ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf103k23 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os06g36390:12006.t03335:unspliced-genomic expressed protein| Length = 2077 Score = 68.0 bits (142), Expect(4) = 7e-18 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 / +2 Query: 375 RTGLSKYYKGKSQSFTSLSDVKCLQDLAKKTTARVCR 485 RTGLSKYY+GKSQSFTSL + +C+QDLAKKTT + R Sbjct: 1055 RTGLSKYYQGKSQSFTSLCNARCVQDLAKKTTPYITR 1165 Score = 29.9 bits (59), Expect(4) = 7e-18 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 / +3 Query: 586 QEHGAGAFLSEAVNHLLTRARKSC 657 QE G+ + + A HL RARKSC Sbjct: 1293 QEQGSTSLFTAAAAHLHNRARKSC 1364 Score = 29.5 bits (58), Expect(4) = 7e-18 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 / +1 Query: 497 LIDFASCSRTFQQDDSEE 550 +++FAS SR QQDD EE Sbjct: 1207 VVEFASRSRALQQDDGEE 1260 Score = 25.4 bits (49), Expect(4) = 7e-18 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 / +2 Query: 349 RRCWRTFPSG 378 RRCWR+F SG Sbjct: 533 RRCWRSFLSG 562 Score = 60.2 bits (125), Expect(5) = 9e-17 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -3 / -2 Query: 469 VVFFARSCKHLTSDRDVKDWDFPL*YLDSPVL 374 VVFFARS HL DVKDWDFP *YLDSPVL Sbjct: 1149 VVFFARSWTHLALQSDVKDWDFPW*YLDSPVL 1054 Score = 33.6 bits (67), Expect(5) = 9e-17 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 / -2 Query: 550 FFAIVLLKGPGA*SEIDER 494 FFAIVLL+GPGA E D R Sbjct: 1260 FFAIVLLQGPGARREFDNR 1204 Score = 26.3 bits (51), Expect(5) = 9e-17 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -1 / -3 Query: 657 TTLSCSGKQVVYRF*EKGPCSMLLTAPGPKNPWAPTSSLSSC 532 T LSCS QV E+ +LLTA + +P+S S C Sbjct: 1364 TALSCSVVQVCCCCCEEACAPLLLTAIDRTSTSSPSSPSSCC 1239 Score = 23.5 bits (45), Expect(5) = 9e-17 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -2 / -2 Query: 218 GHDRRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDHAFTSSTSFAYTVLPH 66 G RR +R R + + GRR + AAG+ + S+S + + H Sbjct: 339 GQARRRRRPQRRRRRRIAAGEPGRRRLAVAAGSSSNTTLISSSSSSSYPAH 187 Score = 22.6 bits (43), Expect(5) = 9e-17 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 / -2 Query: 362 RQQRRQLVEWPA 327 +Q+RRQLVE PA Sbjct: 543 QQRRRQLVERPA 508 Score = 46.4 bits (95), Expect(3) = 7e-11 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +2 / +1 Query: 374 QDRAV*VLQREVPVLHISVRRQMLARSRKEDH 469 QDRA+ VL REVP+LHI+++RQ+ R KED+ Sbjct: 1054 QDRAIQVLPREVPILHIALQRQVRPRPCKEDN 1149 Score = 29.0 bits (57), Expect(3) = 7e-11 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = +3 / +2 Query: 495 RSSISLHAPGPFSKTIAKK 551 R S S APGP SKT+AKK Sbjct: 1205 RLSNSRRAPGPCSKTMAKK 1261 Score = 28.1 bits (55), Expect(3) = 7e-11 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +2 / +1 Query: 533 QDDSEEVGAHGFFGPGAVKSMEQGPFSQKR*TTCLPEQERVVQ 661 Q D E G AVKS SQ++ TC EQER V+ Sbjct: 1240 QQDDGEEGDEVLVRSIAVKSKGAQASSQQQQHTCTTEQERAVK 1368 Score = 57.4 bits (119), Expect(2) = 7e-10 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = -2 / -1 Query: 485 PADAGGGLLCEILQAFDVGQRCEGLGLPFVVLRQPCP 375 P D G LLC++L A V +RCEGLGLP VVL PCP Sbjct: 1165 PGDVRGCLLCKVLDAPGVAERCEGLGLPLVVLG*PCP 1055 Score = 25.8 bits (50), Expect(2) = 7e-10 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 / -1 Query: 557 RQLLRYRLAERSWSMKRNR 501 R+LLR+RLA WS R R Sbjct: 1267 RRLLRHRLAAGPWSATRIR 1211 Score = 39.1 bits (79), Expect(2) = 4e-04 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = +1 / +3 Query: 373 SGQGCLSTTKGSPSPSHLCPTSNACKISQ 459 +GQG STTKGSP+PSH T A K Q Sbjct: 1053 TGQGYPSTTKGSPNPSHRSATPGASKTLQ 1139 Score = 24.4 bits (47), Expect(2) = 4e-04 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = +3 / +2 Query: 549 KLAPMGSSGRGPSRAWSRGLSLRSGKPPAYQSKKEL 656 K A SS R SRA S PA QSKKEL Sbjct: 1256 KKATRCSSDRLLSRAREHKPLHSSSSTPAQQSKKEL 1363
>LOC_Os02g13370:12002.t05465:unspliced-genomic expressed protein| Length = 1776 Score = 63.4 bits (132), Expect(4) = 9e-16 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = +3 / +2 Query: 375 RTGLSKYYKGKSQSFTSLSDVKCLQDLAKKTTARVCRKASRS 500 R GLS YY+GKSQSFTS+SD C+QDLAKK T KA +S Sbjct: 959 RRGLSNYYQGKSQSFTSISDATCVQDLAKKITYNKRMKACKS 1084 Score = 29.9 bits (59), Expect(4) = 9e-16 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +3 / +3 Query: 312 LEGDGGGPLYELSPLLAHLPVR 377 L+ D GPL +LS L+A LP+R Sbjct: 354 LQLDSEGPLCDLSSLIAQLPIR 419 Score = 29.0 bits (57), Expect(4) = 9e-16 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 / +1 Query: 533 QDDSEEVGAHGFFGPGAVKSMEQGPFSQKR*TTCLPEQER 652 Q D E AVK+ + P Q+ *TT PEQER Sbjct: 1138 QQDDSEEALERIIYLSAVKTKQHQPPVQQC*TTYTPEQER 1257 Score = 22.1 bits (42), Expect(4) = 9e-16 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 / +1 Query: 512 SCSRTFQQDDSEE 550 S ++ QQDDSEE Sbjct: 1120 SLAKAMQQDDSEE 1158 Score = 54.7 bits (113), Expect(3) = 7e-10 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = -3 / -1 Query: 490 AFLQTRAVVFFARSCKHLTSDRDVKDWDFPL*YLDSPVL 374 AF+ V+FFARS H+ SD DV DWDFP * LDSP+L Sbjct: 1074 AFILLL*VIFFARS*THVASDIDVNDWDFPW**LDSPLL 958 Score = 26.7 bits (52), Expect(3) = 7e-10 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -3 / -3 Query: 208 DEHSDPLDAPESK 170 DEH DP+D PE + Sbjct: 262 DEHDDPMDEPEKE 224 Score = 24.4 bits (47), Expect(3) = 7e-10 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -2 / -3 Query: 653 LFLALVSRWFTAS 615 +FLALV RWF+ + Sbjct: 1258 IFLALVCRWFSTA 1220 Score = 37.3 bits (75), Expect(2) = 0.006 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -2 / -3 Query: 494 ARLPADAGGGLLCEILQAFDVGQRCEGLGLPFVVLRQPCP 375 ARL G LC++L + RCE LG V++ QP P Sbjct: 1078 ARLHPLIVGNFLCKVLNTCSIRYRCE*LGFSLVIVGQPSP 959 Score = 22.1 bits (42), Expect(2) = 0.006 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 / -2 Query: 651 LSCSGKQVVYRF*EKGPCSMLLTA 580 LSCSG VV G C ++LTA Sbjct: 1256 LSCSGV*VV*HCCTGGWCCLVLTA 1185 Score = 30.9 bits (61), Expect(2) = 0.008 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +2 / +1 Query: 374 QDRAV*VLQREVPVLHISVRRQMLARSRKEDHRPRLQEG 490 Q+RAV +L R++P++HI + M + KE++ EG Sbjct: 958 QERAVQLLPRKIPIIHIDI*CYMCSGPCKENYLQ*EDEG 1074 Score = 28.1 bits (55), Expect(2) = 0.008 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 / +2 Query: 585 SRAWSRGLSLRSGKPPAYQSKKEL 656 SR S L S KPP +QSKK++ Sbjct: 1190 SRPSSTSLLCSSAKPPTHQSKKDV 1261
>LOC_Os01g53730:12001.t04792:unspliced-genomic expressed protein| Length = 1520 Score = 59.3 bits (123), Expect = 3e-08 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +3 / +3 Query: 375 RTGLSKYYKGKSQSFTSLSDVKCLQDLAKKTTARVCRKASRSSISL 512 R GLSKYY GKSQSF +S+V+CL+DL KK K+S+S ++L Sbjct: 447 RKGLSKYYDGKSQSFACMSEVRCLEDLRKKENPYKKIKSSKSYVAL 584 Score = 44.6 bits (91), Expect = 8e-04 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -3 / -2 Query: 463 FFARSCKHLTSDRDVKDWDFPL*YLDSPVL 374 F RS +HLTSD KD DFP *YLD+P L Sbjct: 535 FLRRSSRHLTSDIHAKD*DFPS*YLDNPFL 446
>LOC_Os01g53720:12001.t04791:unspliced-genomic expressed protein| Length = 7247 Score = 59.3 bits (123), Expect = 3e-08 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +3 / -1 Query: 375 RTGLSKYYKGKSQSFTSLSDVKCLQDLAKKTTARVCRKASRSSISL 512 R GLSKYY GKSQSF +S+V+CL+DL KK K+S+S ++L Sbjct: 6803 RKGLSKYYDGKSQSFACMSEVRCLEDLRKKENPYKKIKSSKSYVAL 6666 Score = 44.6 bits (91), Expect(2) = 7e-04 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -3 / +1 Query: 463 FFARSCKHLTSDRDVKDWDFPL*YLDSPVL 374 F RS +HLTSD KD DFP *YLD+P L Sbjct: 6715 FLRRSSRHLTSDIHAKD*DFPS*YLDNPFL 6804 Score = 23.5 bits (45), Expect(2) = 7e-04 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 / +2 Query: 678 LAYHVYCTTLSCSGKQVVY 622 LA HVY + SG VVY Sbjct: 4844 LASHVYRFVMHVSGSNVVY 4900
>LOC_Os05g44900:12005.t03978:unspliced-genomic expressed protein| Length = 1296 Score = 54.2 bits (112), Expect = 1e-06 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = +3 / +1 Query: 375 RTGLSKYYKGKSQSFTSLSDVKCLQDLAKK 464 R GLS+YY+GKSQSF +S+V+CL+DL KK Sbjct: 706 RKGLSRYYEGKSQSFACMSEVRCLEDLRKK 795 Score = 50.1 bits (103), Expect = 2e-05 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -3 / -2 Query: 463 FFARSCKHLTSDRDVKDWDFPL*YLDSPVL 374 F RS +HLTSD DWDFP *YLD+P L Sbjct: 794 FLRRSSRHLTSDMHANDWDFPS*YLDNPFL 705 Score = 32.2 bits (64), Expect = 4.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 / +2 Query: 373 SGQGCLSTTKGSPSPSHLCPTSNACKI 453 +G+GC TT+GSPS S C A +I Sbjct: 704 AGKGCPGTTRGSPSRSRACRR*GAWRI 784
>LOC_Os04g49370:12004.t04453:unspliced-genomic expressed protein| Length = 1560 Score = 45.1 bits (92), Expect = 6e-04 Identities = 21/41 (51%), Positives = 27/41 (65%) Frame = +3 / +1 Query: 357 LAHLPVRTGLSKYYKGKSQSFTSLSDVKCLQDLAKKTTARV 479 L L R GLSK++ GKSQSF SL+ V L+D+AK R+ Sbjct: 502 LLRLCCRRGLSKFFDGKSQSFASLAAVGGLEDMAKPMRKRL 624
>LOC_Os02g45930:12002.t04180:unspliced-genomic expressed protein| Length = 1222 Score = 44.6 bits (91), Expect = 8e-04 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = +3 / +1 Query: 375 RTGLSKYYKGKSQSFTSLSDVKCLQDLAKKTTARV 479 R GLS+++ GKSQSF SL+ V L+DLAK R+ Sbjct: 559 RRGLSRFFDGKSQSFASLAAVASLEDLAKPPRKRL 663 Score = 32.2 bits (64), Expect = 4.3 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 / -3 Query: 460 FARSCKHLTSDRDVKDWDFPL*YLDSPVL 374 FARS T+ D D DFP LD+P+L Sbjct: 644 FARSSSEATAASDANDCDFPSKNLDNPLL 558
>LOC_Os02g48640:12002.t04448:unspliced-genomic expressed protein| Length = 3506 Score = 43.7 bits (89), Expect = 0.002 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -2 / +1 Query: 218 GHDRRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDH 111 GH RR R+A RA AG H+ G +P G DDH Sbjct: 253 GHVRRGARAAARARAAAGDHQRGAAALPRGGGGDDH 360
>LOC_Os05g24650:12005.t02122:unspliced-genomic expressed protein| Length = 1377 Score = 34.5 bits (69), Expect(2) = 0.037 Identities = 20/74 (27%), Positives = 35/74 (47%) Frame = +3 / +2 Query: 414 SFTSLSDVKCLQDLAKKTTARVCRKASRSSISLHAPGPFSKTIAKKLAPMGSSGRGPSRA 593 S TS S + ++ R R+ + S+ + +P P + A++ P ++ R P RA Sbjct: 428 SRTSGSSTTATRRRRRRRGRRGSRRGATSACAPPSPSPTCRRRARRRPPPPAADRRPRRA 607 Query: 594 WSRGLSLRSGKPPA 635 G + R+ PPA Sbjct: 608 APAGTTWRARTPPA 649 Score = 22.1 bits (42), Expect(2) = 0.037 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 / +3 Query: 307 CSWKGTAAGHSTSCRR 354 CSW TAA S S R Sbjct: 267 CSWTPTAAPSSPSAAR 314
>LOC_Os06g03710:12006.t00263:unspliced-genomic DELLA protein SLR1, putative, expressed| Length = 3102 Score = 39.1 bits (79), Expect = 0.037 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +3 / +3 Query: 438 KCLQDLAKKTTARVCRKASRSSISLHAPGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLR 617 +C + + C S S+ S + G + T + + GS+GR SRAW RG LR Sbjct: 1686 RCGYSTPSRPSRGSCTSRSTSASSASSRGTSASTSSTSTSSRGSNGRACSRAWPRGRCLR 1865
>LOC_Os08g04390:12008.t00334:unspliced-genomic bHLH transcription factor, putative, expressed| Length = 5003 Score = 29.9 bits (59), Expect(3) = 0.041 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = +2 / +2 Query: 419 HISVRRQMLARSRKEDHRPRLQEGEPL 499 H+S+ ++ + +K +H P L +G+PL Sbjct: 4853 HLSLNNEVEEKRKKIEHEPPLMQGQPL 4933 Score = 28.1 bits (55), Expect(3) = 0.041 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 / +3 Query: 184 RPADRCARRSCPA 222 RPA RC RR CPA Sbjct: 2895 RPACRCRRRRCPA 2933 Score = 23.1 bits (44), Expect(3) = 0.041 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +1 / +2 Query: 307 CSWKGTAAGHSTSCRRCWRTFPS 375 CSW RR WR PS Sbjct: 3398 CSWSEDPTRRWACRRRSWRRTPS 3466
