ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf88n03 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os03g19370:12003.t01703:unspliced-genomic ocs element-binding factor 1, putative, expressed| Length = 1406 Score = 103 bits (219), Expect = 1e-21 Identities = 48/98 (48%), Positives = 63/98 (64%) Frame = +2 / +2 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNEAMRVTTALMXXXXXXXXXXNRVLSADARY 181 +RLSA+RSR+K+QQ L A QL +N+AMR + NRVL+A AR Sbjct: 785 NRLSAQRSRIKKQQYVDGLAVEAEQLRRENDAMRAGAGAVLQRCRLVEQENRVLAAHARE 964 Query: 182 LYSLLEQQNSQLRVLGELAGVPMDVQEIPVHLTQLYGG 295 L S L+ + SQLR+LGE+AGVP+DV ++ HL QLYGG Sbjct: 965 LCSALQLRASQLRLLGEVAGVPLDVPDVADHLVQLYGG 1078 Score = 94.5 bits (200), Expect = 6e-19 Identities = 47/97 (48%), Positives = 53/97 (54%) Frame = -1 / -3 Query: 294 PPYSCVRWTGISCTSIGTPASSPSTRSWEFCCSRRLYR*RASAESTRFCCWTRLHCCCMR 115 PP SC RW+ S TS GTPA+SPS RS E L+ RA A STRF C TR H C Sbjct: 1077 PP*SCTRWSATSGTSRGTPATSPSRRSCEARSWSALHSSRACAASTRFSCSTRRHRCSTA 898 Query: 114 AVVTRMASLSISSWAARAVRLPSRCCLFTRDLRAERR 4 RMAS S S +A + CC F RDL A+ R Sbjct: 897 PAPARMASFSRRSCSASTASPSTYCCFFMRDLCADSR 787 Score = 54.2 bits (112), Expect(2) = 2e-11 Identities = 28/49 (57%), Positives = 30/49 (61%) Frame = +3 / +3 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 RT CS RT A+C A SS SSACSG A TC SP+TS S TAA Sbjct: 933 RTGCSPRTRASCAARSSSAPRSSACSGRWQACPSTCPTSPTTSCSSTAA 1079 Score = 34.1 bits (68), Expect(2) = 2e-11 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 / +1 Query: 4 PPLGAEVPRKEAAARGQSDR 63 P +GAEVP KEAA RG++ R Sbjct: 787 PAVGAEVPHKEAAVRGRAGR 846 Score = 69.3 bits (145), Expect = 2e-11 Identities = 39/98 (39%), Positives = 47/98 (47%) Frame = -3 / -2 Query: 295 AAVQLREVDGDFLHVHRNAGELPEHAELGVLLLQKAVQVASVRREHXXXXXXXXXXXLHE 116 AAV+L EV GD HV +A LPE AEL L++A Q+A VR EH H Sbjct: 1078 AAVELHEVVGDVGHVEGHACHLPEQAELRGAELERAAQLARVRGEHPVLLLDQAAPLQHG 899 Query: 115 GGGDAHGLVIDLELGRASGQTXXXXXXXXXXXPRREAV 2 G AHG+V+ EL R GQ RR+ V Sbjct: 898 AGAGAHGVVLPPELLRLHGQPVHVLLLLYAGPLRRQPV 785 Score = 31.8 bits (63), Expect = 4.5 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -2 / -1 Query: 77 AGPRERSDCPRAAASLRGTSAPRGG 3 A P R PR AASL GTSAP G Sbjct: 860 AAPPPRPARPRTAASLCGTSAPTAG 786
>LOC_Os12g37410:12012.t03421:unspliced-genomic ocs element-binding factor 1, putative, expressed| Length = 1296 Score = 58.8 bits (122), Expect = 3e-08 Identities = 32/87 (36%), Positives = 44/87 (50%) Frame = +2 / +3 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNEAMRVTTALMXXXXXXXXXXNRVLSADARY 181 +R SARRSR+++QQ L A+L+ DN + + + N VL A A Sbjct: 651 NRESARRSRLRKQQHLDELVQEVARLQADNARVLARASEIAGQYARVEQENTVLRARAAE 830 Query: 182 LYSLLEQQNSQLRVLGELAGVPMDVQE 262 L L N LRV+ E +GV MD+QE Sbjct: 831 LGDRLRSVNEVLRVVEEFSGVAMDIQE 911 Score = 33.6 bits (67), Expect = 1.3 Identities = 18/55 (32%), Positives = 23/55 (41%) Frame = -1 / -3 Query: 174 ASAESTRFCCWTRLHCCCMRAVVTRMASLSISSWAARAVRLPSRCCLFTRDLRAE 10 A A ST F C TR +C + +LS S A CC +RD A+ Sbjct: 823 ARARSTVFSCSTRAYCPAISLARASTRALSACSLATSCTSSSRCCCFRSRDRLAD 659 Score = 32.7 bits (65), Expect = 2.4 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = +3 / +1 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 RT CS R + ++ T SA S SS A WT R+S + C+ Sbjct: 799 RTRCSGRAPPSSATGCAASTRCSASSRSSAASPWTSRRSAPPTTRCS 939
>LOC_Os05g03860:12005.t00283:unspliced-genomic ocs element-binding factor 1, putative, expressed| Length = 1452 Score = 40.5 bits (82), Expect(2) = 2e-04 Identities = 25/75 (33%), Positives = 34/75 (45%) Frame = +2 / +2 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNEAMRVTTALMXXXXXXXXXXNRVLSADARY 181 +R SARRSR ++QQR L A AA+L+ +N + N VL A Sbjct: 653 NRESARRSRARKQQRLEELIAEAARLQAENARVEAQIGAYAGELSKVDGENAVLRARHGE 832 Query: 182 LYSLLEQQNSQLRVL 226 L L+ S L +L Sbjct: 833 LAGRLQALGSVLEIL 877 Score = 23.5 bits (45), Expect(2) = 2e-04 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +2 / +2 Query: 230 ELAGVPMDVQEIP 268 ++AG P+D+ EIP Sbjct: 878 QVAGAPVDIPEIP 916
