| Clone Name | FLbaf96k18 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os10g26520:12010.t02064:unspliced-genomic protein kinase APK1B, chloroplast precursor, putative, expressed| Length = 5879 Score = 35.4 bits (71), Expect = 0.44 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +1 / +2 Query: 415 CDDRHECMRWCDFLTSSFFSVTYCVCVLPIWRVLTSGLIIP 537 CD H C L SS F V YC +LP+W S L +P Sbjct: 602 CDSLHTCELNGTDLASSCFYVCYC*VLLPLWVGAPSLLALP 724
>LOC_Os06g02040:12006.t00100:unspliced-genomic seed maturation protein, putative, expressed| Length = 677 Score = 35.4 bits (71), Expect = 0.44 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 / +3 Query: 183 RSHDEKELXXXXXXXXXXXXXXQLHQEKAAHREDAM 290 RSH E+EL +LHQ+KA HRE+A+ Sbjct: 210 RSHAERELAHERAKARVAAAKMELHQDKALHREEAI 317 Score = 33.1 bits (66), Expect = 2.1 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +1 / +1 Query: 217 AAPPRSLPLRRSCTRKRPRTARMP 288 A P S P R SCTR RP TAR P Sbjct: 244 ALRPGSPPPRWSCTRTRPSTARRP 315 Score = 31.3 bits (62), Expect = 7.5 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 / -1 Query: 287 GILAVRGLFLVQLRLSGSD 231 G+LAV GL LVQL L G D Sbjct: 314 GLLAVEGLVLVQLHLGGGD 258
>LOC_Os11g16400:12011.t01420:unspliced-genomic expressed protein| Length = 3801 Score = 34.5 bits (69), Expect = 0.82 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 / +2 Query: 226 PRSLPLRRSCTRKRPRTARMPWR 294 P S P RR C R RP T+ PW+ Sbjct: 3317 PTSPPSRRRCRRSRPSTSSSPWK 3385
>LOC_Os02g56260:12002.t05199:unspliced-genomic expressed protein| Length = 3624 Score = 34.5 bits (69), Expect = 0.82 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 / -3 Query: 217 AAPPRSLPLRRSCTRKRPRTARMPWR 294 A+PPR+ P RR C R+R R A P R Sbjct: 112 ASPPRAPPSRRPCRRRRTRPASPPVR 35
>LOC_Os09g16240:12009.t01411:unspliced-genomic expressed protein| Length = 6966 Score = 30.4 bits (60), Expect(2) = 1.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 / -2 Query: 346 RGRRWPLIYTQPALASTC 399 R RRW I T PALA+ C Sbjct: 452 RSRRWETILTMPALAAQC 399 Score = 26.3 bits (51), Expect(2) = 1.1 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 / -2 Query: 247 RSCTRKRPRTARMPWR 294 R+C R RPRTA P R Sbjct: 5969 RACRRTRPRTAAAPRR 5922
>LOC_Os07g46940:12007.t04330:unspliced-genomic sex determination protein tasselseed-2, putative, expressed| Length = 1318 Score = 33.6 bits (67), Expect = 1.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 / -1 Query: 244 RRSCTRKRPRTARMPWR 294 R +CT +RPR AR PWR Sbjct: 454 RSACTTRRPRRARRPWR 404
>LOC_Os01g50860:12001.t04520:unspliced-genomic chloride channel protein CLC-e, putative, expressed| Length = 4909 Score = 29.5 bits (58), Expect(2) = 2.0 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -3 / -3 Query: 539 SGIIKPDVSTRQIGKTQTQYVTEKKEEVRKS 447 +G IKP +ST K QYV+E EV K+ Sbjct: 4688 AGAIKPHISTCAKLKALQQYVSELHSEVNKT 4596 Score = 25.8 bits (50), Expect(2) = 2.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 / -3 Query: 412 THDIRTWRQALAVCISVATGAPCVW 338 TH + + +SV+T APCVW Sbjct: 3356 THSELSSLHRSVIGLSVSTEAPCVW 3282
>LOC_Os03g05550:12003.t00427:unspliced-genomic hypothetical protein| Length = 693 Score = 33.1 bits (66), Expect = 2.1 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 / -1 Query: 600 SLYLCVCPPNPLDSEGPKSEI*GLLF 677 +L+LC+CPP P D++ KS I +L+ Sbjct: 198 ALFLCLCPPAPTDTKKRKSYIRVILY 121