>LOC_Os03g27370:12003.t02413:unspliced-genomic phospholipase D alpha 1, putative, expressed| Length = 5495 Score = 37.7 bits (76), Expect = 0.095 Identities = 18/38 (47%), Positives = 20/38 (52%) Frame = -2 / +1 Query: 221 AGHDRRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDHA 108 AG +RR R A R + G HR G R A GAD HA Sbjct: 2083 AGGERRRPRPAVRQAVCDGGHRQGPRRADAHGGADGHA 2196
>LOC_Os01g53570:12001.t04776:unspliced-genomic ALMT1, putative, expressed| Length = 2500 Score = 29.5 bits (58), Expect(2) = 0.12 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 / +1 Query: 343 SCRRCWRTFPSGQGCLSTTKGSPS 414 S RRCW + S GC + T PS Sbjct: 322 SWRRCWCSSASPSGCSAPTSSGPS 393 Score = 25.4 bits (49), Expect(2) = 0.12 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 / +1 Query: 178 PARPADRCARRSC 216 P+RPA RC+ R C Sbjct: 298 PSRPASRCSWRRC 336
>LOC_Os01g65000:12001.t05867:unspliced-genomic ammonium transporter 2, putative, expressed| Length = 2362 Score = 37.3 bits (75), Expect = 0.13 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +1 / +2 Query: 337 STSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPT 435 S+S RCW S +GC S+ GSPSP+ P+ Sbjct: 467 SSSPARCWGG*TSRRGCCSSRSGSPSPTPSAPS 565
>LOC_Os11g12420:12011.t01129:unspliced-genomic protein Z, putative, expressed| Length = 1945 Score = 29.5 bits (58), Expect(2) = 0.22 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +1 / +2 Query: 307 CSWKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 C W+ TA+ +TSC R + P G P PS P++ Sbjct: 581 CPWRRTASAAATSCSRRCPSTPRSPWSPPARGGPPWPSCSPPSA 712 Score = 28.1 bits (55), Expect(2) = 0.22 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +3 / +2 Query: 456 AKKTTARVCRKASRSSISLHAPGPFSKTIAKKLAPMGSSGRGP 584 A+ ++ CR+++ S S +PG S + A SG GP Sbjct: 1415 ARSSSGSTCRRSASRSASSGSPGSSSPSTAASRPRSRVSGSGP 1543
>LOC_Os09g32330:12009.t02848:unspliced-genomic MTD1, putative, expressed| Length = 2129 Score = 34.5 bits (69), Expect(2) = 0.24 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +3 / +2 Query: 375 RTGLSKYYKGKSQSFTSLSD 434 R GLS +Y GKS+SFTSL++ Sbjct: 1349 RRGLSNFYAGKSKSFTSLAE 1408 Score = 23.1 bits (44), Expect(2) = 0.24 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 / +1 Query: 319 GTAAGHSTSCRRCWRT 366 G G + CRR WRT Sbjct: 226 GGGGGGARPCRRRWRT 273
>LOC_Os01g53810:12001.t04798:unspliced-genomic transferrin receptor-like dimerisation domain containing protein,| expressed Length = 4142 Score = 36.3 bits (73), Expect = 0.25 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 / +2 Query: 307 CSWKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNACK 450 C W G +T RRC R G+ +GS + + CP S C+ Sbjct: 782 CRWGPCTTGTATRPRRCGRPAQPGRTASG*ARGSSTGAPRCPASQRCR 925
>LOC_Os12g04170:12012.t00307:unspliced-genomic plastidic phosphate translocator-like protein1, putative, expressed| Length = 1445 Score = 35.9 bits (72), Expect = 0.34 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 / +2 Query: 187 PADRCARRSCPA*QTTTTTPSLP 255 P+ RC+RRSCP+ T + +PS P Sbjct: 566 PSSRCSRRSCPSPSTPSPSPSAP 634
>LOC_Os03g39520:12003.t03385:unspliced-genomic conserved hypothetical protein| Length = 2589 Score = 35.9 bits (72), Expect = 0.34 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +1 / +2 Query: 313 WKGTAAGHSTSCRRCWRTFPSGQGCLSTTKG 405 W T S+SCRR RT SGQ C + +G Sbjct: 1370 WPSTCRSFSSSCRRLARTVASGQRCRGSRQG 1462
>LOC_Os03g30650:12003.t02670:unspliced-genomic hypothetical protein| Length = 1626 Score = 35.0 bits (70), Expect(2) = 0.34 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = -2 / +2 Query: 218 GHDRRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDHAFTS 99 GH A+R R +AG +R GRR V A ADD A S Sbjct: 695 GHSTDARRPRRRGADRAGGNRRGRRSVRREAQADDPAAPS 814 Score = 21.7 bits (41), Expect(2) = 0.34 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 / +3 Query: 431 GQRCEGLGLPFVVLRQPCPDGKVRQQRRQLVEWPA 327 GQR P LRQ P+ + RR L W A Sbjct: 396 GQRPSRRYRPLHALRQQHPEPRHPTGRRDLGTWLA 500
>LOC_Os06g41030:12006.t03798:unspliced-genomic secreted protein, putative, expressed| Length = 5158 Score = 35.4 bits (71), Expect = 0.46 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 / +3 Query: 146 RVVPAAAGADDHAFTSSTSFAYTVLPHETWA 54 +VVP AF TSF TVLP TWA Sbjct: 1428 KVVPVFCAEKPEAFDDGTSFRQTVLPWTTWA 1520
>LOC_Os08g01150:12008.t00015:unspliced-genomic lipopolysaccharide-modifying protein, putative, expressed| Length = 5254 Score = 35.4 bits (71), Expect = 0.47 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -1 / +2 Query: 582 APGPKNPWAPTSSLSSC*KVLEHEAKSMSGSPSCRRGRWSSLR 454 AP P+ W T+S ++C + + SP CR WS R Sbjct: 4556 APSPRTTWPWTTSTTTCCTCSRATPRCSATSPPCRTAPWSCAR 4684
>LOC_Os02g10800:12002.t00928:unspliced-genomic protein brittle-1, chloroplast precursor, putative, expressed| Length = 2250 Score = 35.4 bits (71), Expect = 0.47 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 / -3 Query: 307 CSWKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPS 414 C W A + RR WR P+G+G S + SPS Sbjct: 631 CGWSPAAPRRCATRRRRWRRSPAGEGAGSRSSPSPS 524
>LOC_Os07g49430:12007.t04570:unspliced-genomic transposon protein, putative, unclassified| Length = 5706 Score = 29.0 bits (57), Expect(3) = 0.50 Identities = 14/61 (22%), Positives = 25/61 (40%) Frame = +3 / -1 Query: 399 KGKSQSFTSLSDVKCLQDLAKKTTARVCRKASRSSISLHAPGPFSKTIAKKLAPMGSSGR 578 +G S + TS ++V+C + +R C + + +S T+ MG G Sbjct: 2841 RGISLTGTSSAEVRCFLEARDAEASRACGSVATARLSARCSAQARATLTSPKTVMGPLGP 2662 Query: 579 G 581 G Sbjct: 2661 G 2659 Score = 25.4 bits (49), Expect(3) = 0.50 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 / -3 Query: 6 RYHTPHFVACLVHVSLG 56 R H PHFV VH+ +G Sbjct: 4882 RCHAPHFVDICVHLWVG 4832 Score = 23.1 bits (44), Expect(3) = 0.50 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +3 / -3 Query: 579 GPSRAWSRGLSLRSGKP 629 GP R W RG G+P Sbjct: 955 GPQRCWIRGPPRGRGRP 905
>LOC_Os03g13400:12003.t01134:unspliced-genomic zinc finger, C2H2 type family protein, expressed| Length = 4103 Score = 33.1 bits (66), Expect(2) = 0.58 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 / -3 Query: 516 APGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPPA 635 A G ++ A+ AP G + R PSRA R G+PPA Sbjct: 4002 AAGTRGRSPARSGAPRGPAARAPSRAPRAPGGARGGRPPA 3883 Score = 24.0 bits (46), Expect(2) = 0.58 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 / -1 Query: 625 NHLLTRARKSCAVDMIC*L 681 +HL+T+ K+ A+D+I *L Sbjct: 3377 HHLITKHNKNTAIDLID*L 3321
>LOC_Os12g07160:12012.t00600:unspliced-genomic viral A-type inclusion protein repeat containing protein, expressed| Length = 6848 Score = 35.0 bits (70), Expect = 0.64 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 / +3 Query: 328 AGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCP 432 A H SCR WR +P + LS S P+ +CP Sbjct: 315 ASHGESCRWWWRPWPGPRAFLSPPLLSSPPAPICP 419
>LOC_Os11g04380:12011.t00331:unspliced-genomic plastidic phosphate translocator-like protein1, putative, expressed| Length = 1589 Score = 31.8 bits (63), Expect(2) = 0.82 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 / +3 Query: 187 PADRCARRSCPA*QTTTTTPSLP 255 P+ RC+RRSCP+ T + + S P Sbjct: 528 PSSRCSRRSCPSPSTPSPSRSAP 596 Score = 23.5 bits (45), Expect(2) = 0.82 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = +1 / +3 Query: 352 RCWRTFPSGQGCLSTTKGSPSPSHLCPTSNACKISQ 459 RC T S +GC P P+ C C S+ Sbjct: 831 RCHGTSSSCRGCAPPRAPPPGPTCSCSGRTRCARSR 938
>LOC_Os08g40510:12008.t03781:unspliced-genomic KID-containing protein, putative, expressed| Length = 1764 Score = 34.5 bits (69), Expect = 0.88 Identities = 13/20 (65%), Positives = 17/20 (85%) Frame = +3 / +1 Query: 375 RTGLSKYYKGKSQSFTSLSD 434 R GLS +Y GKS+SFTSL++ Sbjct: 1093 RRGLSNFYAGKSKSFTSLAE 1152
>LOC_Os11g05760:12011.t00467:unspliced-genomic lysosomal Pro-X carboxypeptidase precursor, putative, expressed| Length = 5668 Score = 34.5 bits (69), Expect = 0.88 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 / -1 Query: 310 SWKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSP 417 +W+GTAA T R CWRT C T +P P Sbjct: 418 AWRGTAAPPPT*NRCCWRTARRRPRCRRTRTPAPPP 311
>LOC_Os04g46630:12004.t04192:unspliced-genomic beta-expansin 2 precursor, putative, expressed| Length = 1923 Score = 34.5 bits (69), Expect = 0.88 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +1 / +3 Query: 307 CSWKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNACK 450 CS +G +G T R C R PS + SP+ S L S AC+ Sbjct: 1425 CSSRGAPSGS*TPARHCRRRSPSASRPAPARRSSPATSSLPGGSPACR 1568
>LOC_Os03g18990:12003.t01666:unspliced-genomic conserved hypothetical protein| Length = 1710 Score = 34.5 bits (69), Expect = 0.88 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 / +1 Query: 187 PADRCARRSCPA*QTTTTTPSLP 255 P+ RC+R SCP+ T +++PS P Sbjct: 979 PSSRCSRHSCPSPSTPSSSPSTP 1047
>LOC_Os03g12180:12003.t01017:unspliced-genomic topoisomerase, putative, expressed| Length = 2668 Score = 34.5 bits (69), Expect = 0.88 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 C RC T +G+ C + SPSP+ CP++ Sbjct: 685 CPRCTATSSTGRRCTRGSASSPSPATTCPST 777
>LOC_Os01g57620:12001.t05165:unspliced-genomic expressed protein| Length = 870 Score = 34.5 bits (69), Expect = 0.88 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 / +3 Query: 313 WKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPS 420 W GT+ G T+CR WR P + C S+ P S Sbjct: 30 WTGTSGGC*TACRSPWRPSPPPRCCSSSATRPPPAS 137
>LOC_Os04g38910:12004.t03461:unspliced-genomic atypical receptor-like kinase MARK, putative, expressed| Length = 2511 Score = 26.7 bits (52), Expect(2) = 0.95 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +1 / -3 Query: 178 PARPADRCARRS 213 P RPA RCARRS Sbjct: 2116 PRRPAARCARRS 2081 Score = 24.9 bits (48), Expect(2) = 0.95 Identities = 12/42 (28%), Positives = 17/42 (40%) Frame = +1 / -2 Query: 313 WKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 W GT S + R S GCL ++ + S H T+ Sbjct: 2063 WSGTVTVQSIASRSISTISSSAPGCLRSSVSNTSDVHSSRTT 1938
>LOC_Os01g14890:12001.t01343:unspliced-genomic expressed protein| Length = 2161 Score = 29.0 bits (57), Expect(2) = 0.96 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 / +1 Query: 349 RRCWRTFPSGQGCLSTTKGSPSPS 420 R C PS +GC ST G SPS Sbjct: 1444 RTCCSPAPSSRGCSSTAPGWASPS 1515 Score = 22.6 bits (43), Expect(2) = 0.96 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 / +1 Query: 181 ARPADRCARRSCPA 222 +R A RC R CPA Sbjct: 1393 SRRARRCTGRGCPA 1434