>LOC_Os07g01560:12007.t00055:unspliced-genomic sugar transport protein 1, putative, expressed| Length = 5212 Score = 39.6 bits (80), Expect = 0.020 Identities = 18/38 (47%), Positives = 24/38 (63%) Frame = +3 / +2 Query: 162 SLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPST 275 S RT T ++ ++R SACSG+S A WTCR+S T Sbjct: 3353 SSRTPPTRSSTGATRRRRSACSGASAAPTWTCRRSTRT 3466
>LOC_Os05g29750:12005.t02575:unspliced-genomic cytochrome P450 71E1, putative, expressed| Length = 1809 Score = 39.6 bits (80), Expect = 0.020 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = +3 / +2 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 W RT S SGS+ RW+CR+ P R C A Sbjct: 206 WPRRTGPSCGSGSAACRRWSCRRPPPPRRCCARA 307
>LOC_Os01g42900:12001.t03807:unspliced-genomic ATPase, coupled to transmembrane movement of substances, putative,| expressed Length = 1992 Score = 38.6 bits (78), Expect(2) = 0.022 Identities = 17/30 (56%), Positives = 17/30 (56%) Frame = +3 / +2 Query: 201 SRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 S SSA S SSPA W R SP T SCT Sbjct: 1649 SSRASSAASSSSPATSWRARTSPGTGCSCT 1738 Score = 21.7 bits (41), Expect(2) = 0.022 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 / +2 Query: 162 SLRTLATCTAFWSSRTPSS 218 SL T + + WS+ TPSS Sbjct: 1016 SLPTSTSSSTPWSASTPSS 1072
>LOC_Os05g40650:12005.t03604:unspliced-genomic ATCHX15, putative, expressed| Length = 3108 Score = 39.1 bits (79), Expect = 0.028 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +3 / +1 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 R TC + + T S+CS S+ + RWT SPST RS Sbjct: 1882 RCTRTCACWRRTSTSRSSCSRSTSSRRWTAAWSPSTRRS 1998
>LOC_Os03g52860:12003.t04608:unspliced-genomic lipoxygenase 2, putative, expressed| Length = 3514 Score = 30.4 bits (60), Expect(2) = 0.066 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 / +3 Query: 150 RTACSLRTLATCTAFWSSRTPSSA 221 R CS RT T T W S TPSS+ Sbjct: 2568 RCGCSSRTTRTPTTGWPSGTPSSS 2639 Score = 24.9 bits (48), Expect(2) = 0.066 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 / +3 Query: 201 SRTPSSACSGSSPAFRWTCRKS 266 S TP++ACS ++P+ R R+S Sbjct: 2661 STTPTTACSRATPSCRRGGRRS 2726
>LOC_Os05g48630:12005.t04297:unspliced-genomic expressed protein| Length = 986 Score = 37.7 bits (76), Expect = 0.072 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 / -2 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPS 272 R L CT W R P + + RW+CR+ PS Sbjct: 238 RVLLVCTCGWCGRAPGATA*RRASCRRWSCRRGPS 134
>LOC_Os10g28060:12010.t02161:unspliced-genomic fatty acid elongase, putative, expressed| Length = 5131 Score = 37.3 bits (75), Expect = 0.099 Identities = 19/47 (40%), Positives = 26/47 (55%) Frame = +3 / +2 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 RT S + C+A +SR P+SACS S+PA SP +S + T Sbjct: 590 RTPSSSASSTRCSASPASRRPTSACSSSTPASSPRRPPSPRSSSTAT 730
>LOC_Os02g03960:12002.t00295:unspliced-genomic ocs element-binding factor 1, putative, expressed| Length = 1766 Score = 37.3 bits (75), Expect = 0.099 Identities = 23/72 (31%), Positives = 32/72 (44%) Frame = +2 / +2 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNEAMRVTTALMXXXXXXXXXXNRVLSADARY 181 +R SARRSR+++Q+ LTA+ A L +N + L N VL A Sbjct: 959 NRESARRSRMRKQRHLDDLTAQVAHLRRENAHVATALGLTTQGLLAVDAENAVLRTQAAE 1138 Query: 182 LYSLLEQQNSQL 217 L + L N L Sbjct: 1139 LAARLASLNDIL 1174
>LOC_Os07g03220:12007.t00212:unspliced-genomic bZIP transcription factor family protein, expressed| Length = 576 Score = 30.4 bits (60), Expect(2) = 0.13 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 / +1 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNEAM 100 +R SARRSR +R+QR L A +L + A+ Sbjct: 250 NRESARRSRARRRQRVEELERAADELRAERRAL 348 Score = 24.0 bits (46), Expect(2) = 0.13 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 / +2 Query: 183 CTAFWSSRTPSSACSGSSPAFR 248 C A TP ACSG++ A R Sbjct: 389 CAARTRGTTPRRACSGAASARR 454
>LOC_Os04g45920:12004.t04124:unspliced-genomic protein kinase APK1B, chloroplast precursor, putative, expressed| Length = 2680 Score = 27.6 bits (54), Expect(2) = 0.16 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 / +3 Query: 213 SSACSGSSPAFRWTCRKSPSTSRSCTAA 296 S+A S +SPA R T SPS + TAA Sbjct: 834 STAASSASPASRPTAPPSPSRGSTPTAA 917 Score = 26.3 bits (51), Expect(2) = 0.16 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 / +2 Query: 177 ATCTAFWSSRTPSSACSGSS 236 +TCT+ W+S PS++ S S Sbjct: 653 STCTSSWASTRPSASSSAVS 712