>LOC_Os07g42420:12007.t03894:unspliced-genomic 3-oxoacyl-synthase I, chloroplast precursor, putative, expressed| Length = 5660 Score = 33.1 bits (66), Expect = 2.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 / -3 Query: 600 KGHTHASMQCRQPGQLSSHH 541 KGH S CR+P L SHH Sbjct: 2058 KGHKMGSFSCRRPSMLQSHH 1999
>LOC_Os10g13694:12010.t003607:unspliced-genomic expressed protein| Length = 6924 Score = 32.7 bits (65), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 / -3 Query: 426 AVVTSHTTYARGGKRWLCVYQWPPAPPVFGI 334 AV T +A GG R C QW APP+ + Sbjct: 238 AVAAIATAHAEGGHRGRCRSQWGRAPPLLAV 146
>LOC_Os07g03770:12007.t00266:unspliced-genomic homeobox protein rough sheath 1, putative, expressed| Length = 6124 Score = 32.7 bits (65), Expect = 2.9 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 / +3 Query: 223 PPRSLPLRRSCTRKRPRTAR 282 PPR+ R CTR+RPR AR Sbjct: 297 PPRTTARRSPCTRRRPRLAR 356
>LOC_Os06g19610:12006.t01780:unspliced-genomic steroid dehydrogenase SPM2, putative| Length = 1804 Score = 32.7 bits (65), Expect = 2.9 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 / +3 Query: 220 APPRSLPLRRSCTRKRPRTARMP 288 A P LP RR C R+RP T R P Sbjct: 12 AHPAGLPRRRPCRRRRPPTRRHP 80
>LOC_Os04g56240:12004.t05096:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 3672 Score = 32.7 bits (65), Expect = 2.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 / +1 Query: 223 PPRSLPLRRSCTRKRPRTARMPW 291 PPR P RR+ R +PR R PW Sbjct: 499 PPRRRPRRRARVRPQPRQQRPPW 567
>LOC_Os01g52670:12001.t04693:unspliced-genomic expressed protein| Length = 777 Score = 32.7 bits (65), Expect = 2.9 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -2 / +2 Query: 576 QCRQPGQLSSHHLRDN*ARRKYAPNRQNTNTV 481 +CR+PG +HH R + A RK P+ + T+ Sbjct: 422 RCRRPGFAGAHH*RQHHAERKTRPDHRLARTI 517
>LOC_Os03g37110:12003.t03172:unspliced-genomic hypothetical protein| Length = 2291 Score = 29.9 bits (59), Expect(2) = 3.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 / -1 Query: 549 RRAGLAVCIAWMHVYVPSLYLCVCPPNPL 635 RRAGL IAW + C CP PL Sbjct: 635 RRAGLLAIIAWPPTLLAGRPPCRCPRQPL 549 Score = 23.5 bits (45), Expect(2) = 3.2 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +3 / -1 Query: 375 TASACLHVRMS 407 TASACLHV S Sbjct: 698 TASACLHVESS 666
>LOC_Os09g39180:12009.t03384:unspliced-genomic ribonucleoprotein, chloroplast precursor, putative, expressed| Length = 2553 Score = 32.2 bits (64), Expect = 4.0 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = +1 / +3 Query: 223 PPRSLPLRRSCTRKRPRTARMPWR 294 PPRS RRS TRKR T R P R Sbjct: 297 PPRSPTCRRSLTRKRRGTRRRPRR 368
>LOC_Os09g16200:12009.t01407:unspliced-genomic conserved hypothetical protein| Length = 7040 Score = 32.2 bits (64), Expect = 4.0 Identities = 21/74 (28%), Positives = 30/74 (40%) Frame = -2 / +1 Query: 570 RQPGQLSSHHLRDN*ARRKYAPNRQNTNTVRH*KERRSEKITPPHAFMAVVTSHTTYARG 391 R PG+ ++ D RR+ P + V S ++ AF + H RG Sbjct: 5932 RFPGRRTT*AASDRRRRRRSLPELHVVSRV*TGVSHGSPQLHAVRAFAFLARVHPFPRRG 6111 Query: 390 GKRWLCVYQWPPAP 349 G RW V PP+P Sbjct: 6112 GARWSSVRVPPPSP 6153