>LOC_Os02g07930:12002.t00689:unspliced-genomic B-box zinc finger family protein, expressed| Length = 1475 Score = 25.8 bits (50), Expect(2) = 0.98 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 / +3 Query: 319 GTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSP 417 G A G + RR WR SG GC + P Sbjct: 576 GGAGGVPRARRRFWRGGRSGWGCRRARRAGAPP 674 Score = 25.8 bits (50), Expect(2) = 0.98 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = +3 / +3 Query: 504 ISLHAPGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPP 632 ++ AP P + P + RG S W RG R +PP Sbjct: 786 VAAAAPAPDRPRCSGGWRPARTCRRGCS*RWRRGWRARRRRPP 914
>LOC_Os10g39120:12010.t03154:unspliced-genomic ubiquitin-conjugating enzyme E2-18 kDa, putative, expressed| Length = 3411 Score = 34.1 bits (68), Expect = 1.2 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -2 / +1 Query: 482 ADAGGGLLCEILQAFDVGQRCEGLGLPFVVL 390 A GG+ C + QA G RC GLG P V+L Sbjct: 2155 AVTNGGIHC*LGQAPGCGLRCPGLGAPLVIL 2247
>LOC_Os01g16020:12001.t01452:unspliced-genomic geranylgeranyl hydrogenase, putative, expressed| Length = 1614 Score = 34.1 bits (68), Expect = 1.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 / -3 Query: 218 GHDRRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDH 111 GH +RA R GR G +AG H R V H Sbjct: 175 GHPQRAPRRRGRGGARAGDHEARRGVAGGGGDGGGH 68
>LOC_Os04g44850:12004.t04023:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 1918 Score = 34.1 bits (68), Expect = 1.2 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +1 / +2 Query: 322 TAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 T AG + S R RT S L+TT PSP + PTS Sbjct: 1187 TPAGRARSTRSGRRTTCSAAAALATTSSPPSPDNAGPTS 1303
>LOC_Os03g51790:12003.t04511:unspliced-genomic GTP binding protein, putative, expressed| Length = 16903 Score = 27.2 bits (53), Expect(3) = 1.3 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 / +2 Query: 561 MGSSGRGPSRAWSRGLSLRSGKP 629 M + RGP R W RG G+P Sbjct: 13310 MPPTSRGPRRRWGRGSPQGRGRP 13378 Score = 25.8 bits (50), Expect(3) = 1.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 / +3 Query: 181 ARPADRCARRSCPA*QTTTTTPSLP 255 A P+ CAR S P TTTT P Sbjct: 57 APPSPACARTSTPTLTPTTTTAYPP 131 Score = 25.8 bits (50), Expect(3) = 1.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 / +3 Query: 504 ISLHAPGPFSKTIA 545 ++LH PGP S T+A Sbjct: 5778 LTLHTPGPISPTVA 5819
>LOC_Os12g35070:12012.t03195:unspliced-genomic hypothetical protein| Length = 709 Score = 27.6 bits (54), Expect(2) = 1.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 / +1 Query: 218 GHDRRAQRSAGRAGIKAGSHRLGR 147 GH R +R AG G G HR R Sbjct: 634 GHGHRGRRGAGHRGDDQGGHRQHR 705 Score = 25.8 bits (50), Expect(2) = 1.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 / +2 Query: 497 AARLPADAGGGLLCEILQAFD 435 AARLPA G L +L+ FD Sbjct: 515 AARLPAARRPGALTRVLEVFD 577
>LOC_Os07g13090:12007.t01179:unspliced-genomic hypothetical protein| Length = 1239 Score = 33.6 bits (67), Expect = 1.7 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 / -3 Query: 358 WRTFPSGQGCLSTTKGSPSPSHLCPTSNAC 447 WRT PSGQ T SPSPS + +C Sbjct: 283 WRTRPSGQSARRTDAASPSPSPPVNAAASC 194
>LOC_Os12g37650:12012.t03445:unspliced-genomic expressed protein| Length = 1128 Score = 27.6 bits (54), Expect(2) = 1.8 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +1 / +2 Query: 322 TAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNA 444 T G C R +GC +GSP+ S L TS++ Sbjct: 176 TTCGRRRRCTSATRPGRRRRGCCWRRRGSPAASSLSATSSS 298 Score = 23.1 bits (44), Expect(2) = 1.8 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +3 / +3 Query: 558 PMGSSGRGPSRAWSRGLSLRSGKPPAYQSKKE 653 P+ GR P + RGL R PP +++ Sbjct: 354 PLLRQGRPPRQLRRRGLRRRREGPPPQDHRRQ 449
>LOC_Os02g44310:12002.t04021:unspliced-genomic cortical cell-delineating protein precursor, putative, expressed| Length = 838 Score = 31.3 bits (62), Expect(2) = 2.0 Identities = 17/38 (44%), Positives = 19/38 (50%) Frame = +1 / +2 Query: 331 GHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNA 444 G STS RRC PSG +T SPS S T+ A Sbjct: 359 GSSTSRRRCASARPSGATSSESTSTSPSTSASSSTTAA 472 Score = 21.7 bits (41), Expect(2) = 2.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 / +1 Query: 211 SCPA*QTTTTTPSLP 255 SCP +T TPS P Sbjct: 181 SCPTPTPSTPTPSTP 225
>LOC_Os06g49660:12006.t04650:unspliced-genomic taxadien-5-alpha-ol O-acetyltransferase, putative, expressed| Length = 1654 Score = 30.4 bits (60), Expect(2) = 2.1 Identities = 17/57 (29%), Positives = 23/57 (40%) Frame = +3 / +2 Query: 480 CRKASRSSISLHAPGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPPAYQSKK 650 C R + + HAPG S A A SG P+R S G P +S++ Sbjct: 830 CASTRRRASAAHAPGSSSSRRASGAAARRRSGTPPARRCGSPSS*TPGAAPTCRSRR 1000 Score = 23.5 bits (45), Expect(2) = 2.1 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 / +2 Query: 307 CSWKGTAAGHST 342 CSW+GT G T Sbjct: 683 CSWRGTRRGRRT 718
>LOC_Os05g39600:12005.t03501:unspliced-genomic ATCHX15, putative, expressed| Length = 3273 Score = 28.6 bits (56), Expect(2) = 2.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 / +1 Query: 196 RCARRSCPA*QTTTTT 243 RC RRSCP+* ++T T Sbjct: 946 RCCRRSCPS*ASSTRT 993 Score = 26.3 bits (51), Expect(2) = 2.1 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 / +3 Query: 331 GHSTSCRRCWRTFPSGQGCLSTTKGSPSPS 420 G ++S RCWR+ + C ST S S Sbjct: 2283 GSASSTARCWRSRRAPSRCSSTATPGASAS 2372
>LOC_Os01g69290:12001.t06282:unspliced-genomic expressed protein| Length = 1809 Score = 29.0 bits (57), Expect(2) = 2.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / -3 Query: 553 WRPWVLRAGGRQEHGAGAFL 612 W PW R GGR + G G+ L Sbjct: 208 WTPWEWRGGGRGKGGVGSEL 149 Score = 24.9 bits (48), Expect(2) = 2.3 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = +1 / -2 Query: 319 GTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPT 435 G AG S RC + + SPSPS P+ Sbjct: 686 GVGAGPPDSATRCAAASGKSEDSTAAASPSPSPSSPSPS 570
>LOC_Os09g27500:12009.t02428:unspliced-genomic cytochrome P450 76C1, putative, expressed| Length = 2985 Score = 33.1 bits (66), Expect = 2.3 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 / +1 Query: 215 HDRRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDHA 108 H R A G++AG+ R GRRVVP A HA Sbjct: 2206 HHARPGVVASPGGVRAGALRRGRRVVPRRRDAGVHA 2313
>LOC_Os08g41560:12008.t03885:unspliced-genomic ubiquitin carboxyl-terminal hydrolase 1, putative, expressed| Length = 3355 Score = 33.1 bits (66), Expect = 2.3 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 / -3 Query: 336 LYELSPLLAHLPVRTGLSKYYKGKSQSFTSLSDVKCLQD 452 LY+ SP+ A PV+T L ++ + + T S KC Q+ Sbjct: 1154 LYQASPMEAERPVQTSLPAAFQAQGGTATPHSSSKCFQN 1038
>LOC_Os05g41700:12005.t03707:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5631 Score = 33.1 bits (66), Expect = 2.3 Identities = 22/71 (30%), Positives = 31/71 (43%) Frame = +3 / -3 Query: 375 RTGLSKYYKGKSQSFTSLSDVKCLQDLAKKTTARVCRKASRSSISLHAPGPFSKTIAKKL 554 RTGL+ + S TSL L KT A CRK + +S L + P + + Sbjct: 2218 RTGLAPGRTARRCSITSLGTPGMSAGLQAKTAAFACRKETSASSYLSSRRPPIRVVLDGP 2039 Query: 555 APMGSSGRGPS 587 +P +S G S Sbjct: 2038 SPRATSLTGTS 2006
>LOC_Os02g33420:12002.t02985:unspliced-genomic ATPase, AAA family protein, expressed| Length = 4552 Score = 33.1 bits (66), Expect = 2.3 Identities = 19/73 (26%), Positives = 32/73 (43%) Frame = +3 / +1 Query: 369 PVRTGLSKYYKGKSQSFTSLSDVKCLQDLAKKTTARVCRKASRSSISLHAPGPFSKTIAK 548 P T L Y + + S + V D + +CR+ S++ + APG IA+ Sbjct: 526 PKETALRTYGRDMTGSAAAADPVIGRDDEVDRVVCILCRRTKNSAVLVGAPGVGKTAIAE 705 Query: 549 KLAPMGSSGRGPS 587 LA ++G P+ Sbjct: 706 GLARRVAAGDVPA 744
>LOC_Os06g21590:12006.t01976:unspliced-genomic chlorophyll a-b binding protein 6A, chloroplast precursor,| putative, expressed Length = 1530 Score = 33.1 bits (66), Expect = 2.3 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +1 / +3 Query: 319 GTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 G A +CR CWR +G C S P + CP S Sbjct: 141 G*GAAARWACRACWRRRRTGAACRSAPTPPPPGASPCPPS 260
>LOC_Os04g39680:12004.t03536:unspliced-genomic anthranilate phosphoribosyltransferase-like protein, putative,| expressed Length = 2790 Score = 33.1 bits (66), Expect = 2.3 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +1 / +1 Query: 313 WKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCP 432 W T + C RCWR G+ S SP PS P Sbjct: 2404 WSATWRRRGSGCGRCWRGGTRGRRRCSRRPASPPPSWRTP 2523
>LOC_Os03g45860:12003.t03958:unspliced-genomic OsSAUR17 - Auxin-responsive SAUR gene family member| Length = 321 Score = 33.1 bits (66), Expect = 2.3 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 / -2 Query: 166 PALIPARPADRCARRSCPA*QTTTTTPSLP 255 P P R A RR CPA Q T +TP P Sbjct: 308 PPAAPLRSAHSTTRRKCPASQGTRSTPGWP 219
>LOC_Os02g29510:12002.t02644:unspliced-genomic non-imprinted in Prader-Willi/Angelman syndrome region protein 1,| putative, expressed Length = 11896 Score = 33.1 bits (66), Expect = 2.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 / -2 Query: 355 CWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 C ++FP CLS P+ SH+C T+ Sbjct: 1566 CGKSFPKADCCLSDNALQPASSHICSTN 1483
>LOC_Os01g47560:12001.t04204:unspliced-genomic OsWRKY16 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 4574 Score = 33.1 bits (66), Expect = 2.3 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 / -1 Query: 343 SCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNACK 450 +C R W + P G G + SP S C S++CK Sbjct: 3704 ACPRTW*SPPPGPGTTAPPASSPGTSASCTCSSSCK 3597
>LOC_Os06g10940:12006.t00971:unspliced-genomic conserved hypothetical protein| Length = 411 Score = 25.4 bits (49), Expect(2) = 2.6 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +3 / +3 Query: 483 RKASRSSISLHAPGPFSKTIAKKLAPMGSSGRGPSRA 593 R +R+ L APG ++ A+ P SSG P +A Sbjct: 216 RACARARRRLVAPGAHARREARHAQPRRSSGDTPRQA 326 Score = 24.9 bits (48), Expect(2) = 2.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 / +2 Query: 316 KGTAAGHSTSCRRCWRT 366 +G G STSCR W T Sbjct: 77 RGWMTGRSTSCRSRWPT 127
>LOC_Os09g12590:12009.t01048:unspliced-genomic sugar transport protein 1, putative, expressed| Length = 1554 Score = 30.9 bits (61), Expect(2) = 2.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 / +2 Query: 337 STSCRRCWRTFPSGQGCLSTTKGSPSPSHLC 429 ST+ RR WR S C ++ GSP+ + C Sbjct: 377 STARRRTWRCSSSAASCSASASGSPTRACRC 469 Score = 22.6 bits (43), Expect(2) = 2.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 / +2 Query: 558 PMGSSGRGPSRAWSRGLSLRSGKPPA 635 P G S +RAW+ S + PPA Sbjct: 713 PGGCSSACAARAWTWRTSTTTWSPPA 790
>LOC_Os07g47210:12007.t04357:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 2344 Score = 32.7 bits (65), Expect = 3.1 Identities = 19/42 (45%), Positives = 22/42 (52%) Frame = -2 / +3 Query: 218 GHDRRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDHAFTSST 93 G RRA R+AG AG G R GRR AA G + T +T Sbjct: 1920 GSRRRAWRAAGTAGRTTGWCRAGRRRACAATGRATCSGTRTT 2045
>LOC_Os06g48500:12006.t04536:unspliced-genomic expressed protein| Length = 2104 Score = 32.7 bits (65), Expect = 3.1 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 / +3 Query: 375 RTGLSKYYKGKSQSFTSLSDV 437 R GLS ++ GKS+SF +L DV Sbjct: 1086 RRGLSNFFSGKSRSFANLQDV 1148
>LOC_Os02g47480:12002.t04332:unspliced-genomic expressed protein| Length = 11852 Score = 32.7 bits (65), Expect = 3.1 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 / -2 Query: 333 PLYELSPLLAHLPVRTGLSKYYKGKSQSFTSLSDVK 440 P+++L P+ A LP GLS+ Y + + TSL+ K Sbjct: 4060 PVFDLPPVTARLPRLPGLSRGYSNINTAVTSLNSNK 3953