>LOC_Os05g40770:12005.t03616:unspliced-genomic protein kinase, putative, expressed| Length = 6142 Score = 36.3 bits (73), Expect = 0.19 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +3 / +2 Query: 162 SLRTLATCTAFWSSRTPSSACSGSSPA 242 S++T C A WSSRT SS C G + A Sbjct: 4424 SVQTATQCRALWSSRTRSSCCPGCTTA 4504
>LOC_Os03g56010:12003.t04860:unspliced-genomic ocs element-binding factor 1, putative| Length = 456 Score = 36.3 bits (73), Expect = 0.19 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +2 / +1 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNEAMRVTTALMXXXXXXXXXXNRVLSADARY 181 +RLSARRSR ++QQR L +A+L +N + + N L A+A Sbjct: 187 NRLSARRSRARKQQRLEELRGESARLRAENRELAARLHAVARHGLAARCQNARLRAEAAA 366 Query: 182 L 184 L Sbjct: 367 L 369
>LOC_Os09g16910:12009.t01478:unspliced-genomic cysteine desulfurase, mitochondrial precursor, putative, expressed| Length = 4565 Score = 35.9 bits (72), Expect = 0.26 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 / +3 Query: 204 RTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 R PS AC+ WTCR+ P ++R C+ Sbjct: 228 R*PSRACASRGGRCTWTCRRPPPSTRGCS 314
>LOC_Os01g73810:12001.t06661:unspliced-genomic ATCHX15, putative| Length = 777 Score = 35.9 bits (72), Expect = 0.26 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 / +2 Query: 180 TCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 TC ++ + T S+CS S+ + RWT SPS RS Sbjct: 11 TCASWRRTSTSRSSCSRSTSSRRWTAAWSPSMRRS 115
>LOC_Os03g61070:12003.t05340:unspliced-genomic expressed protein| Length = 3291 Score = 27.2 bits (53), Expect(3) = 0.29 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -1 / -3 Query: 552 TLVYYTYKFTRNSHSSSKTKVAIAHVITLPVPHKHALHYTQYDNMLPSQ 406 +L++ + +T K + I+ + T+P P +H LHY + P Q Sbjct: 2254 SLLHRVHLYTTIRKLDRK*IMKISTIGTMPCPREHKLHYYITNEDRPQQ 2108 Score = 24.9 bits (48), Expect(3) = 0.29 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 / -2 Query: 294 PPYSCVRWTGISC 256 PP SC RW G C Sbjct: 530 PPRSCRRWRGRPC 492 Score = 23.5 bits (45), Expect(3) = 0.29 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = -1 / -2 Query: 144 WTRLHCCCMRAVVTRMASLSISSWAARAVRLPSRCC 37 W CC R + R S +I+ R RCC Sbjct: 509 WRGRPCCRSRGGIRRRTSEAIAPHRGCRRRRGRRCC 402
>LOC_Os07g09300:12007.t00805:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 11907 Score = 35.4 bits (71), Expect = 0.35 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 / +2 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 W + PSS C S+P R TC +P TS +A Sbjct: 215 WCTSPPSSTCPASTPPSRSTCSLAPPTSPPSSA 313
>LOC_Os03g04120:12003.t00293:unspliced-genomic AMP binding protein, putative, expressed| Length = 2103 Score = 35.4 bits (71), Expect = 0.35 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 / -1 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 W +P + S SSP+ W R++P +S C AA Sbjct: 1791 WPWPSPGARTSASSPSTSWAGRRTPPSSAPCNAA 1690
>LOC_Os09g28620:12009.t02540:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1505 Score = 35.0 bits (70), Expect = 0.48 Identities = 16/32 (50%), Positives = 21/32 (65%) Frame = +3 / +1 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 S+ TP+S + SSP+FR R SPS+S S A Sbjct: 400 STPTPASPSASSSPSFRSPPRSSPSSSSSTAA 495
>LOC_Os04g49220:12004.t04438:unspliced-genomic tim10/DDP family zinc finger containing protein| Length = 5344 Score = 35.0 bits (70), Expect = 0.48 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +3 / -2 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTS 278 S+ TP++ C+ +SPA RW+C + TS Sbjct: 3990 SAPTPATRCTSTSPAVRWSC*RG*GTS 3910
>LOC_Os04g32440:12004.t02923:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2911 Score = 35.0 bits (70), Expect = 0.48 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -2 / -3 Query: 470 HYQYHTNTHYITHNMIICSRVRATGDSLHR 381 H +H TH+I H+ C R+ T SLHR Sbjct: 782 HIHHHYRTHHIHHHYHRCLRLHCTNCSLHR 693
>LOC_Os03g06570:12003.t00524:unspliced-genomic calmodulin binding protein, putative, expressed| Length = 2119 Score = 35.0 bits (70), Expect = 0.48 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 / +1 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSR 281 W RTP S S PA R +CR++PS R Sbjct: 421 WPRRTPRPPPSASPPARRTSCRRAPSRRR 507
