| Clone Name | FLbaf104l13 |
|---|---|
| Clone Library Name | barley_pub |
>Q09502:YQH2_CAEEL Probable G-protein coupled receptor C43C3.2 - Caenorhabditis| elegans Length = 498 Score = 35.8 bits (81), Expect = 0.24 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = -2 Query: 759 PYV*RAPSITVEGMIDRQRSTRPATKYTEEGIGGAR*F*QMTHELGSSS 613 PY+ A + + G+++RQ P KYT G+GG QM+H L +++ Sbjct: 375 PYINSASNFILYGLLNRQLHNAPERKYTRNGVGGR----QMSHALTTNT 419
>Q6L3Z4:R1B12_SOLDE Putative late blight resistance protein homolog R1B-12 - Solanum| demissum (Wild potato) Length = 1348 Score = 35.0 bits (79), Expect = 0.41 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = +2 Query: 266 QVVVKLDLHDDRHKQKAIQVVSGLHGIDDIAVDMKDQKMTVIGTVD 403 ++V+K D +++ KA + L GI IAVD ++K VIG +D Sbjct: 1286 KMVLKFDTSNEKEISKAFDRLLSLPGIQSIAVDSNEKKFIVIGDMD 1331
>Q6L440:R1A3_SOLDE Putative late blight resistance protein homolog R1A-3 - Solanum| demissum (Wild potato) Length = 775 Score = 34.3 bits (77), Expect = 0.70 Identities = 13/46 (28%), Positives = 31/46 (67%) Frame = +2 Query: 266 QVVVKLDLHDDRHKQKAIQVVSGLHGIDDIAVDMKDQKMTVIGTVD 403 +++++ D+ D+ A + ++ L G+D I++DM ++K+TV G ++ Sbjct: 713 KMILQFDISHDKEIDNAFKRLASLPGVDSISIDMIEKKLTVGGDMN 758
>Q6L406:R1B19_SOLDE Putative late blight resistance protein homolog R1B-19 - Solanum| demissum (Wild potato) Length = 1326 Score = 32.3 bits (72), Expect = 2.7 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +2 Query: 275 VKLDLHDDRHKQKAIQVVSGLHGIDDIAVDMKDQKMTVIGTVD 403 +KL+L D KA + + GI+ ++ D K++K+TV G VD Sbjct: 1214 LKLNLSHDEDIPKAFKRLFLCPGIESVSTDRKEKKLTVTGDVD 1256
>Q5F3A1:SEC62_CHICK Translocation protein SEC62 - Gallus gallus (Chicken)| Length = 398 Score = 31.6 bits (70), Expect = 4.6 Identities = 12/35 (34%), Positives = 24/35 (68%) Frame = -1 Query: 250 KEENKMNKHEQSRN*SQKRERERERNPNSLDCKQE 146 KEE K +K E S++ K+E+E++++ +CK++ Sbjct: 119 KEEEKKSKKESSKDEKTKKEKEKKKDGEKEECKKD 153
>P79114:MYO10_BOVIN Myosin-X - Bos taurus (Bovine)| Length = 2052 Score = 31.2 bits (69), Expect = 5.9 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -1 Query: 259 RAIKEENKMNKHEQSRN*SQKRERERERNPNSLDCKQE 146 RA +E+ K + E+ + ++RERERER L +QE Sbjct: 816 RAEEEKRKREEEEKRKREEEERERERERREAELRAQQE 853 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 128,758,375 Number of extensions: 2731165 Number of successful extensions: 8693 Number of sequences better than 10.0: 6 Number of HSP's gapped: 8634 Number of HSP's successfully gapped: 6 Length of query: 299 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 187 Effective length of database: 69,965,399 Effective search space: 13083529613 Effective search space used: 13083529613 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)