>LOC_Os02g07920:12002.t00688:unspliced-genomic expressed protein| Length = 2735 Score = 32.7 bits (65), Expect = 3.1 Identities = 19/60 (31%), Positives = 26/60 (43%) Frame = +3 / +2 Query: 465 TTARVCRKASRSSISLHAPGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPPAYQS 644 T + C A S S A P +T + A + R +RGLSLRS + P+ S Sbjct: 398 TLSGSCSSARLRSASPRARAPTRRTTTPRSAALARPSRARPYPRARGLSLRSSRRPSAPS 577
>LOC_Os01g07160:12001.t00596:unspliced-genomic F-box domain containing protein| Length = 1332 Score = 32.7 bits (65), Expect = 3.1 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +3 / -3 Query: 573 GRGPSRAWSRGLS 611 GRGPSRAWSR LS Sbjct: 358 GRGPSRAWSRSLS 320
>LOC_Os08g32730:12008.t03016:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3785 Score = 32.7 bits (65), Expect = 3.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1782 CRRCWASTTSPPACLRRRRAVPPPTRL 1862 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 180 CRRCWASTTSPPACLRRRRVVPPPTRL 260 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 269 CRRCWASTTSPPACLRRRRVVPPPTRL 349 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 447 CRRCWASTTSPPACLRRRRVVPPPTRL 527 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 803 CRRCWASTTSPPACLRRRRVVPPPTRL 883 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 892 CRRCWASTTSPPACLRRRRVVPPPTRL 972 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1693 CRRCWASTTSPPACLRRRRVVPPPTRL 1773
>LOC_Os06g16700:12006.t01543:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4620 Score = 32.7 bits (65), Expect = 3.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 158 CRRCWASTTSPPACLRRRRAVPPPTRL 238 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 518 CRRCWASTSSPSACLRRRRLVPPPTRL 598 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 607 CRRCWASTSSPSACLRRRRLVPPPTRL 687 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 785 CRRCWASTTSPPACLRRRRVVPPPTRL 865 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1676 CRRCWASTTSPPACLRRRRVVPPPTRL 1756
>LOC_Os05g45600:12005.t04048:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3671 Score = 32.7 bits (65), Expect = 3.1 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 / +3 Query: 343 SCRRCWRTFPSGQGCLSTTKGSPSPSHL 426 SCRRCW + S CL + P P+ L Sbjct: 1206 SCRRCWASTTSPPACLRRRRLVPPPTRL 1289 Score = 32.2 bits (64), Expect = 4.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + + P P+ L Sbjct: 496 CRRCWASTTSPPACLRSRRVVPPPTRL 576 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2 CRRCWASTTSPPACLRCRRVVPPPTRL 82 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 853 CRRCWASTTSPPACLRRRRVVPPPTRL 933 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 942 CRRCWASTTSPPACLRRRRVVPPPTRL 1022 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1298 CRRCWASTTSPPACLRRRRVVPPPTRL 1378 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2407 CRRCWASTTSPPACLRRRRVVPPPTRL 2487 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2496 CRRCWASTTSPPACLRRRRVVPPPTRL 2576
>LOC_Os04g01600:12004.t00058:unspliced-genomic glyoxylate reductase, putative, expressed| Length = 4379 Score = 32.7 bits (65), Expect = 3.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 / +1 Query: 166 PALIPARPADRCARRSC 216 P L P+ PA RC+RRSC Sbjct: 3928 PTLTPSSPATRCSRRSC 3978
>LOC_Os01g74440:12001.t06722:unspliced-genomic DNA binding protein, putative| Length = 627 Score = 28.6 bits (56), Expect(2) = 3.8 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 / +2 Query: 313 WKGTAAGHSTSCRRCWR 363 W G++ G + SC R WR Sbjct: 320 WSGSSTGSTASCARWWR 370 Score = 23.1 bits (44), Expect(2) = 3.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 / +2 Query: 570 SGRGPSRAWSRGLSLRSGKPP 632 S R P+R + SL +G+PP Sbjct: 521 SPRAPTRCCATRSSLAAGRPP 583
>LOC_Os03g10800:12003.t00881:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 5556 Score = 27.2 bits (53), Expect(2) = 3.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 / -2 Query: 534 KTIAKKLAPMGSSGRGPSRAWSRGLS 611 +T +LAP SSG PS A +R LS Sbjct: 4955 RTALCRLAPSSSSGEPPSSASTRRLS 4878 Score = 22.1 bits (42), Expect(2) = 3.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 / -3 Query: 462 KTTARVCRKASRSSISLHAPG 524 ++T CRK + S L APG Sbjct: 5089 ESTENSCRKLTLHSSRLRAPG 5027
>LOC_Os04g08290:12004.t00699:unspliced-genomic zinc finger, C2H2 type family protein| Length = 4681 Score = 26.3 bits (51), Expect(2) = 4.0 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 / -1 Query: 524 SWSMKRNR*AARLPADAGGGLLCEILQAFDVGQR 423 SW + R A R PA GGG L+ +G+R Sbjct: 2848 SWRRRGTRWARRRPAARGGGTARRRLRHHRLGRR 2747 Score = 23.1 bits (44), Expect(2) = 4.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 / -1 Query: 389 RQPCPDGKVRQQRRQL 342 R P P G R++RRQL Sbjct: 2653 RWPAPAGAPRRRRRQL 2606
>LOC_Os12g35260:12012.t03214:unspliced-genomic hypothetical protein| Length = 780 Score = 32.2 bits (64), Expect = 4.3 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 / +3 Query: 209 RRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDH 111 RR QR G + G HR+ R A AG DH Sbjct: 9 RRRQRGGGAQRVGGGEHRVPHRDGGAVAGVGDH 107
>LOC_Os07g09530:12007.t00827:unspliced-genomic protein binding protein, putative| Length = 3199 Score = 32.2 bits (64), Expect = 4.3 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = -2 / +3 Query: 206 RAQRSAGRAGIKAGSHRLGRRVVPAAAGADDHAFTSSTS 90 R+ RS R G + S R RR AAG A T+STS Sbjct: 2658 RSSRSTSRGGARTSSCRRWRRTSRCAAGGRAPAATTSTS 2774
>LOC_Os07g08729:12007.t00747:unspliced-genomic ATP-dependent DNA helicase 2 subunit 1, putative, expressed| Length = 11043 Score = 32.2 bits (64), Expect = 4.3 Identities = 20/61 (32%), Positives = 27/61 (44%) Frame = +3 / -3 Query: 462 KTTARVCRKASRSSISLHAPGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPPAYQ 641 K+ AR R S H P P +K+ A L S PSRA R +++ PP + Sbjct: 7741 KSHARDHRSVSFPFSFAHRPSPSAKSPAAALTASPSHVAPPSRASLRKIAVAQPSPPTIR 7562 Query: 642 S 644 S Sbjct: 7561 S 7559
>LOC_Os06g03940:12006.t00285:unspliced-genomic spastin, putative, expressed| Length = 7687 Score = 32.2 bits (64), Expect = 4.3 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 / -1 Query: 531 SKTIAKKLAPMGSSGRGPSRAWSRGLSLR 617 S T KL P G GP AW+RGL +R Sbjct: 2797 SYT*IPKLTPTRRGGTGPRAAWARGLLVR 2711
>LOC_Os04g02920:12004.t00186:unspliced-genomic protein binding protein, putative, expressed| Length = 6223 Score = 32.2 bits (64), Expect = 4.3 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 / -1 Query: 212 DRRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDHAFTSS 96 +RR +R+ AG R VV AAA A DHAF ++ Sbjct: 322 ERRERRAVDGAGDAGLDQRQRHHVVAAAAAAADHAFPAA 206
>LOC_Os03g11270:12003.t00927:unspliced-genomic hypothetical protein| Length = 1125 Score = 32.2 bits (64), Expect = 4.3 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +3 / -3 Query: 516 APGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPPAYQSKK 650 AP P S+T + P GSS R + A + R G PP +S++ Sbjct: 913 APAPRSRTSTWRATPGGSSRRASTPAVAARRRRRRGDPPRRRSRR 779
>LOC_Os02g17690:12002.t01562:unspliced-genomic hypothetical protein| Length = 2610 Score = 32.2 bits (64), Expect = 4.3 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 / +1 Query: 557 RQLLRYRLAERSWSMKRNR*AARLPADAGGGLLCEILQAFD 435 RQL+R R ER WS N+ + RL + GG + E + D Sbjct: 2371 RQLIRNRKPERVWSDTINQESGRLESRGGGSTVGECKEEAD 2493
>LOC_Os01g64290:12001.t05797:unspliced-genomic expressed protein| Length = 1608 Score = 25.4 bits (49), Expect(2) = 4.3 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +3 / +2 Query: 474 RVCRKASRSSISLHAPGPFSKTIAKKLAPMGSSGRGPSRAWSR 602 R CR S ++ P S+ A G+ R P R W R Sbjct: 749 RCCRATSPAAPPHRRPASPSRRRATSRTTTGARWRRPGRRWCR 877 Score = 24.0 bits (46), Expect(2) = 4.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 / +2 Query: 579 GPSRAWSRGLSLRSGKPPAYQSKKELC 659 G SR R SLR+ KPP ++ C Sbjct: 914 GHSRVCRRSSSLRAPKPPLPPFRRLCC 994
>LOC_Os12g28760:12012.t02586:unspliced-genomic hypothetical protein| Length = 507 Score = 32.2 bits (64), Expect = 4.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 / +1 Query: 352 RCWRTFPSGQGCLSTTKGSPSPSHLCP 432 R W ++PS + C +T SP+P L P Sbjct: 118 RRWSSWPSAKNCATTAAPSPAPRSLSP 198
>LOC_Os11g47250:12011.t04200:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5529 Score = 32.2 bits (64), Expect = 4.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1942 CRRCWASTTSPPACLRRRRVDPPPTRL 2022 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1675 CRRCWASTTSPPACLRRRRVVPPPTRL 1755 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1764 CRRCWASTTSPPACLRRRRVVPPPTRL 1844 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2031 CRRCWASTTSPPACLRRRRVVPPPTRL 2111 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2120 CRRCWASTTSPPACLRRRRVVPPPTRL 2200 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3156 CRRCWASTTSPPACLRRRRVVPPPTRL 3236 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3334 CRRCWASTTSPPACLRRRRVVPPPTRL 3414
>LOC_Os10g34490:12010.t02745:unspliced-genomic organic anion transporter, putative| Length = 1060 Score = 32.2 bits (64), Expect = 4.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 / +3 Query: 187 PADRCARRSCPA*QTTTTTPSLP 255 P+ RC+RRSCP+ T + + S P Sbjct: 603 PSSRCSRRSCPSSSTASPSRSAP 671
>LOC_Os10g11150:12010.t00916:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1440 Score = 32.2 bits (64), Expect = 4.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 359 CRRCWASTTSPPACLRCRRVDPPPTRL 439 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2 CRRCWASTTSPPACLRRRRVVPPPTRL 82 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 180 CRRCWASTTSPPACLRCRRVVPPPTRL 260 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1337 CRRCWASTTSPSACLRRRRLVPPPTRL 1417
>LOC_Os09g35860:12009.t03064:unspliced-genomic ras-related protein Rab11A, putative, expressed| Length = 1945 Score = 32.2 bits (64), Expect = 4.3 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 / +3 Query: 504 SMSGSPSCRRGRWSSLR 454 S SPSCR GRWSS R Sbjct: 1599 SRRSSPSCRAGRWSSTR 1649
>LOC_Os09g25550:12009.t02234:unspliced-genomic expressed protein| Length = 3548 Score = 32.2 bits (64), Expect = 4.3 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 / -2 Query: 334 HSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNACKISQ 459 H +CR + F SGQG TT P+H T+ IS+ Sbjct: 379 HHPACRSAGQPFGSGQGHRLTTPDRTIPAHHSKTAKQTAISE 254
>LOC_Os07g10840:12007.t00958:unspliced-genomic stachyose synthase precursor, putative, expressed| Length = 3575 Score = 32.2 bits (64), Expect = 4.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 / -1 Query: 361 RTFPSGQGCLSTTKGSPSPSHLCPTSNA 444 R FPS G ++T GSPSP P+ A Sbjct: 827 RNFPSSSGSITTNTGSPSPPPSWPSPAA 744
>LOC_Os06g40540:12006.t03750:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2394 Score = 32.2 bits (64), Expect = 4.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P+P+ L Sbjct: 1503 CRRCWASTTSPPACLRRRRVVPTPTRL 1583