>LOC_Os07g32620:12007.t02944:unspliced-genomic anthocyanidin 5,3-O-glucosyltransferase, putative, expressed| Length = 1665 Score = 28.1 bits (55), Expect(2) = 0.56 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 / +2 Query: 129 CCCMRAVVTRMASLSISSWAARAVRLPSRCCLFTRDLR 16 CCC R TR S W AR+ R C R R Sbjct: 491 CCCARRGSTRRWPSSSRRWTARSASPGCRRCRRPRSRR 604 Score = 24.0 bits (46), Expect(2) = 0.56 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 / +2 Query: 243 TPASSPSTRSWEFCCSRR 190 T S + R W CC+RR Sbjct: 455 TCTSPAARRCWRCCCARR 508
>LOC_Os09g23820:12009.t02065:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 2234 Score = 34.5 bits (69), Expect = 0.66 Identities = 19/49 (38%), Positives = 21/49 (42%) Frame = +3 / +1 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 R C C W SRT SSA SG R R PST+ S + A Sbjct: 1816 RRRCGCTRRRRCCRGWRSRTSSSAASGCRGGCRCGSRCWPSTTTSPSGA 1962
>LOC_Os09g15540:12009.t01342:unspliced-genomic F-box domain containing protein, expressed| Length = 1609 Score = 34.5 bits (69), Expect = 0.66 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 / +3 Query: 177 ATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 A CT W +RTP S C+ + RW+ + S S + Sbjct: 939 ALCTGDWMARTPCSLCTRPRQSSRWSRSRRSSESHT 1046
>LOC_Os06g43384:12006.t04028:unspliced-genomic cytochrome P450 71D10, putative, expressed| Length = 4686 Score = 34.5 bits (69), Expect = 0.66 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 / +2 Query: 189 AFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSC 287 A W + T S CSGS+ RW CR+ R C Sbjct: 185 ATWRAATGRS*CSGSARCPRWWCRRGTRRGR*C 283
>LOC_Os03g61280:12003.t05361:unspliced-genomic expressed protein| Length = 3355 Score = 34.5 bits (69), Expect = 0.66 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 / +1 Query: 608 FFFFHKLDLFIYCIEQHITLLCTTRTSS 525 F F ++DLFIYC E H ++C+ SS Sbjct: 3100 FRLFVQIDLFIYCTEFHSFVICSMHPSS 3183
>LOC_Os03g04130:12003.t00294:unspliced-genomic AMP binding protein, putative, expressed| Length = 2860 Score = 34.5 bits (69), Expect = 0.66 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 / -1 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 W +P + S SSP+ W ++P +S C AA Sbjct: 2548 WPGPSPGARTSASSPSTSWANHRTPPSSAPCNAA 2447
>LOC_Os02g56010:12002.t05175:unspliced-genomic anthocyanidin 3-O-glucosyltransferase, putative| Length = 2924 Score = 34.5 bits (69), Expect = 0.66 Identities = 18/45 (40%), Positives = 26/45 (57%) Frame = +3 / +2 Query: 156 ACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 A S AT ++ S T S A SGS P+ R +CR+ P++S + T Sbjct: 1808 ASSSTAAATSSSPPSCSTSSPASSGSPPSPRGSCRRRPTSSPTTT 1942
>LOC_Os01g25460:12001.t02262:unspliced-genomic extensin-like protein, putative, expressed| Length = 1844 Score = 34.5 bits (69), Expect = 0.66 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = +3 / +2 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 TA S R+ A C+A SS T +S + S+ FR + +P+T S T Sbjct: 608 TASSARSPARCSASPSSATSTSGSTTSTAPFRRSSSSAPTTPSSST 745
>LOC_Os08g14190:12008.t01295:unspliced-genomic flavonol 3-sulfotransferase, putative, expressed| Length = 3069 Score = 34.5 bits (69), Expect = 0.67 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 / +1 Query: 276 RWTGISCTSIGTPASSPSTRSWEFCC 199 RW G SC SI + ASSPS + + C Sbjct: 1813 RWRGSSCFSIVSQASSPSVLKYNYLC 1890
>LOC_Os08g01220:12008.t00022:unspliced-genomic VAMP protein SEC22, putative, expressed| Length = 1567 Score = 29.5 bits (58), Expect(2) = 0.76 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 / +1 Query: 300 CRPPYSCVRWTGISCTSIGTPASSPSTRSWEFCCSRRLYR 181 CRPP T ++ P +PSTR+ C RR R Sbjct: 598 CRPPSPPATATSAWASTTTAPTCTPSTRASASPCRRRCRR 717 Score = 22.1 bits (42), Expect(2) = 0.76 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 / +2 Query: 459 PHKHALHYTQYDNMLPSQSHGRLP 388 PH+ A ++LP + H RLP Sbjct: 452 PHRLAHPPPHQASLLPQRPHRRLP 523
>LOC_Os11g45280:12011.t04056:unspliced-genomic ATP binding protein, putative, expressed| Length = 7159 Score = 34.1 bits (68), Expect = 0.91 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 / +1 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSC 287 R +C+A+ + +P+ SGS + C SPST+ SC Sbjct: 520 RRRGSCSAWAAPDSPTGTTSGSCTRWGRPCTSSPSTASSC 639