>LOC_Os06g04670:12006.t00357:unspliced-genomic CCR4-NOT transcription complex subunit 8, putative, expressed| Length = 1008 Score = 32.2 bits (64), Expect = 4.0 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +1 / -3 Query: 220 APPRSLPLRRSCTRKRPRTAR 282 APPR P RR C R+R RT R Sbjct: 835 APPRRAPGRRGCRRRRRRTWR 773
>LOC_Os03g10650:12003.t00866:unspliced-genomic cyclin delta-3, putative, expressed| Length = 2517 Score = 32.2 bits (64), Expect = 4.0 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 / -1 Query: 648 VPLNRGG*EDTRINRGKGHTHASMQCRQPGQLSSHHLR 535 +PL RG E+ ++G+ H ++ RQP + + HLR Sbjct: 1197 LPLERGEDEELHPHQGRAVVHVQLELRQPRRPALLHLR 1084
>LOC_Os09g30060:12009.t02684:unspliced-genomic hypothetical protein| Length = 806 Score = 25.4 bits (49), Expect(2) = 4.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 / -1 Query: 603 GKGHTHASMQCRQPGQLS 550 G GH H S CR P L+ Sbjct: 188 GDGHHHRSRCCRTPSHLA 135 Score = 24.0 bits (46), Expect(2) = 4.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 / -1 Query: 447 TPPHAFMAVVTSHTT 403 TP H +A++TSH T Sbjct: 152 TPSHLAVAILTSHLT 108
>LOC_Os01g28660:12001.t02559:unspliced-genomic hypothetical protein| Length = 5809 Score = 24.9 bits (48), Expect(2) = 4.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 / -1 Query: 609 NRGKGHTHASMQCRQPGQLS 550 +R GH H S CR P L+ Sbjct: 2209 DRSHGHHHHSCCCRTPSHLA 2150 Score = 24.0 bits (46), Expect(2) = 4.9 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -2 / -1 Query: 447 TPPHAFMAVVTSHTT 403 TP H +A++TSH T Sbjct: 2167 TPSHLAVAILTSHPT 2123
>LOC_Os08g43190:12008.t04044:unspliced-genomic sorbitol dehydrogenase, putative, expressed| Length = 2551 Score = 31.8 bits (63), Expect = 5.5 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 / -2 Query: 217 AAPPRSLPLRRSCTRKRPRTARMPWR 294 +APP RR TR RPR+A WR Sbjct: 1608 SAPPSPARRRRGGTRARPRSAARTWR 1531
>LOC_Os06g43840:12006.t04074:unspliced-genomic protein kinase domain containing protein, expressed| Length = 5956 Score = 31.8 bits (63), Expect = 5.5 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 / -2 Query: 220 APPRSLPLRRSCTRKRPRTARMP 288 APPR+ P R C R+R +R P Sbjct: 483 APPRAAPTRSGCRRRRTAASRRP 415
>LOC_Os02g47790:12002.t04363:unspliced-genomic monodehydroascorbate reductase, cytoplasmic isoform 2, putative,| expressed Length = 2454 Score = 31.8 bits (63), Expect = 5.5 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 / -3 Query: 217 AAPPRSLPLRRSCTRKRPRTARMPW 291 A PRS L R C R+ TAR PW Sbjct: 1945 ARGPRSARLPRRCRRRTATTARRPW 1871
>LOC_Os02g32530:12002.t02896:unspliced-genomic SAM domain family protein, expressed| Length = 4430 Score = 31.8 bits (63), Expect = 5.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 / +2 Query: 220 APPRSLPLRRSCTRKRPRTARMPWR 294 +PP +P R R+RP R PWR Sbjct: 1562 SPPTGVPRSRRRRRRRPTRTRKPWR 1636
>LOC_Os01g05610:12001.t00445:unspliced-genomic histone H2B.1, putative, expressed| Length = 973 Score = 31.8 bits (63), Expect = 5.5 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 / -1 Query: 511 VLTSGLIIPEMMRGELAWLSALHGCMCMSLP 603 +L GL++ ++RG L HGC C LP Sbjct: 148 LLRRGLLLRGLLRGRLLLCLGRHGCRCCLLP 56