>LOC_Os06g35440:12006.t03241:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 3821 Score = 32.2 bits (64), Expect = 4.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 649 CRRCWASTTSPPACLRRRRVDPPPTRL 569 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 560 CRRCWASTTSPPACLRRRRVVPPPTRL 480 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 471 CRRCWASTTSPPACLRRRRVVPPPTRL 391 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 382 CRRCWASTTSPPACLRRRRVVPPPTRL 302 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 293 CRRCWASTTSPPACLRRRRVVPPPTRL 213
>LOC_Os06g14940:12006.t01368:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1426 Score = 32.2 bits (64), Expect = 4.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P+P+ L Sbjct: 792 CRRCWASTTSPPACLRRRRVVPTPTRL 872 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 436 CRRCWASTTSPPACLRRRRVVPPPTRL 516
>LOC_Os03g56850:12003.t04950:unspliced-genomic pentatricopeptide repeat protein PPR986-12, putative, expressed| Length = 3258 Score = 32.2 bits (64), Expect = 4.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 / +1 Query: 313 WKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPS 420 W+GT A S+S RC RT P + + S SP+ Sbjct: 469 WRGTTAPRSSSTSRCGRTPPRRSRTATPSPTSSSPA 576
>LOC_Os03g42480:12003.t03652:unspliced-genomic expressed protein| Length = 6787 Score = 32.2 bits (64), Expect = 4.3 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 / -2 Query: 187 PADRCARRSCPA*QTTTTTPSLP 255 P+ RC+RRSCP+ T + + S P Sbjct: 3009 PSSRCSRRSCPSPSTASPSRSAP 2941
>LOC_Os07g07070:12007.t00586:unspliced-genomic anthranilate phosphoribosyltransferase-like protein, putative,| expressed Length = 3892 Score = 28.1 bits (55), Expect(2) = 4.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 / +2 Query: 215 HDRRAQRSAGRAGIKAGSHRLGRRVVPAAAG 123 H R +RSA + A R GRR V AA G Sbjct: 2159 HRRGVRRSAAAVAVAATGRRQGRRRVLAADG 2251 Score = 25.8 bits (50), Expect(2) = 4.4 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -2 / +1 Query: 407 LPFVVLRQPCPDGKVRQQRRQLVEWPAAV 321 LP ++ P P + R++RR+ + PAAV Sbjct: 601 LPMLLRPMPTPRRRRRRKRRKHYQLPAAV 687
>LOC_Os10g28550:12010.t02206:unspliced-genomic conserved hypothetical protein| Length = 2759 Score = 29.0 bits (57), Expect(2) = 4.4 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / -2 Query: 166 PALIPARPADRCARRSCPA 222 PAL RPA RC R+ C A Sbjct: 937 PALARGRPAGRCCRQPCRA 881 Score = 24.4 bits (47), Expect(2) = 4.4 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 / -1 Query: 406 SPSPSHLCPTSNACK 450 +PSP LCP + C+ Sbjct: 485 TPSPPSLCPRNRRCR 441
>LOC_Os07g34680:12007.t03143:unspliced-genomic hypothetical protein| Length = 880 Score = 26.3 bits (51), Expect(2) = 4.5 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 / -1 Query: 540 IAKKLAPMGSSGRGPSRAWS 599 +AK L P+G R PS WS Sbjct: 337 LAKSLLPLGRRHREPSPPWS 278 Score = 23.1 bits (44), Expect(2) = 4.5 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 / -2 Query: 364 TFPSGQGCLSTTKGSPSPSHLCP 432 T P + ++ T SPSH CP Sbjct: 384 TIPHPRLAVNRTGRRSSPSHCCP 316
>LOC_Os02g28340:12002.t02528:unspliced-genomic transferase, putative, expressed| Length = 1694 Score = 26.3 bits (51), Expect(2) = 5.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 / +1 Query: 172 LIPARPADRCARRSCP 219 L+P RP RC RR+ P Sbjct: 211 LLPPRPRRRCRRRAVP 258 Score = 26.3 bits (51), Expect(2) = 5.1 Identities = 16/54 (29%), Positives = 21/54 (38%) Frame = +3 / +3 Query: 474 RVCRKASRSSISLHAPGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPPA 635 R R R++ S P + A SS P+ W+R S G PPA Sbjct: 465 RSSRSFPRAARSSRCR*PCCRPSAAASLSASSSTTPPATGWARRTSSTPGPPPA 626
>LOC_Os08g08850:12008.t00771:unspliced-genomic carF, putative, expressed| Length = 931 Score = 31.8 bits (63), Expect = 5.9 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = -2 / -2 Query: 539 RLAERSWSMKRNR*AARLPADAGGGLLCEILQAFDVGQRCEGLGLPFVV 393 R ER + + + ARLP GGG+ L+ D+G G+G+ VV Sbjct: 492 REGERDGARQGVQVVARLPPRDGGGVAVVALERGDLGAEHRGVGVAVVV 346
>LOC_Os01g16320:12001.t01481:unspliced-genomic plant-specific domain TIGR01570 family protein| Length = 2589 Score = 31.8 bits (63), Expect = 5.9 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -2 / +3 Query: 221 AGHDRRAQRSAGRAGIKAGSHRLGRRVVPAAAG 123 AG A +AGRAG+ G R RRV AA G Sbjct: 2256 AGGSPPAAAAAGRAGVVGGGERRERRVRGAAGG 2354
>LOC_Os05g50000:12005.t04432:unspliced-genomic hypothetical protein| Length = 1209 Score = 26.3 bits (51), Expect(2) = 5.9 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 / -3 Query: 358 WRTFPSGQGCLSTTKGSPSP 417 W+ +P G G S + G+P P Sbjct: 817 WQAWPGGGGARSPSPGAPPP 758 Score = 22.6 bits (43), Expect(2) = 5.9 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 / -2 Query: 526 LSAXXXXXSWRPWV 567 ++A SWRPW+ Sbjct: 683 IAAALRTASWRPWI 642
>LOC_Os09g19990:12009.t01733:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4002 Score = 31.8 bits (63), Expect = 5.9 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 / +2 Query: 337 STSCRRCWRTFPSGQGCLSTTKGSPSPSHL 426 S CRRCW + S CL + P P+ L Sbjct: 2042 SLLCRRCWASTTSPPACLRRRRVVPPPTRL 2131 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 626 CRRCWASTTSPPACLRRRRVVPPPTRL 706 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1160 CRRCWASTTSPPACLRRRRVVPPPTRL 1240 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1516 CRRCWASTTSPPACLRRRRVVPPPTRL 1596 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1694 CRRCWASTTSPPACLRRRRVVPPPTRL 1774 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1783 CRRCWASTTSPPACLRRRRVVPPPTRL 1863
>LOC_Os07g03270:12007.t00217:unspliced-genomic heat shock protein binding protein, putative, expressed| Length = 2689 Score = 31.8 bits (63), Expect = 5.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 / +3 Query: 732 ISGRSYLIPCYKTLHHL*LAYHVYCTTLSCSGKQ 631 I GR + +PC HHL A+ C + S K+ Sbjct: 666 IRGREWSVPCSPIRHHLAFAFQYLCLSFQYSCKE 767
>LOC_Os06g42130:12006.t03904:unspliced-genomic leucoanthocyanidin dioxygenase, putative, expressed| Length = 1326 Score = 31.8 bits (63), Expect = 5.9 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -1 / +2 Query: 585 TAPGPKNPWAPTSSLSSC*KVLEHEAKSMSGSPSCRRGRWSSLRDLAS 442 T PGP +P AP + SS + +G+P+C S+ AS Sbjct: 779 TTPGPGSPRAPNRAPSSSTSATPWRSSPTAGTPACSTAASSAATQCAS 922
>LOC_Os05g19930:12005.t01756:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3820 Score = 31.8 bits (63), Expect = 5.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNA 444 CRRCW + S CL + P P+ L ++A Sbjct: 2033 CRRCWASTTSPPACLRRRRVVPPPTRLAYYASA 1935 Score = 31.8 bits (63), Expect = 5.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNA 444 CRRCW + S CL + P P+ L ++A Sbjct: 1677 CRRCWASTTSPPACLRRRRVVPPPTRLAYYASA 1579 Score = 31.8 bits (63), Expect = 5.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNA 444 CRRCW + S CL + P P+ L ++A Sbjct: 1143 CRRCWASTTSPPACLRRRRVVPPPTRLAYYASA 1045 Score = 31.8 bits (63), Expect = 5.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNA 444 CRRCW + S CL + P P+ L ++A Sbjct: 965 CRRCWASTTSPPACLRRRRVVPPPTRLAYYASA 867 Score = 31.8 bits (63), Expect = 5.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNA 444 CRRCW + S CL + P P+ L ++A Sbjct: 698 CRRCWASTTSPPACLRRRRVVPPPTRLAYYASA 600 Score = 31.8 bits (63), Expect = 5.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNA 444 CRRCW + S CL + P P+ L ++A Sbjct: 520 CRRCWASTTSPPACLRRRRVVPPPTRLAYYASA 422 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2211 CRRCWASTTSPPACLRRRRVVPPPTRL 2131 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2122 CRRCWASTTSPPACLRRRRVVPPPTRL 2042 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1855 CRRCWASTTSPPACLRRRRVVPPPTRL 1775 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1499 CRRCWASTTSPPACLRRRRVVPPPTRL 1419 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1321 CRRCWASTTSPPACLRRRRVVPPPTRL 1241 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 787 CRRCWASTTSPPACLRRRRVVPPPTRL 707
>LOC_Os05g15400:12005.t01312:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3779 Score = 31.8 bits (63), Expect = 5.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 358 CRRCWASMTSPPACLRRRRLVPPPTRL 438
>LOC_Os04g54474:12004.t04919:unspliced-genomic transcription factor TGA4, putative, expressed| Length = 8705 Score = 31.8 bits (63), Expect = 5.9 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 / +1 Query: 337 STSCRRCWRTFPSGQGCLSTTKG 405 STSCR C R PSG C S G Sbjct: 7510 STSCRACGRPPPSGSSCGSVGSG 7578
>LOC_Os03g38310:12003.t03278:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2051 Score = 31.8 bits (63), Expect = 5.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + PSP L Sbjct: 80 CRRCWASTTSPPACLRRRRLVPSPIRL 160
>LOC_Os03g07140:12003.t00580:unspliced-genomic male sterility protein 2, putative, expressed| Length = 4112 Score = 31.8 bits (63), Expect = 5.9 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 / +3 Query: 337 STSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNACK 450 ST C +R PSGQ G PSP T CK Sbjct: 1917 STPCEEIYRLSPSGQASSRAPGGIPSPVGWKGTGTNCK 2030
>LOC_Os06g29470:12006.t02651:unspliced-genomic peroxidase 1 precursor, putative, expressed| Length = 1147 Score = 29.0 bits (57), Expect(2) = 6.6 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 / +3 Query: 316 KGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPS 414 +G A +T+CRR W + + +TT SPS Sbjct: 852 RGAGASPTTACRRRWTPAATRRSTPATTAMSPS 950 Score = 22.6 bits (43), Expect(2) = 6.6 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 / +3 Query: 178 PARPADRCARRSCPA*QTTTTTP 246 PARP C RR+ + ++ ++P Sbjct: 627 PARPPPACPRRTATSRRSPGSSP 695
>LOC_Os08g02440:12008.t00139:unspliced-genomic ATP binding protein, putative, expressed| Length = 4622 Score = 29.9 bits (59), Expect(2) = 6.8 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +1 / +2 Query: 349 RRCWRTFPSGQGCLSTTKGSPSPSHLCPTSNACKIS 456 RR W GC TT SP PS ++ C S Sbjct: 344 RRRWPCCRGSPGCTCTTTSSPGPSLASSATSPCSPS 451 Score = 23.5 bits (45), Expect(2) = 6.8 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +3 / +1 Query: 582 PSRAWSRGLSLRSGKP 629 P R W RG+ ++G+P Sbjct: 4195 PRRRWRRGVLRQAGRP 4242
>LOC_Os04g54140:12004.t04887:unspliced-genomic receptor-like kinase, putative, expressed| Length = 4141 Score = 24.4 bits (47), Expect(2) = 7.2 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 / +1 Query: 29 CLLGSCVIRPRFHGGAPC 82 C GSC R R G PC Sbjct: 3841 CRSGSCACRMRRRKGRPC 3894 Score = 24.0 bits (46), Expect(2) = 7.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 181 ARPADRCARRSCPA*QTTTT 240 A RCA RSC A T TT Sbjct: 3967 AEAGHRCASRSCWAPPTLTT 4026
>LOC_Os11g13890:12011.t01223:unspliced-genomic chlorophyll a-b binding protein M9, chloroplast precursor,| putative, expressed Length = 2600 Score = 24.9 bits (48), Expect(2) = 7.5 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 / +3 Query: 582 APGPKNPWAPTSSLSSC*KVLEHEAKS 502 +P P P APTS++SS + AKS Sbjct: 249 SPPPSPPRAPTSAMSSPSGTVSEIAKS 329 Score = 23.5 bits (45), Expect(2) = 7.5 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 / +1 Query: 507 KSMSGSPSCRRGRWSSLR 454 ++++G SCRR W++ R Sbjct: 418 QALTGGSSCRRVSWTAQR 471