>LOC_Os10g38420:12010.t03085:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1223 Score = 34.1 bits (68), Expect = 0.91 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +2 / +2 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNE 94 +R SARRSR KR+Q EG +T + E + E Sbjct: 110 ERASARRSRPKRRQGEGRMTPAGGKREKEGE 202
>LOC_Os10g05860:12010.t00459:unspliced-genomic proline-rich protein, putative, expressed| Length = 1135 Score = 34.1 bits (68), Expect = 0.91 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 / +3 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 R S RT CT S T ++ + P+ T P+ SRSCTA Sbjct: 345 RWRSSARTATVCTRARPSATSTATAPSACPSPLTTSTAPPTASRSCTA 488
>LOC_Os10g05820:12010.t00456:unspliced-genomic proline-rich protein, putative, expressed| Length = 1159 Score = 34.1 bits (68), Expect = 0.91 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 / +3 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 R S RT CT S T ++ + P+ T P+ SRSCTA Sbjct: 324 RWRSSARTATVCTRARPSATSTATAPSACPSPLTTSTAPPTASRSCTA 467
>LOC_Os06g08310:12006.t00712:unspliced-genomic ATPase 8, plasma membrane-type, putative, expressed| Length = 4846 Score = 34.1 bits (68), Expect = 0.91 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 / +3 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 SSR P S CS S RW R+SP T +A Sbjct: 2604 SSRGPGSCCSSPSSLRRWWRRRSPCTRAGISA 2699
>LOC_Os04g46940:12004.t04222:unspliced-genomic copper-transporting ATPase 3, putative, expressed| Length = 5763 Score = 34.1 bits (68), Expect = 0.91 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 / +3 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSC 287 SSR P SAC SPA RW S++ C Sbjct: 5424 SSRRPGSACRHGSPALRWLLPPLASSAGPC 5513
>LOC_Os03g48590:12003.t04216:unspliced-genomic protein transport protein Sec61 alpha subunit isoform B, putative,| expressed Length = 1513 Score = 34.1 bits (68), Expect = 0.91 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = +3 / +3 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 +A + + A W PSS+ +S A W CR T R+ TAA Sbjct: 813 SAAAAAAASPTCAAWPPPAPSSSPPSTSRACAWRCRCGRGTRRAATAA 956
>LOC_Os02g56260:12002.t05199:unspliced-genomic expressed protein| Length = 3624 Score = 34.1 bits (68), Expect = 0.91 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +3 / +2 Query: 177 ATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 A T S+ +P + S ++ A RW C +SP++S S T Sbjct: 656 AATTTPASASSPPATTSSTTAASRWRCSRSPTSSTSST 769
>LOC_Os02g09830:12002.t00830:unspliced-genomic ocs element-binding factor 1, putative, expressed| Length = 840 Score = 34.1 bits (68), Expect = 0.91 Identities = 20/71 (28%), Positives = 34/71 (47%) Frame = +2 / +3 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNEAMRVTTALMXXXXXXXXXXNRVLSADARY 181 +R SARRSRV++Q+R L+++ ++L N+ + V M N L +A Sbjct: 339 NRESARRSRVRKQRRLDELSSQVSELRDTNQRLLVELNHMISKHARIVRENSQLREEASD 518 Query: 182 LYSLLEQQNSQ 214 L L + + Sbjct: 519 LQRKLSEMKME 551
>LOC_Os01g67890:12001.t06146:unspliced-genomic SRF-type transcription factor family protein| Length = 1452 Score = 34.1 bits (68), Expect = 0.91 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = +3 / +2 Query: 177 ATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 AT T+ + R P S+ S W CR +PSTSRS Sbjct: 803 ATATSTTTPRRPPSSRSPRPRRTPWHCRTTPSTSRS 910
>LOC_Os02g02140:12002.t00114:unspliced-genomic receptor protein kinase CLAVATA1 precursor, putative, expressed| Length = 3442 Score = 34.1 bits (68), Expect = 0.92 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 / +2 Query: 276 RWTGISCTSIGTPASSPSTRSWEFCCS 196 RW G +CT+ G+ A SPS CCS Sbjct: 1415 RWCGCACTATGSTARSPSGSGSCRCCS 1495
>LOC_Os01g12180:12001.t01086:unspliced-genomic expressed protein| Length = 2532 Score = 34.1 bits (68), Expect = 0.92 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 / +1 Query: 442 *CVFVWYW*CDDVSYGYFCFGTTM*VSCELVRVVHKSVM 558 *C F+W C + Y Y+C T+ VSC + ++ K V+ Sbjct: 2224 *C*FIWLNFCWSL*YSYYCTYLTLVVSCTYIFLLEKLVL 2340