>LOC_Os05g28120:12005.t02462:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10294 Score = 27.6 bits (54), Expect(2) = 6.5 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 / -2 Query: 554 SWPGCLHCMDACVC 595 SW G L+C AC+C Sbjct: 9396 SWTGTLNCQLACIC 9355 Score = 26.7 bits (52), Expect(2) = 6.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 / -3 Query: 603 LYLCVCPPNPLDSEGPKSE 659 LY CVCP N + + G SE Sbjct: 5246 LYSCVCPSNVVCTTGEHSE 5190
>LOC_Os09g12840:12009.t01074:unspliced-genomic conserved hypothetical protein| Length = 2121 Score = 28.1 bits (55), Expect(2) = 7.4 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 / -3 Query: 217 AAPPRSLPLRRSCTRKRPRTAR 282 A PP P SCTR+RPR R Sbjct: 1972 ARPPPCTPPCGSCTRRRPR*TR 1907 Score = 24.0 bits (46), Expect(2) = 7.4 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +1 / -2 Query: 427 HECMRWCDFLTS 462 H C RWC L S Sbjct: 1466 HRCRRWCGVLPS 1431
>LOC_Os04g02650:12004.t00158:unspliced-genomic expressed protein| Length = 2742 Score = 31.3 bits (62), Expect = 7.5 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +1 Query: 561 LAVCIAWMHVYVPSLYLCVC 620 L V I +++ YVP +Y CVC Sbjct: 2575 LGVYIRYLYTYVPHMYACVC 2634
>LOC_Os08g41760:12008.t03905:unspliced-genomic F-box domain containing protein, expressed| Length = 1396 Score = 31.3 bits (62), Expect = 7.6 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 / -3 Query: 223 PPRSLPLRRSCTRKRPRTARMP 288 P R+ P RRS TR+RPR R P Sbjct: 548 PRRAPPTRRSPTRRRPRWRRAP 483
>LOC_Os07g37510:12007.t03420:unspliced-genomic carbohydrate transporter/ sugar porter, putative| Length = 1614 Score = 31.3 bits (62), Expect = 7.6 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 / -3 Query: 220 APPRSLPLRRSCTRKRPRTARMPWR 294 A P S RR+C R+RPR R P R Sbjct: 973 AAPISTAARRTCRRRRPRRRRPPQR 899
>LOC_Os06g47890:12006.t04475:unspliced-genomic adagio protein 1, putative, expressed| Length = 5086 Score = 31.3 bits (62), Expect = 7.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 / -3 Query: 223 PPRSLPLRRSCTRKRPRTARMPW 291 PP P RR C R+RP PW Sbjct: 293 PPPPPPRRRRCCRRRPTRCPTPW 225
>LOC_Os03g26530:12003.t02338:unspliced-genomic acyltransferase, putative, expressed| Length = 2005 Score = 31.3 bits (62), Expect = 7.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / -1 Query: 226 PRSLPLRRSCTRKRPRTAR 282 PR P RR C R+RPR R Sbjct: 574 PRCTPSRRGCRRRRPRACR 518
>LOC_Os02g34080:12002.t03049:unspliced-genomic XIB, putative, expressed| Length = 21889 Score = 25.4 bits (49), Expect(2) = 7.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / +3 Query: 566 CLHCMDACVCPFPLF 610 CL+C +AC C LF Sbjct: 18618 CLYCFNACRCFISLF 18662 Score = 22.6 bits (43), Expect(2) = 7.8 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +1 / +2 Query: 421 DRHECMRWC 447 +RH C WC Sbjct: 18488 ERHHCTNWC 18514 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 217,499,038 Number of extensions: 3345341 Number of successful extensions: 19317 Number of sequences better than 10.0: 34 Length of query: 240 Length of database: 55,613,886 Length adjustment: 49 Effective length of query: 191 Effective length of database: 52,856,264 Effective search space: 10095546424 Effective search space used: 10095546424 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)