>LOC_Os02g10670:12002.t00915:unspliced-genomic hypothetical protein| Length = 2652 Score = 30.9 bits (61), Expect(2) = 7.6 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +1 / -2 Query: 160 WLPALIPARPADRCARRSCPA*QTTTTTPSLP 255 W P +P A C+R SC A T+T + P Sbjct: 2312 WTPTAVPVAVARTCSRASCAAHGGRTSTTARP 2217 Score = 21.7 bits (41), Expect(2) = 7.6 Identities = 12/43 (27%), Positives = 16/43 (37%) Frame = +3 / -2 Query: 516 APGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPPAYQS 644 AP F + + + P A SLRS PP +S Sbjct: 2213 APAAFCVHVTRMRSSFPKCSEAPYTAVVAACSLRSRAPPRPES 2085
>LOC_Os12g22744:12012.t004160:unspliced-genomic expressed protein| Length = 5419 Score = 29.5 bits (58), Expect(2) = 7.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 / -3 Query: 370 PSGQGCLSTTKGSPSPSHLC 429 P GQG LST K P +H C Sbjct: 4205 PFGQGQLSTNKSQPEHNHSC 4146 Score = 24.0 bits (46), Expect(2) = 7.7 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +3 / -1 Query: 564 GSSGRGPSRAWSRGLSLRSGKPPAYQSKKELCSRHDMLAKGDAR 695 G GRG R + +PPA S C R +L D R Sbjct: 613 GGRGRGERRGCGLRRRFSTIQPPAGLSPLYCCCRLSLLKSTDNR 482
>LOC_Os09g20300:12009.t01764:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1851 Score = 31.3 bits (62), Expect = 8.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 / +1 Query: 516 APGPFSKTIAKKLAPMGSSGRGPSRAW 596 A GPF T P GS G GPS W Sbjct: 142 ATGPFPTTTGGGHPPHGSGGSGPSPTW 222
>LOC_Os08g05820:12008.t00474:unspliced-genomic monocopper oxidase-like protein SKS1 precursor, putative, expressed| Length = 5142 Score = 31.3 bits (62), Expect = 8.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 / +1 Query: 516 APGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPPA 635 +P P ++++ P SS R S A S L L S +PPA Sbjct: 1936 SPAPTARSLPGGTGPTSSSSRTRSAASSTSLRLVSSEPPA 2055
>LOC_Os04g09780:12004.t00812:unspliced-genomic ATP binding protein, putative| Length = 1016 Score = 31.3 bits (62), Expect = 8.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 / -1 Query: 591 AWSRGLSLRSGKPPAYQSKKELCSRHDMLAKGDA 692 +W+ R+G PPAY+S++ L S A+G A Sbjct: 419 SWAMSGRARNGAPPAYRSRQLLYSMAPPTARGQA 318
>LOC_Os02g36400:12002.t03277:unspliced-genomic ubiquitin carboxyl-terminal hydrolase 4, putative, expressed| Length = 4640 Score = 31.3 bits (62), Expect = 8.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +3 / -2 Query: 558 PMGSSGRGPSRAWSRGLSLRSGKPPA 635 P GS RGPSRAW R G P A Sbjct: 202 PRGSGRRGPSRAWRRPRRGPRGGPTA 125
>LOC_Os01g49830:12001.t04421:unspliced-genomic DNA-binding protein RAV1, putative, expressed| Length = 1635 Score = 31.3 bits (62), Expect = 8.1 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +3 / -2 Query: 507 SLHAPGPFSKTIAKKLAPMGSSGRGPSRAWSRGLSLRSGKPP 632 S APG + T A PM SSG + A + LSL +PP Sbjct: 299 SASAPGSAASTTALAPLPMRSSGAVSAAAAANALSLSVDEPP 174
>LOC_Os12g37900:12012.t03471:unspliced-genomic thioredoxin-related, putative, expressed| Length = 548 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 / +1 Query: 307 CSWKGTAAGHSTSCRRCWRTFPS 375 C + TA G S +CRR WR P+ Sbjct: 379 CGCRSTAGGTSCACRRGWRCGPA 447
>LOC_Os12g36380:12012.t03321:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3143 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 819 CRRCWASTTSPPACLRRRRVVPPPTRL 899 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 908 CRRCWASTTSPPACLRCRRVVPPPTRL 988
>LOC_Os12g33820:12012.t03071:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2672 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 483 CRRCWASTTSPPACLRRRRVVPPPTRL 563 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 839 CRRCWASTTSPPACLRRRRVVPPPTRL 919
>LOC_Os12g28890:12012.t02599:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3320 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2647 CRRCWASTTSPPACLRCRRVVPPPTRL 2727 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2825 CRRCWASTTSPPACLRCRRVVPPPTRL 2905
>LOC_Os11g11320:12011.t01020:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 2486 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1190 CRRCWASTTSPPACLRRRRVVPPPTRL 1110 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 786 CRRCWASTTSPPACLRRRRVVPPPTRL 706 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 471 CRRCWASTTSPPACLRRRRVVPPPTRL 391 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 382 CRRCWASTTSPPACLRRRRVVPPPTRL 302 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 293 CRRCWASTTSPPACLRRRRVVPPPTRL 213
>LOC_Os10g40660:12010.t03308:unspliced-genomic cys2/His2 zinc-finger transcription factor, putative, expressed| Length = 1692 Score = 31.3 bits (62), Expect = 8.1 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / +3 Query: 340 TSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 ++CRR WRT S C + + + H PTS Sbjct: 1305 STCRRQWRTTSSSPPCTTPSSPARDSDHTPPTS 1403
>LOC_Os09g27340:12009.t02413:unspliced-genomic ATP binding protein, putative| Length = 2365 Score = 31.3 bits (62), Expect = 8.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +1 / +2 Query: 340 TSCRRCWRTFPSGQGCLSTTKGSPSPS 420 +SCRRC R + S C + ++ S SPS Sbjct: 5 SSCRRCGRCWASSPSCRTCSRRSYSPS 85
>LOC_Os09g25300:12009.t02209:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3812 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 661 CRRCWASTTSPPACLRRRRVVPPPTRL 741 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 750 CRRCWASTTSPPACLRRRRVVPPPTRL 830 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 839 CRRCWASTTSPPACLRRRRVVPPPTRL 919 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1106 CRRCWASTTSPPACLRRRRVVPPPTRL 1186 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1284 CRRCWASTTSPPACLRRRRVVPPPTRL 1364 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1373 CRRCWASTTSPPACLRRRRVVPPPTRL 1453 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1462 CRRCWASTTSPPACLRRRRVVPPPTRL 1542 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1551 CRRCWASTTSPPACLRRRRVVPPPTRL 1631
>LOC_Os09g04339:12009.t00331:unspliced-genomic expressed protein| Length = 8660 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1469 CRRCWASTTSPPACLRRRRVVPPPTRL 1549
>LOC_Os08g36340:12008.t03374:unspliced-genomic potassium transporter 4, putative, expressed| Length = 10963 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 4241 CRRCWASTTSPPACLRRRRVVPPPTRL 4321 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 4419 CRRCWASTTSPPACLRRRRVVPPPTRL 4499 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 4864 CRRCWASTTSPPACLRRRRVVPPPTRL 4944 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 5487 CRRCWASTTSPPACLRRRRVVPPPTRL 5567 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 5665 CRRCWASTTSPPACLRRRRVVPPPTRL 5745
>LOC_Os08g31740:12008.t02919:unspliced-genomic conserved hypothetical protein| Length = 4686 Score = 31.3 bits (62), Expect = 8.1 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = -1 / +2 Query: 603 PCSMLLTAPGPKNPWAPTSSLSSC*KVLEHEAKSMSGSPSCRRGRWSSLRDLAS 442 PC+ TAP W P + S + E S S +P R R + R+L S Sbjct: 4496 PCTAATTAPPGSRGWRPKAPGSPTGRWREMSPTSTSTTPRSPRAREQARRELCS 4657
>LOC_Os08g27980:12008.t02556:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6330 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3894 CRRCWASTTSPPACLRRRRVVPPPTRL 3974 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3983 CRRCWASTTSPPACLRRRRVVPPPTRL 4063 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 4161 CRRCWASTTSPPACLRRRRVVPPPTRL 4241 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 4250 CRRCWASTTSPPACLRRRRVVPPPTRL 4330 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 4339 CRRCWASTTSPPACLRRRRVVPPPTRL 4419 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 4518 CRRCWASTTSPPACLRRRRVVPPPTRL 4598 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 4696 CRRCWASTTSPPACLRRRRVVPPPARL 4776
>LOC_Os08g22560:12008.t02032:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1170 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 180 CRRCWASTTSPPACLRRRRVVPPPTRL 260 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 269 CRRCWASTTSPPACLRCRRVVPPPTRL 349 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 358 CRRCWASTTSPPACLRRRRVVPPPTQL 438 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 447 CRRCWASTTSPPACLRRRRVVPPPTRL 527 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 625 CRRCWASTTSPPACLRCRRVVPPPTRL 705 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 803 CRRCWASTTSPPACLRCRRVVPPPTRL 883 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 892 CRRCWASTTSPPACLRRRRVVPPPTRL 972 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 981 CRRCWASTTSPPACLRRRRVVPPPTRL 1061
>LOC_Os08g15830:12008.t01457:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 11464 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1005 CRRCWASTTSPPACLRRRRVVPPPTRL 925 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 916 CRRCWASTTSPPACLRRRRVVPPPTRL 836 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 649 CRRCWASTTSPPACLRRRRVVPPPTRL 569 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 471 CRRCWASTTSPPACLRRRRVVPPPTRL 391 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 293 CRRCWASTTSTPACLRRRRVVPPPTRL 213
>LOC_Os08g13600:12008.t01237:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3689 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2 CRRCWESTTSPPACLRRRRLVPPPTRL 82 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 180 CRRCWASTTSPPACLRRRRVVPPPTRL 260 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 269 CRRCWASTTSPPACLRRRRVVPPPTRL 349 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 358 CRRCWASTTSPPACLRRRRVVPPPTRL 438 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 447 CRRCWASTTSPPACLRRRRVVPPPTRL 527 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 536 CRRCWASTTSPPACLRRRRVVPPPTRL 616 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 625 CRRCWASTTSPPACLRRRRVVPPPTRL 705 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 714 CRRCWASTTSPPACLRRRRVVPPPTRL 794 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 803 CRRCWASTTSPPACLRRRRVVPPPTRL 883 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3235 CRRCWASTTSPPACLRRRRVVPPPTRL 3315 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3324 CRRCWASTTSPPACLRRRRVVPPPTRL 3404 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3413 CRRCWASTTSPPACLRRRRVVPPPTRL 3493 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3502 CRRCWASTTSPPACLRRRRVVPPPTRL 3582
>LOC_Os08g07180:12008.t00607:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative| Length = 534 Score = 31.3 bits (62), Expect = 8.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 / +2 Query: 160 WLPALIPARPADRCARRSCPA*QTTTTTPSLP 255 W P L PA RC+ SC +T+ S P Sbjct: 23 WCPTLAPATSTRRCSSPSCSTAMASTSPSSTP 118