>LOC_Os10g28590:12010.t02210:unspliced-genomic CAF1 family ribonuclease containing protein| Length = 3550 Score = 29.9 bits (59), Expect(3) = 1.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 / +3 Query: 273 WTGISCTSIGTPASSPSTRSW 211 W G S T TPA + S+RSW Sbjct: 1368 WAGSSTTWCSTPAQAGSSRSW 1430 Score = 22.1 bits (42), Expect(3) = 1.0 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 / +1 Query: 71 PRERSDCPRAA 39 PR + CPRAA Sbjct: 3478 PRHKDGCPRAA 3510 Score = 21.7 bits (41), Expect(3) = 1.0 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -1 / +2 Query: 222 TRSWEFCCSRR 190 +R+W+FC S R Sbjct: 3056 SRAWKFCISSR 3088
>LOC_Os04g28860:12004.t02581:unspliced-genomic conserved hypothetical protein| Length = 5860 Score = 30.4 bits (60), Expect(2) = 1.2 Identities = 17/70 (24%), Positives = 26/70 (37%) Frame = -1 / -1 Query: 276 RWTGISCTSIGTPASSPSTRSWEFCCSRRLYR*RASAESTRFCCWTRLHCCCMRAVVTRM 97 RW + +P S + R+ R + S R CCW R C+ A + Sbjct: 442 RWPAAAAAGFASPISPVACRAVPAATGRTRRGGASCCPSDRLCCWRRSAGRCVPAA*SAA 263 Query: 96 ASLSISSWAA 67 A ++AA Sbjct: 262 AHRRSRAYAA 233 Score = 25.4 bits (49), Expect(2) = 1.2 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = -2 / -2 Query: 557 ITLLCTTRTSSQETHIVVPK 498 +++ CT + S++ HI++PK Sbjct: 1347 VSIPCTCKRISKQMHIILPK 1288
>LOC_Os07g05830:12007.t00466:unspliced-genomic ZIM motif family protein, expressed| Length = 2282 Score = 31.3 bits (62), Expect(2) = 1.2 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = +3 / -3 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSP 239 ++ S R +A TA W++R+P +A S S+P Sbjct: 2250 SSSSSRGIAAATASWTARSPPAAGSSSAP 2164 Score = 23.1 bits (44), Expect(2) = 1.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 / -1 Query: 499 FGTTM*VSCELVRVVHKSVMC 561 FGTT ++C +VR+ C Sbjct: 1175 FGTTRGINCSVVRIFKFQPCC 1113
>LOC_Os12g33160:12012.t03009:unspliced-genomic RGH1A, putative, expressed| Length = 5367 Score = 33.6 bits (67), Expect = 1.3 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +3 / -3 Query: 180 TCTAFWSSRTPSSACSGSSP 239 +C+AFW ++TP+S+CS P Sbjct: 5185 SCSAFWVAQTPNSSCSFKQP 5126
>LOC_Os09g32370:12009.t02852:unspliced-genomic expressed protein| Length = 2273 Score = 33.6 bits (67), Expect = 1.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 / +2 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 ++ +P + C G+ PA RWTC + SR +A Sbjct: 1523 ATASPCATCPGACPARRWTCAWRSACSRRSSA 1618
>LOC_Os05g31080:12005.t02705:unspliced-genomic conserved hypothetical protein| Length = 1582 Score = 33.6 bits (67), Expect = 1.3 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 / -1 Query: 180 TCTAFWSSRTPSSACSGSS 236 TC WS R PS++CSG S Sbjct: 1417 TCVEAWSGRAPSTSCSGGS 1361
>LOC_Os05g19010:12005.t01668:unspliced-genomic expressed protein| Length = 781 Score = 33.6 bits (67), Expect = 1.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 / -2 Query: 189 AFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 ++WS +SA S PA W PS+ RSC+ A Sbjct: 687 SWWSGARGTSAGMSSPPARGWVISPPPSSRRSCSKA 580
>LOC_Os02g35000:12002.t03138:unspliced-genomic chaperone protein dnaJ 10, putative, expressed| Length = 2858 Score = 33.6 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 / +2 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSRSC 287 W R S+ CS S+P T P+TSRSC Sbjct: 374 WRRRPSSTTCSASAPPPPTTRSARPTTSRSC 466
>LOC_Os02g06480:12002.t00546:unspliced-genomic protein SCO1, mitochondrial precursor, putative, expressed| Length = 6427 Score = 33.6 bits (67), Expect = 1.3 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 / -1 Query: 183 CTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 CT W+ + +G S A RW R ST RSC A Sbjct: 5398 CTTSWTPAASCCSFAGRSSARRW*GRSRGSTRRSCRIA 5285
>LOC_Os02g06470:12002.t00545:unspliced-genomic F-box domain containing protein, expressed| Length = 1863 Score = 33.6 bits (67), Expect = 1.3 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 / +1 Query: 183 CTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 CT W+ + +G S A RW R ST RSC A Sbjct: 1030 CTTSWTPAASCCSFAGRSSARRW*GRSRGSTRRSCRIA 1143
>LOC_Os10g04674:12010.t00350:unspliced-genomic disease resistance protein RPM1, putative, expressed| Length = 11210 Score = 33.6 bits (67), Expect = 1.3 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 / +3 Query: 394 SPVALTREHIIILCVM*CVFVWYW*CDDVSYGYF 495 S LT + I ++CV *CVF+WY D++ G + Sbjct: 10941 SRFTLTYKVIFVVCVP*CVFLWYNRLHDLTGGLY 11042
