expect = 0.76 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 1 EFTSLSHRDCGQ-HTIHRHSPRPIYHPMEERQADKMPASAQHHDEHPKQQESPDEEVSSL 177 EFT + + GQ + H + +YHP+ E + H EH QQE E+ ++L Sbjct: 14 EFTYMINFGRGQNYWEHPYQKSDVYHPINEHREHSKEYEYPLHQEHTYQQEDSGEDENTL 73
>P22621:AMA1_PLAFF Apical membrane antigen 1 precursor - Plasmodium falciparum| (isolate FC27 / Papua New Guinea) Length = 622 Score = 31.6 bits (70), Expect = 0.99 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 1 EFTSLSHRDCGQ-HTIHRHSPRPIYHPMEERQADKMPASAQHHDEHPKQQESPDEEVSSL 177 EFT + + GQ + H + +YHP+ E + H EH QQE E+ ++L Sbjct: 14 EFTYMINFGRGQNYWEHPYQKSDVYHPINEHREHPKEYQYPLHQEHTYQQEDSGEDENTL 73
>Q7SBU6:VID21_NEUCR Chromatin modification-related protein vid-21 - Neurospora crassa| Length = 2189 Score = 31.2 bits (69), Expect = 1.3 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 34 QHTIHRHSPRPIYHPMEERQADKMPASAQHHDEH-PKQQESPDEE 165 QH H+H P P ++ Q + S Q +H P+QQ+ P ++ Sbjct: 1328 QHQQHQHQQHP-QQPQQQGQVQQQVVSQQQQQQHQPQQQQQPQQQ 1371
>P50490:AMA1_PLAFG Apical membrane antigen 1 precursor - Plasmodium falciparum| (isolate FCR-3 / Gambia) Length = 622 Score = 31.2 bits (69), Expect = 1.3 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 1 EFTSLSHRDCGQ-HTIHRHSPRPIYHPMEERQADKMPASAQHHDEHPKQQESPDEEVSSL 177 EFT + + GQ + H + +YHP+ E + H EH QQE E+ ++L Sbjct: 14 EFTYMINFGRGQNYWEHPYQKSGVYHPINEHREHPKEYEYPLHQEHTYQQEDSGEDENTL 73
>P04929:HRPX_PLALO Histidine-rich glycoprotein precursor - Plasmodium lophurae| Length = 351 Score = 30.8 bits (68), Expect = 1.7 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +1 Query: 37 HTIHRHSPRPIYHPMEERQADKMPASAQHHDEHPKQQESPDEE 165 H H H +HP E + P +HH HP++ P E Sbjct: 53 HPEHLHEEHHHHHPEEHHE----PHHEEHHHHHPEEHHEPHHE 91
>P48620:FAD3C_SESIN Omega-3 fatty acid desaturase, chloroplast precursor - Sesamum| indicum (Oriental sesame) (Gingelly) Length = 447 Score = 30.8 bits (68), Expect = 1.7 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +1 Query: 19 HRDCGQHTIHRHSPR-PIYHPMEERQADKMPASAQHHDEHPKQQESPDEEVSSLSPTVAR 195 H D G H IH P+ P YH +E +A K P +++ E K P + L+ ++ R Sbjct: 364 HHDIGTHVIHHLFPQIPHYHLIEATEAAK-PVLGKYYREPKKSAPLPFHLLGDLTRSLKR 422
>P50489:AMA1_PLAFC Apical membrane antigen 1 precursor - Plasmodium falciparum| (isolate Camp / Malaysia) Length = 622 Score = 30.8 bits (68), Expect = 1.7 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +1 Query: 1 EFTSLSHRDCGQ-HTIHRHSPRPIYHPMEERQADKMPASAQHHDEHPKQQESPDEEVSSL 177 EFT + + GQ + H + +YHP+ E + H EH QQE E+ ++L Sbjct: 14 EFTYMINFGRGQNYWEHPYQNSNVYHPINEHREHPKEYQYPLHQEHTYQQEDSGEDENTL 73
>P48621:FAD3C_SOYBN Omega-3 fatty acid desaturase, chloroplast precursor - Glycine max| (Soybean) Length = 453 Score = 30.4 bits (67), Expect = 2.2 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +1 Query: 19 HRDCGQHTIHRHSPR-PIYHPMEERQADKMPASAQHHDEHPKQQESP 156 H D G H IH P+ P YH +E +A K P +++ E PK+ +P Sbjct: 368 HHDIGTHVIHHLFPQIPHYHLVEATEAAK-PVFGKYYRE-PKKSAAP 412
>Q11184:LE756_CAEEL Protein let-756 - Caenorhabditis elegans| Length = 425 Score = 30.0 bits (66), Expect = 2.9 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +1 Query: 55 SPRPIYHPMEERQADKMP--ASAQHHDEHPKQQESPDEE 165 SPRP Y+P + + P S HH HP+ S D + Sbjct: 359 SPRPAYNPYWQSPVTQAPHHNSHHHHHHHPRVSSSSDPQ 397