>LOC_Os08g07170:12008.t00606:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative| Length = 1905 Score = 31.3 bits (62), Expect = 8.1 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 / +2 Query: 160 WLPALIPARPADRCARRSCPA*QTTTTTPSLP 255 W P L PA RC+ SC +T+ S P Sbjct: 23 WCPTLAPATSTRRCSSPSCSTAMASTSPSSTP 118
>LOC_Os08g06160:12008.t00506:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 816 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 180 CRRCWASTTSPPACLRRRRVVPPPTRL 260
>LOC_Os08g05990:12008.t00491:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2746 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 436 CRRCWASTTSPPACLRRRRVVPPPTRL 516 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 525 CRRCWASTTSPPACLRRRRVVPPPTRL 605 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 614 CRRCWASTTSPPACLRRRRVVPPPTRL 694 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 792 CRRCWASTTSPPACLRRRRVVPPPTRL 872
>LOC_Os07g40330:12007.t03694:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2694 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 471 CRRCWASTTSPPACLHRRRVVPPPTRL 391 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 382 CRRCWASTTSPPACLRRRRVVPPPTRL 302 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 293 CRRCWASTTSPPACLRRRRVVPPPTRL 213
>LOC_Os07g36360:12007.t03307:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 3849 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2303 CRRCWASTTSPPACLRRRRVVPPPTRL 2383
>LOC_Os07g24770:12007.t02173:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6733 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 5533 CRRCWASTTSPPACLRRRRVVPPPTRL 5613 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 5978 CRRCWASTTSPPACLRRRRVVPPPTRL 6058
>LOC_Os07g24280:12007.t02125:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3526 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2 CRRCWASTTSPPACLRRRRVVPPPTRL 82
>LOC_Os07g18790:12007.t01737:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3488 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1705 CRRCWASTTSPPACLRCRRVVPPPTRL 1785 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1794 CRRCWASTTSPPACLRCRRVVPPPTRL 1874 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1883 CRRCWASTTSPPACLRRRRVVPPPTRL 1963 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1972 CRRCWASTTSPPACLRCRRVVPPPTRL 2052
>LOC_Os07g16090:12007.t01471:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3336 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 642 CRRCWASTTSPPACLRRRRVVPPPTRL 722 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1265 CRRCWASTTSPPACLRRRRVVPPPTRL 1345 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1354 CRRCWASTTSPPACLRRRRVVPPPTRL 1434 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1443 CRRCWASTTSPPACLRRRRVVPPPTRL 1523 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1532 CRRCWASTTSPPACLRRRRVVPPPTRL 1612
>LOC_Os07g12740:12007.t01145:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2742 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 524 CRRCWASTTSPPACLRRRRVVPPPTRL 604
>LOC_Os06g42900:12006.t03980:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3599 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 91 CRRCWASTTSPPACLRRRRVVPPPTRL 171 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 358 CRRCWASTTSPPACLRRRRVVPPPTRL 438 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 714 CRRCWASTTSPPACLRRRRVVPPPTRL 794
>LOC_Os06g33549:12006.t03051:unspliced-genomic protein phosphatase 2C isoform epsilon, putative, expressed| Length = 10443 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 6149 CRRCWASTTSPPACLRRRRVVPPPTRL 6069
>LOC_Os06g07110:12006.t00595:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4674 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2137 CRRCWASTTSPSACLRRRRLVPPPTRL 2217 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2226 CRRCWASTTSPPACLRRRRVVPPPTRL 2306 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2404 CRRCWASTTSPPACLRRRRVVPPPTRL 2484
>LOC_Os05g30840:12005.t02683:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 894 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 349 CRRCWASTTSPPACLRRRRVVPPPTRL 429 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 705 CRRCWASTTSPPACLRRRRVVPPPTRL 785
>LOC_Os05g26540:12005.t02308:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2345 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1499 CRRCWASTTSPPACLRRRRVVPPPTRL 1419 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1232 CRRCWASTTSPPACLRRRRVVPPPTRL 1152 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 965 CRRCWASTTSPPACLRRRRVVPPPTRL 885 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 698 CRRCWASTTSPPACLRRRRVLPPPTRL 618 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 609 CRRCWASTTSPPACLRRRRVVPPPTRL 529 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 520 CRRCWASTTSPPACLRRRRVVPPPTRL 440
>LOC_Os05g23070:12005.t01965:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4549 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 868 CRRCWASTTSPPACLRRRRVVPPPTRL 788 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 779 CRRCWASTTSPPACLRRRRVVPPPTRL 699 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 690 CRRCWASTTSPPACLRRRRVVPPPTRL 610 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 423 CRRCWASTTSPPACLRRRRVVPPPTRL 343 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 156 CRRCWASTTSPPACLRRRRVVPPPTRL 76
>LOC_Os05g13730:12005.t01151:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5776 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2221 CRRCWASTTSPPACLRRRRVVPPPTRL 2301 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2666 CRRCWASTTSPPACLRRRRVVPPPTRL 2746 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2844 CRRCWASTTSPPACLRRRRVVPPPTRL 2924 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2933 CRRCWASTTSPPACLRRRRVVPPPTRL 3013
>LOC_Os04g38026:12004.t03373:unspliced-genomic sugar transport protein 5, putative, expressed| Length = 6078 Score = 31.3 bits (62), Expect = 8.1 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = -1 / -1 Query: 558 APTSSLSSC*KVLEHEAKSMSGSPSCRRGRWSSLRDLASI*RRTEM 421 AP+S L SC S S S R RWS+ R + RRT + Sbjct: 4101 APSSFLRSCSTAARMSLNSASTSTPLPRTRWSAARARSCFPRRTRL 3964
>LOC_Os04g37500:12004.t03320:unspliced-genomic glutamate decarboxylase, putative, expressed| Length = 2375 Score = 31.3 bits (62), Expect = 8.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 / +1 Query: 340 TSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 T CRR W T T SPS CPTS Sbjct: 1711 TRCRRRWST*RCSASSSGKTSAGRSPSGSCPTS 1809
>LOC_Os04g33240:12004.t03000:unspliced-genomic sex determination protein tasselseed-2, putative, expressed| Length = 1165 Score = 31.3 bits (62), Expect = 8.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 / +2 Query: 316 KGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 +GT A R WR +P+ + C S + SP P P + Sbjct: 788 RGTWAWRGRRSRPPWRPWPTSRACASAWRTSPPPCCSSPAT 910
>LOC_Os04g26030:12004.t02310:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4384 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 613 CRRCWASTTSPPACLRRRRVVPPPTRL 693 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 702 CRRCWASTTSPPACLRRRRVVPPPTRL 782 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 791 CRRCWASTTSPPACLRRRRVVPPPTRL 871 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 880 CRRCWASTTSPPACLRRRRVVPPPTRL 960 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1050 CRRCWASTTSPPACLRRRRVVPPPTRL 1130 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1139 CRRCWASTTSPPACLRRRRVVPPPTRL 1219 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1228 CRRCWASTTSPPACLRRRRVVPPPTRL 1308 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1584 CRRCWASTTSPPACLRRRRVVPPPTRL 1664 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1673 CRRCWASTTSPPACLRRRRVVPPPTRL 1753 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1762 CRRCWASTTSPPACLRRRRVVPPPTRL 1842
>LOC_Os04g19490:12004.t01689:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2809 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 91 CRRCWASTTSPPACLRRRRVVPPPTRL 171 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 714 CRRCWASTTSPPACLRRRRVVPPPTRL 794
>LOC_Os04g18780:12004.t01620:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2948 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 57 CRRCWASTTSPPACLRRRRVVPPPTRL 137 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 146 CRRCWASTTSPPACLRRRRVVPPPTRL 226 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 858 CRRCWASTTSPPACLRRRRVVPPPTRL 938
>LOC_Os04g14980:12004.t01315:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4198 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 141 CRRCWASTTSPPACLRRRRVVPPPTRL 221 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 957 CRRCWASTTSPPACLRRRRVVPPPTRL 1037 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1313 CRRCWASTTSPPACLRRRRVVPPPTRL 1393
>LOC_Os04g13410:12004.t01161:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2402 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1005 CRRCWASTTSPPACLRRRRVVPPPTRL 925 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 738 CRRCWASTTSPPACLHRRRVVPPPTRL 658 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 649 CRRCWASTTSPPACLRRRRVVPPPTRL 569 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 471 CRRCWASTTSPPACLRRRRVVPPPTRL 391 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 293 CRRCWASTTSPPACLRRRRVVPPPTRL 213
>LOC_Os04g12890:12004.t01111:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4010 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1659 CRRCWASTTSPPACLRRRRVVPPPTRL 1739 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1748 CRRCWASTTSPPACLRRRRVVPPPTRL 1828 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2015 CRRCWASTTSPPACLRRRRVVPPPTRL 2095 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2232 CRRCWASTTSPPACLRRRRVVPPPTRL 2312
>LOC_Os04g06400:12004.t00519:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2701 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 259 CRRCWASATSPPACLRRRRVVPPPTRL 339 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 348 CRRCWASTTSPPACLRRRRVVPPPTRL 428 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 437 CRRCWASTTSPPACLRRRRVVPPPTRL 517 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 526 CRRCWASTTSPPACLRRRRVVPPPTRL 606 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 615 CRRCWASTTSPPACLRRRRVVPPPTRL 695 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 793 CRRCWASTTSPPACLRRRRVVPPPTRL 873
>LOC_Os03g51850:12003.t04514:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2773 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 609 CRRCWASTTSPPACLRRRRVVPPPTRL 689 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 787 CRRCWASTTSPPACLRRRRVVPPPTRL 867 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 965 CRRCWASTTSPPACLRRRRVVPPPTRL 1045 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1054 CRRCWASTTSPPACLRRRRVVPPPTRL 1134 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1143 CRRCWASTTSPPACLRRRRVVPPPTRL 1223 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1232 CRRCWTSTSSPPACLRRRRVVPPPTRL 1312