>LOC_Os08g19160:12008.t01737:unspliced-genomic endosomal P24A protein precursor, putative, expressed| Length = 2356 Score = 33.6 bits (67), Expect = 1.3 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -1 / +1 Query: 297 RPPYSCVRWTGISCTSIGTPASSPSTRSWEFCCSRR 190 RPP + +RW+ +C G +S RSW S R Sbjct: 811 RPPGATLRWSACACGPTGRSSSPTRWRSWRAASSGR 918
>LOC_Os06g15370:12006.t01410:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 4592 Score = 33.6 bits (67), Expect = 1.3 Identities = 15/50 (30%), Positives = 22/50 (44%) Frame = -1 / -3 Query: 174 ASAESTRFCCWTRLHCCCMRAVVTRMASLSISSWAARAVRLPSRCCLFTR 25 A S C CCC AV+TRM + I + + +RC + +R Sbjct: 3714 ARRRSMVLACCRAKVCCCEYAVITRMPAAQIGPMRSSDLSSSTRCTVLSR 3565
>LOC_Os03g09290:12003.t00782:unspliced-genomic protein yippee-like OJ1003C07.11, putative, expressed| Length = 2564 Score = 33.6 bits (67), Expect = 1.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 / +1 Query: 285 SCVRWTGISCTSIGTPASSPSTRS 214 SC WTG C+S G AS+P R+ Sbjct: 262 SCSDWTGTGCSSAGDAASTPRPRT 333
>LOC_Os09g10340:12009.t00826:unspliced-genomic cytochrome P450 71D7, putative, expressed| Length = 2229 Score = 25.8 bits (50), Expect(2) = 1.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 / +3 Query: 237 ASSPSTRSWEFCCSRRLYR*RASA 166 AS PSTR W R R RASA Sbjct: 1020 ASGPSTRRWTASSRRSSPRGRASA 1091 Score = 24.9 bits (48), Expect(2) = 1.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 / +1 Query: 283 LREVDGDFLHVHRNAGELPEHAELG 209 L ++DGD H HR+ + P H G Sbjct: 970 LPDMDGDPRHGHRHEAQPPGHLHDG 1044
>LOC_Os04g53810:12004.t04854:unspliced-genomic leucoanthocyanidin reductase, putative, expressed| Length = 2155 Score = 26.3 bits (51), Expect(2) = 1.3 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -1 / +2 Query: 294 PPYSCVRWTGISCTSIGTPASSPSTRSWEFCCSRRLY 184 P +C RW + +S P + ST C RR Y Sbjct: 893 PSPACGRWKAPAMSSTSRPGPTSSTSDPWRSCRRRRY 1003 Score = 24.4 bits (47), Expect(2) = 1.3 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -1 / +3 Query: 138 RLHCCCMRAVVTR 100 R HCCCM TR Sbjct: 1068 RRHCCCMHCRRTR 1106
>LOC_Os06g10950:12006.t00972:unspliced-genomic galactoside 2-alpha-L-fucosyltransferase, putative, expressed| Length = 1966 Score = 28.6 bits (56), Expect(2) = 1.3 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 / +3 Query: 201 SRTPSSACSGSSPAFRWT 254 +R +ACS S+PA RWT Sbjct: 822 TRCSPTACSSSTPATRWT 875 Score = 22.1 bits (42), Expect(2) = 1.3 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 / +2 Query: 152 NRVLSADARYLYSLL 196 NR+L+A + +LY++L Sbjct: 788 NRILAAASAFLYAML 832
>LOC_Os03g02330:12003.t00124:unspliced-genomic ATP binding protein, putative, expressed| Length = 1904 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 / +1 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 T+C+ R A +S PSSA S S A R R + S+ S T Sbjct: 1195 TSCTRRWRRASMAARASAPPSSARSCSPTARRRAARCATSSRSSST 1332 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +1 / +1 Query: 355 AGPAR*YHGRCRESPVALTR 414 AGPAR HGR R A TR Sbjct: 1381 AGPARAGHGRSRPRAPARTR 1440
>LOC_Os09g36870:12009.t03163:unspliced-genomic conserved hypothetical protein| Length = 1419 Score = 25.8 bits (50), Expect(2) = 1.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +3 / +2 Query: 228 GSSPAFRWTCRKSPSTSRSCTA 293 G++ + RW C + S+S SC++ Sbjct: 377 GATSSCRWWCSTAASSSSSCSS 442 Score = 24.9 bits (48), Expect(2) = 1.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +3 / +2 Query: 186 TAFWSSRTPSSACSGSSPAFRWT 254 +A SSRTP++A + ++ WT Sbjct: 239 SAISSSRTPATAAAAAAAVATWT 307
>LOC_Os01g62600:12001.t05634:unspliced-genomic laccase, putative| Length = 2225 Score = 25.8 bits (50), Expect(3) = 1.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 / +1 Query: 231 SPSTRSWEFCCSRRLYR 181 S STR W +CC R R Sbjct: 1753 SRSTRRWSWCCRARASR 1803 Score = 24.0 bits (46), Expect(3) = 1.4 Identities = 9/38 (23%), Positives = 14/38 (36%) Frame = -1 / +1 Query: 150 CCWTRLHCCCMRAVVTRMASLSISSWAARAVRLPSRCC 37 C W C + + T + W+ A+ RCC Sbjct: 2083 CVWQGCGSCTVTSTCT*AGACPWRGWSTTALCRVRRCC 2196 Score = 22.1 bits (42), Expect(3) = 1.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 / +1 Query: 267 GISCTSIGTPASSPS 223 G +CTS +SSPS Sbjct: 637 GFACTSTALSSSSPS 681