>P48619:FAD3C_RICCO Omega-3 fatty acid desaturase, chloroplast precursor - Ricinus| communis (Castor bean) Length = 460 Score = 30.0 bits (66), Expect = 2.9 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +1 Query: 19 HRDCGQHTIHRHSPR-PIYHPMEERQADKMPASAQHHDEHPKQQESPDEEVSSL 177 H D G H IH P+ P YH +E +A K P +++ E K P + SL Sbjct: 374 HHDIGTHVIHHLFPQIPHYHLVEATEAAK-PVMGKYYREPKKSGPLPLHLLGSL 426
>Q51ZN8:ATG2_MAGGR Autophagy-related protein 2 - Magnaporthe grisea (Rice blast| fungus) (Pyricularia grisea) Length = 2094 Score = 30.0 bits (66), Expect = 2.9 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 55 SPRPIYHPMEERQADKMPASAQHHDEHPKQQESPDEEVSSLSPT 186 SP PI P + + P S+ + H ++ +SP+E ++ PT Sbjct: 545 SPAPIIPPSSDGNTEAGPESSIQGERHDRKSQSPNECLTPREPT 588
>Q6EEF3:TTLL5_CERAE Tubulin--tyrosine ligase-like protein 5 - Cercopithecus aethiops| (Green monkey) (Grivet) Length = 1295 Score = 29.6 bits (65), Expect = 3.7 Identities = 20/57 (35%), Positives = 24/57 (42%), Gaps = 9/57 (15%) Frame = +1 Query: 34 QHTIHRHSPRPIYHPMEER-----QADKMPASAQHHDEHPKQQESP----DEEVSSL 177 Q R S RPIY E Q + P AQ H PKQ+ P D E+ +L Sbjct: 396 QDPAQRASTRPIYPTFESSRRNPFQKPQRPLPAQFHSSEPKQRSRPLSASDAEMKNL 452
>Q6BVY9:TIM50_DEBHA Import inner membrane translocase subunit TIM50, mitochondrial| precursor - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 471 Score = 29.3 bits (64), Expect = 4.9 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 325 FVPTCLYRRSNKTLGSLFPLLQVSVFQ 405 F P +Y R NK LGSLF VF+ Sbjct: 149 FAPNLMYGRLNKRLGSLFTFFSEPVFE 175
>Q68DN1:CB016_HUMAN Uncharacterized protein C2orf16 - Homo sapiens (Human)| Length = 1984 Score = 29.3 bits (64), Expect = 4.9 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = +1 Query: 16 SHRDCGQHTIHRHSPRPIYHPMEERQADKMPASAQHHDEHPKQQESPDE 162 SHR G HSP H R++ + P+ HH + SP E Sbjct: 1701 SHR--GPSERRHHSPSKRSHRSPARRSHRSPSERSHHSPSERSHHSPSE 1747
>Q9Z0R7:TS1R2_RAT Taste receptor type 1 member 2 precursor - Rattus norvegicus (Rat)| Length = 843 Score = 28.9 bits (63), Expect = 6.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 296 WTPASSSFASLCRLACTVGVIKRSAVYFPCC 388 +TP ++ S+C +C G +K+S PCC Sbjct: 488 YTPNNTVPVSMCSKSCQPGQMKKSVGLHPCC 518
>P48626:FAD3E_TOBAC Omega-3 fatty acid desaturase, endoplasmic reticulum - Nicotiana| tabacum (Common tobacco) Length = 379 Score = 28.9 bits (63), Expect = 6.4 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +1 Query: 19 HRDCGQHTIHRHSPR-PIYHPMEERQADKMPASAQHHDEHPKQQESPDEEVSSLS 180 H D G H IH P+ P YH E +A K P +++ E K P V L+ Sbjct: 294 HHDIGTHVIHHLFPQIPHYHLREATKAAK-PVLGKYYREPKKSGPIPFHLVKDLT 347
>P48625:FAD3E_SOYBN Omega-3 fatty acid desaturase, endoplasmic reticulum - Glycine max| (Soybean) Length = 380 Score = 28.9 bits (63), Expect = 6.4 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +1 Query: 19 HRDCGQHTIHRHSPR-PIYHPMEERQADKMPASAQHHDEHPKQQESP 156 H D G H IH P+ P YH +E QA K P ++ E + P Sbjct: 297 HHDIGTHVIHHLFPQIPHYHLVEATQAAK-PVLGDYYREPERSAPLP 342
>P48618:FAD3C_BRANA Omega-3 fatty acid desaturase, chloroplast precursor - Brassica| napus (Rape) Length = 404 Score = 28.9 bits (63), Expect = 6.4 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 19 HRDCGQHTIHRHSPR-PIYHPMEERQADKMPASAQHHDEHPKQQESP 156 H D G H IH P+ P YH +E +A K P +++ E K P Sbjct: 318 HHDIGTHVIHHLFPQIPHYHLVEATEAAK-PVLGKYYREPDKSGPLP 363