>LOC_Os03g46690:12003.t04036:unspliced-genomic F-box domain containing protein, expressed| Length = 2728 Score = 31.3 bits (62), Expect = 8.1 Identities = 19/55 (34%), Positives = 22/55 (40%) Frame = -1 / +2 Query: 612 EKGPCSMLLTAPGPKNPWAPTSSLSSC*KVLEHEAKSMSGSPSCRRGRWSSLRDL 448 EKG L+T P W S V +HE S P R RW L+DL Sbjct: 1763 EKGVYLALITKPRSLQVWVLNESCDEMEWVPKHENNLDSVFPRQTRRRWMLLQDL 1927
>LOC_Os03g27210:12003.t02399:unspliced-genomic LOL3, putative, expressed| Length = 2073 Score = 31.3 bits (62), Expect = 8.1 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 / +1 Query: 310 SWKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGS 408 SW TA + + RRC SG+G STT+ + Sbjct: 604 SWTSTATRRTATTRRCAPWTSSGRGSSSTTRST 702
>LOC_Os03g25940:12003.t02287:unspliced-genomic cystathionine beta-lyase, putative, expressed| Length = 4209 Score = 31.3 bits (62), Expect = 8.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 / +3 Query: 762 FFFFFVSGDCISGRSYLIPCYKTLHHL 682 +F F V G CISGR L+ + HH+ Sbjct: 2538 YFVF*VIGGCISGRDELVSKVRIYHHV 2618
>LOC_Os02g56730:12002.t05245:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3230 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 437 CRRCWASTTSPPACLRRRRVVPPPTRL 517 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 615 CRRCWASTTSPPACLRRRRVVPPPTRL 695 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 704 CRRCWASTTSPPACLRRRRVVPPPTRL 784
>LOC_Os02g42770:12002.t03862:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2254 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 896 CRRCWASTTSPPACLRRRRVVPPPTRL 816 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 649 CRRCWASTTSPPACLRRRRVVPPPTRL 569 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 560 CRRCWASTTSPPACLRRRRVVPPPTRL 480 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 471 CRRCWASTTSPPACLRRRRVVPPPTRL 391 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 293 CRRCWASTTSPPACLRRRRVVPPPTRL 213
>LOC_Os02g40850:12002.t03720:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2546 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 180 CRRCWASTTSPPACLRRRRVVPPPARL 260
>LOC_Os02g35520:12002.t03190:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2324 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 223 CRRCWASTTSPPACLRRRRVVPPPTRL 303 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 490 CRRCWASTTSPPACLRRRRVVPPPTRL 570
>LOC_Os02g29750:12002.t02668:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3870 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1190 CRRCWASTTSPPACLRRRRVVPPPTRL 1110 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 786 CRRCWASTTSPPACLRRRRVVPPPTRL 706 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 471 CRRCWASTTSPPACLRRRRVVPPPTRL 391 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 382 CRRCWASTTSPPACLRRRRVVPPPTRL 302 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 293 CRRCWASTTSPPACLRRRRVVPPPTRL 213
>LOC_Os02g05020:12002.t00400:unspliced-genomic expressed protein| Length = 9251 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2293 CRRCWTSTTSPPACLRRRRVVPPPTRL 2373 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2382 CRRCWASTTSPPACLRRRRVVPPPTRL 2462 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2560 CRRCWASTTSPPACLRRRRVVPPPTRL 2640 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3273 CRRCWASTTSPPACLRRRRVVPPPTRL 3353 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3451 CRRCWASTTSPPACLRRRRVVPPPTRL 3531 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3629 CRRCWASTTSPPACLRRRRVVPPPTRL 3709 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3718 CRRCWASTTSPPACLRRRRVVPPPTRL 3798 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3807 CRRCWASTTSPPACLRRRRVVPPPTRL 3887
>LOC_Os01g74130:12001.t06693:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2986 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 197 CRRCWASTTSPPACLRRRRVVPPPTRL 277 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 286 CRRCWASTTSPPACLRCRRVVPPPTRL 366
>LOC_Os01g71700:12001.t06463:unspliced-genomic amino-acid permease C1039.01, putative, expressed| Length = 2487 Score = 31.3 bits (62), Expect = 8.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 / +2 Query: 355 CWRTFPSGQGCLSTTKGSPSPSHLC 429 CWR PS C++++ S S +LC Sbjct: 959 CWRFMPSS*SCMASSTASLSSGYLC 1033
>LOC_Os01g52250:12001.t04652:unspliced-genomic glycogen synthase, putative, expressed| Length = 10480 Score = 31.3 bits (62), Expect = 8.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 / -2 Query: 319 GTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 G+++ S+ R WRT+P+ STT P+P P S Sbjct: 9720 GSSSRPSSPARGHWRTWPTTSPTPSTTTHGPTPPTSSPAS 9601
>LOC_Os01g52240:12001.t04651:unspliced-genomic chlorophyll a-b binding protein 2, chloroplast precursor, putative,| expressed Length = 1057 Score = 31.3 bits (62), Expect = 8.1 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 / +1 Query: 319 GTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTS 438 G+++ S+ R WRT+P+ STT P+P P S Sbjct: 760 GSSSRPSSPARGHWRTWPTTSPTPSTTTHGPTPPTSSPAS 879
>LOC_Os01g38080:12001.t03347:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1350 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 293 CRRCWASTTSPPACLRRRRVVPPPTRL 213
>LOC_Os01g33700:12001.t02935:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5828 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2408 CRRCWASTTSPPACLRRRRVVPPPTRL 2488 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2675 CRRCWASTSSPPACLRRRRVVPPPTRL 2755 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2764 CRRCWASTTSPPACLRRRRVVPPPTRL 2844 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3031 CRRCWASTSSPPACLRRRRVVPPPTRL 3111 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 3120 CRRCWASTTSPPACLRRRRVVPPPTRL 3200
>LOC_Os01g22620:12001.t01994:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1278 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 555 CRRCWASTTSPPACLRRRRVVPPPTRL 635 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 911 CRRCWASTTSPPACLRRRRVVPPPTRL 991 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1089 CRRCWASTTSPPACLRRRRVVPPPTRL 1169
>LOC_Os01g19894:12001.t01778:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 13141 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 270 CRRCWASTTSPPACLRRRRVVPPPTRL 350 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 359 CRRCWASTTSPPACLRCRRVVPPPTRL 439
>LOC_Os01g15360:12001.t01387:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2918 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 2163 CRRCWASTTSPPACLRRRRVVPPPTRL 2083 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -3 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1896 CRRCWASTTSPPACLRRRRVVPPPTRL 1816 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1718 CRRCWASTTSPPACLRRRRVVPPPTRL 1638 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1540 CRRCWASTTSPPACLRRRRVVPPPTRL 1460 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 1094 CRRCWASTTSPPACLRRRRVVPPPARL 1014 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -2 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 916 CRRCWASTTSPPACLRRRRVVPPPTRL 836 Score = 31.3 bits (62), Expect = 8.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 / -1 Query: 346 CRRCWRTFPSGQGCLSTTKGSPSPSHL 426 CRRCW + S CL + P P+ L Sbjct: 293 CRRCWASTTSPPACLRRRRVVPPPTRL 213
>LOC_Os04g59420:12004.t05399:unspliced-genomic expressed protein| Length = 1597 Score = 29.5 bits (58), Expect(2) = 8.7 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +1 / +3 Query: 316 KGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPSPSHLCPTSN 441 +G A ST RR W + G S++ P P PTS+ Sbjct: 342 RGHACATSTRGRRWWACARNASGSASSSSSPPRPRLPLPTSS 467 Score = 22.1 bits (42), Expect(2) = 8.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 / +3 Query: 573 GRGPSRAWSRGLSLRSGKP 629 GRG R+W R L++ P Sbjct: 1029 GRGRGRSWIRTLTITRRPP 1085
>LOC_Os07g16170:12007.t01479:unspliced-genomic hypothetical protein| Length = 1399 Score = 25.4 bits (49), Expect(3) = 9.5 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -2 / -3 Query: 200 QRSAGRAGIKAGSHRLGRRVVPAAAGADDHAFTSSTSFA 84 +RS ++ HR G V A G A TSS S++ Sbjct: 149 RRSPSSVPLRCPDHRAGDEKVAAWRGGGPSASTSSASWS 33 Score = 21.7 bits (41), Expect(3) = 9.5 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -3 / -2 Query: 712 HPMLQNLASPLASISC 665 HP + + SPL ++SC Sbjct: 1086 HP*I*HTVSPLVAVSC 1039 Score = 21.7 bits (41), Expect(3) = 9.5 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 / -2 Query: 483 CRRGRWSSLR 454 CRR RWS +R Sbjct: 324 CRRRRWSLVR 295
>LOC_Os01g12870:12001.t01153:unspliced-genomic eukaryotic translation initiation factor 3 subunit 6-interacting| protein, putative, expressed Length = 3553 Score = 28.6 bits (56), Expect(2) = 9.8 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +1 / +2 Query: 307 CSWKGTAAGHSTSCRRCWRTFPSGQGCLSTTKGSPS 414 C +G G S +C+R WR+ S + KGS S Sbjct: 815 CCRRGMCTGFSITCKRWWRSP*SRRFWRGRRKGSSS 922 Score = 24.0 bits (46), Expect(2) = 9.8 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +1 / +1 Query: 499 HRFRFMLQDLSAXXXXXSWRPWVLRAGGRQEHGAG 603 + F+ +L S +WR + L GR GAG Sbjct: 3151 YTFKSLLLSCSLRK*LVNWRKYSLTEPGRNHGGAG 3255
>LOC_Os12g42130:12012.t03887:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 2553 Score = 27.2 bits (53), Expect(2) = 9.8 Identities = 16/54 (29%), Positives = 21/54 (38%) Frame = -2 / +1 Query: 218 GHDRRAQRSAGRAGIKAGSHRLGRRVVPAAAGADDHAFTSSTSFAYTVLPHETW 57 G + + +A R G GSHR RV+ D+ S A P TW Sbjct: 2188 GDEGDSATAANRRG*WHGSHRRRHRVICLNGTEQDYRTDLELSLAILEAPSWTW 2349 Score = 24.9 bits (48), Expect(2) = 9.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 / +2 Query: 600 CSMLLTAPGPKNPWA 556 C+ TAPG PWA Sbjct: 500 CAARRTAPGSSGPWA 544
>LOC_Os05g33940:12005.t02989:unspliced-genomic hsr203J, putative, expressed| Length = 1807 Score = 27.6 bits (54), Expect(2) = 9.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 / +3 Query: 160 WLPALIPARPADRCARRSCPA 222 W P+ P RP+ C R S PA Sbjct: 690 WSPSSCPWRPSAACRRTSTPA 752 Score = 24.0 bits (46), Expect(2) = 9.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 / +3 Query: 346 CRRCWRTFPS 375 CRRCW PS Sbjct: 1155 CRRCWSPSPS 1184 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 274,338,869 Number of extensions: 4221213 Number of successful extensions: 29934 Number of sequences better than 10.0: 183 Length of query: 254 Length of database: 55,613,886 Length adjustment: 49 Effective length of query: 205 Effective length of database: 52,856,264 Effective search space: 10835534120 Effective search space used: 10835534120 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
