| Clone Name | FLbaf97i14 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g45590:12002.t04146:unspliced-genomic expressed protein| Length = 5093 Score = 36.8 bits (74), Expect = 0.13 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 / +2 Query: 20 CPAHTRRRPRPHGLLAVKLAP 82 CPAH R RPRPH L A+ +P Sbjct: 2033 CPAHRRHRPRPHQLRALARSP 2095
>LOC_Os11g43300:12011.t03860:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1899 Score = 29.9 bits (59), Expect(2) = 0.38 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 / +3 Query: 106 DSGHGIDGGRELHGEKAMGSRTTTGVSGAEGG 11 + G G GGRE GEK R T+G + +GG Sbjct: 990 ERGGGPRGGREGEGEKEREERETSG*TWPKGG 1085 Score = 25.8 bits (50), Expect(2) = 0.38 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 / +3 Query: 421 QRSNEARPPAWEPP 380 + ++ARP AW+PP Sbjct: 753 EEGDDARPGAWDPP 794
>LOC_Os05g43950:12005.t03884:unspliced-genomic expressed protein| Length = 4122 Score = 34.5 bits (69), Expect = 0.62 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 / +3 Query: 100 GHGIDGGRELHGEKAMGSRTTT 35 GHG DGG+ L GE MGS T Sbjct: 723 GHGQDGGQNLQGEAVMGSTAAT 788
>LOC_Os12g32950:12012.t02988:unspliced-genomic membrane protein, putative, expressed| Length = 3164 Score = 32.7 bits (65), Expect = 2.2 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 / -3 Query: 124 TELQDMDSGHGIDGGRELHGEKAMGSRTTTGVSGAEGGE 8 T + + G+ GG E GE+ GSR++ G G+ GE Sbjct: 171 TPVMNSPESRGVRGGGEAGGERERGSRSSVGRCGSFVGE 55
>LOC_Os04g31430:12004.t02825:unspliced-genomic expressed protein| Length = 506 Score = 32.7 bits (65), Expect = 2.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 / -2 Query: 5 RLSSLCPAHTRRRPRPHGLLAV 70 R SS C +H R RPR HG++ V Sbjct: 103 RCSSSCLSHARTRPRDHGVVGV 38
>LOC_Os12g34802:12012.t004164:unspliced-genomic expressed protein| Length = 2008 Score = 32.2 bits (64), Expect = 3.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 / -2 Query: 94 GIDGGRELHGEKAMGSRTTTGVSG 23 G GR +HG+K GSRT+ V G Sbjct: 150 GRGAGRAMHGKKGAGSRTSASVEG 79
>LOC_Os08g16600:12008.t01532:unspliced-genomic expressed protein| Length = 4728 Score = 31.8 bits (63), Expect = 4.2 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +2 / +3 Query: 17 LCPAHTRRRPRPHGLLAVKLAPSVDPVP 100 L P RRRPRP G L + L P P P Sbjct: 141 LRPPPRRRRPRPGGALLLLLPPPPPPAP 224
>LOC_Os03g04610:12003.t00338:unspliced-genomic expressed protein| Length = 1051 Score = 25.8 bits (50), Expect(2) = 4.3 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 / -2 Query: 106 DSGHGIDGGRELHGEKAMGSRTTTGVSGAEGGE 8 D+G G DGGR GE G+ GGE Sbjct: 432 DAGGGRDGGRRGGGEAEERGGGEGGLEALVGGE 334 Score = 25.4 bits (49), Expect(2) = 4.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 / -3 Query: 448 P*RRLAQKIQRSNEARPPAWEPPNYS*SSAAST 350 P R+ Q+ + RPP PP ++ +S A T Sbjct: 668 PLGRVEQRNRTERPRRPPQHRPPTHTATSEAMT 570
>LOC_Os10g35950:12010.t02883:unspliced-genomic 10-deacetylbaccatin III 10-O-acetyltransferase, putative, expressed| Length = 2699 Score = 31.3 bits (62), Expect = 5.8 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 / +3 Query: 85 GGRELHGEKAMGSRTTTGVSGAEGGEAA 2 GG E+HGE+ G G + AEG E A Sbjct: 75 GGAEVHGEEEAGGAGGAGGADAEGAEEA 158
>LOC_Os05g11950:12005.t01025:unspliced-genomic esterase precursor, putative, expressed| Length = 2799 Score = 31.3 bits (62), Expect = 5.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 / -2 Query: 454 GVP*RRLAQKIQRSNEARPPAWEPPNYS*SSAAS 353 G P RR + +R+ PP W PP ++ SS+ S Sbjct: 905 GSPARRRGARPRRAAARCPPPWRPPRWAPSSSPS 804
>LOC_Os02g50370:12002.t04621:unspliced-genomic ATP binding protein, putative, expressed| Length = 6094 Score = 31.3 bits (62), Expect = 5.8 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 / -2 Query: 291 AQEMEVPATDDCYPDGAYYYVEAAD 365 A+ M++PATD C+P Y +EAA+ Sbjct: 4953 AKHMQIPATDWCHPV*VNYAMEAAN 4879
>LOC_Os02g45450:12002.t04132:unspliced-genomic dehydration-responsive element-binding protein 1A, putative,| expressed Length = 1272 Score = 31.3 bits (62), Expect = 5.8 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 / -1 Query: 41 RPRPHGLLAVKLAPSVDPVPGV 106 RP P+ LLAV+LA P PGV Sbjct: 294 RPEPYPLLAVRLAHLAHPPPGV 229
>LOC_Os09g02380:12009.t00137:unspliced-genomic hypothetical protein| Length = 555 Score = 30.9 bits (61), Expect = 7.9 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / +3 Query: 20 CPAHTRRRPRPHGLLAVKLAP 82 CP H RRRPRP L + P Sbjct: 243 CPLHERRRPRPRPFLRLPQPP 305
>LOC_Os12g28390:12012.t02549:unspliced-genomic conserved hypothetical protein| Length = 1589 Score = 25.8 bits (50), Expect(2) = 8.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 / +1 Query: 421 QRSNEARPPAWEPP 380 + ++ARP AW+PP Sbjct: 727 EEGDDARPGAWDPP 768 Score = 24.9 bits (48), Expect(2) = 8.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 / +1 Query: 88 DGGRELHGEKAMGSRTTTGVSGAE 17 +GGRE GEK R T G+ A+ Sbjct: 967 EGGREGEGEKKREERETFGLGLAQ 1038
>LOC_Os02g09170:12002.t00764:unspliced-genomic sucrose-phosphate synthase 1, putative, expressed| Length = 8388 Score = 25.4 bits (49), Expect(2) = 8.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -1 / +2 Query: 405 RGLLPGNLLTTPDHQXXXXXXXXXXXXXRLWLGPPS 298 R LLPG LL H R WL PPS Sbjct: 263 RPLLPGALLRRGGHHRVRRDRPLQDMAPRAWLPPPS 370 Score = 22.1 bits (42), Expect(2) = 8.9 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -3 / +2 Query: 442 RRLAQKIQRSNEARPPAWEPP 380 RR ++ Q N RPP PP Sbjct: 194 RRHPRRRQGGNRRRPPLAPPP 256 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 141,644,057 Number of extensions: 1767641 Number of successful extensions: 8288 Number of sequences better than 10.0: 15 Length of query: 194 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 146 Effective length of database: 52,912,542 Effective search space: 7725231132 Effective search space used: 7725231132 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)