>P46310:FAD3C_ARATH Omega-3 fatty acid desaturase, chloroplast precursor - Arabidopsis| thaliana (Mouse-ear cress) Length = 446 Score = 28.9 bits (63), Expect = 6.4 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +1 Query: 19 HRDCGQHTIHRHSPR-PIYHPMEERQADKMPASAQHHDEHPKQQESP 156 H D G H IH P+ P YH +E +A K P +++ E K P Sbjct: 360 HHDIGTHVIHHLFPQIPHYHLVEATEAAK-PVLGKYYREPDKSGPLP 405
>Q571B6:WHDC1_MOUSE WH2 domain-containing protein 1 - Mus musculus (Mouse)| Length = 793 Score = 28.9 bits (63), Expect = 6.4 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = -3 Query: 86 SSMGW*IGRGLWR--WMVCWP 30 S GW +GRGLW W + WP Sbjct: 105 SGAGWGLGRGLWALLWPLLWP 125
>P58874:OPT_BOVIN Opticin precursor - Bos taurus (Bovine)| Length = 321 Score = 28.9 bits (63), Expect = 6.4 Identities = 23/70 (32%), Positives = 34/70 (48%) Frame = -3 Query: 395 ETCNKGNKLPSVLLLLRYKQVGTN*QSYSRLESTRSTERAKAKMSDEPSAAAFPPSAGLE 216 E + G++LP V GT+ S +R T+STE A+ S+ +A PP+ GL Sbjct: 57 ELIDYGDQLPQVK--------GTSLASLTRTRFTQSTEAARTLPSNPTTAR--PPTLGLL 106 Query: 215 ATDSRTSLAT 186 A + L T Sbjct: 107 AAPANHGLPT 116
>P20448:DBP4_YEAST ATP-dependent RNA helicase DBP4 - Saccharomyces cerevisiae (Baker's| yeast) Length = 770 Score = 28.5 bits (62), Expect = 8.4 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 79 MEERQADKMPASAQHHDEHPKQQESPDEEVSSLSPTVARLVRE 207 + E QAD +P S Q HD + + ++ L P + +L RE Sbjct: 64 LTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEKLYRE 106
>Q2TAC2:CCD57_HUMAN Coiled-coil domain-containing protein 57 - Homo sapiens (Human)| Length = 916 Score = 28.5 bits (62), Expect = 8.4 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +1 Query: 37 HTIHRHSPRPIYHPMEERQADKMPASAQHHDEHPKQQESPDEEVSSLSPTVARLV 201 HT+ SPR +E ++ K P + QH +EH +Q S S + RL+ Sbjct: 789 HTVTCKSPR-----QKEDRSPKPPQAPQHPEEHGRQSHSSSSFASGTLQDMWRLL 838
>Q9BYB0:SHAN3_HUMAN SH3 and multiple ankyrin repeat domains protein 3 - Homo sapiens| (Human) Length = 1741 Score = 28.5 bits (62), Expect = 8.4 Identities = 21/64 (32%), Positives = 29/64 (45%) Frame = -3 Query: 374 KLPSVLLLLRYKQVGTN*QSYSRLESTRSTERAKAKMSDEPSAAAFPPSAGLEATDSRTS 195 + PS L LR K + + LE S R K + DE AAA P+ + D+ + Sbjct: 684 RAPSTTLTLRSKSMT------AELEELASIRRRKGEKLDEMLAAAAEPTLRPDIADADSR 737 Query: 194 LATV 183 ATV Sbjct: 738 AATV 741
>Q28G88:FEZF2_XENTR Fez family zinc finger protein 2 - Xenopus tropicalis (Western| clawed frog) (Silurana tropicalis) Length = 435 Score = 28.5 bits (62), Expect = 8.4 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -3 Query: 290 STERAKAKMSDEPSAAAFPPSAGLE 216 S ER AK S EP AAAF PS GL+ Sbjct: 31 SIERIMAKTS-EPKAAAFQPSQGLD 54 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 51,612,310 Number of extensions: 855781 Number of successful extensions: 3403 Number of sequences better than 10.0: 25 Number of HSP's gapped: 3383 Number of HSP's successfully gapped: 25 Length of query: 141 Length of database: 100,686,439 Length adjustment: 102 Effective length of query: 39 Effective length of database: 72,708,349 Effective search space: 2835625611 Effective search space used: 2835625611 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)