>LOC_Os12g44300:12012.t04096:unspliced-genomic monovalent cation proton antiporter, putative, expressed| Length = 2749 Score = 33.1 bits (66), Expect = 1.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 / +2 Query: 162 SLRTLATCTAFWSSRTPSSACSGSSPAFRW 251 S RT A+ + WSS +P C S P RW Sbjct: 974 SARTRASAST*WSSPSPGGRCCSSPPWARW 1063
>LOC_Os11g41350:12011.t03671:unspliced-genomic snRNP protein, putative| Length = 1179 Score = 33.1 bits (66), Expect = 1.7 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = +3 / +2 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPS 272 S RTP+SA S SS WTCR S Sbjct: 416 SGRTPASASSASSRRRSWTCRHGAS 490
>LOC_Os05g34210:12005.t03015:unspliced-genomic expressed protein| Length = 3703 Score = 33.1 bits (66), Expect = 1.7 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +3 / -2 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 T C +++ +A S+ + SS+CS SS A +C S S+S S Sbjct: 1317 TTCDSSSISLVSASSSTASGSSSCSSSSSAGAASCSSSSSSSSS 1186
>LOC_Os03g13400:12003.t01134:unspliced-genomic zinc finger, C2H2 type family protein, expressed| Length = 4103 Score = 33.1 bits (66), Expect = 1.7 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +3 / -2 Query: 180 TCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 TC ++ + S++ SSP RW R++ S++RS AA Sbjct: 3979 TCAIRRAAWSRSASAFSSSPRARWRARRASSSARSAAAA 3863
>LOC_Os02g10290:12002.t00877:unspliced-genomic copper-transporting ATPase 3, putative, expressed| Length = 6062 Score = 33.1 bits (66), Expect = 1.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 / +1 Query: 201 SRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 SR+P+S C SP W R+ S++R C ++ Sbjct: 5536 SRSPASGCRHGSPELAWRPRR*ASSARRCCSS 5631
>LOC_Os01g71690:12001.t06462:unspliced-genomic recA protein, expressed| Length = 6171 Score = 33.1 bits (66), Expect = 1.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +3 / +3 Query: 156 ACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 AC AT +SR +++CS +SP C +P T+R T Sbjct: 4977 ACDPSACATA*TATASRRGATSCSSTSPTASAPCASTPPTARPST 5111
>LOC_Os03g46400:12003.t04007:unspliced-genomic flavonol-3-O-glycoside-7-O-glucosyltransferase 1, putative, expressed| Length = 2278 Score = 33.1 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 / +1 Query: 147 CWTRLHCCCMRAVVTRMASLSISSWAARAVRLPS 46 C +RL C + TR +S + S+WA VRLP+ Sbjct: 1201 CHSRLGHCAPSSSSTRCSSSTCSAWACGCVRLPA 1302
>LOC_Os03g46390:12003.t04006:unspliced-genomic ras-related protein RHN1, putative, expressed| Length = 6551 Score = 33.1 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 / -1 Query: 147 CWTRLHCCCMRAVVTRMASLSISSWAARAVRLPS 46 C +RL C + TR +S + S+WA VRLP+ Sbjct: 4034 CHSRLGHCAPSSSSTRCSSSTCSAWACGCVRLPA 3933
>LOC_Os01g11080:12001.t00981:unspliced-genomic Transposable element protein, putative, Retrotrans_gag| Length = 1050 Score = 28.1 bits (55), Expect(2) = 2.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 / -3 Query: 80 RAGPRERSDCPRAAASLRGTSAPR 9 R GPR+R+ PR G APR Sbjct: 388 RLGPRDRTTAPRRRRGTPGRCAPR 317 Score = 24.4 bits (47), Expect(2) = 2.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 / -3 Query: 294 PPYSCVRWTGISCTSIGTPASSPSTRS 214 PP RW +SC + ++PS+ S Sbjct: 895 PPLPWWRWRLLSCCCCSSSGTTPSSSS 815
>LOC_Os03g13730:12003.t01166:unspliced-genomic translocase of chloroplast 34, putative, expressed| Length = 4044 Score = 29.5 bits (58), Expect(2) = 2.0 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 / +3 Query: 607 FFFFTNLTYSYIV*SNTSHSCVL 539 FFFF NL+ + V*+N SCVL Sbjct: 2238 FFFFCNLSAASSV*TNIFSSCVL 2306 Score = 24.9 bits (48), Expect(2) = 2.0 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -1 / +3 Query: 222 TRSWEFCCSRRLYR*RASAESTRFCCW 142 T SW +CC L * AS + F C+ Sbjct: 2640 TPSWVYCCFNLLGS*VASFKLYTFLCF 2720
>LOC_Os11g38620:12011.t03405:unspliced-genomic expressed protein| Length = 4634 Score = 26.7 bits (52), Expect(3) = 2.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 / +2 Query: 285 SCVRWTGISCTSIGTPASS 229 S WT ISCTS P++S Sbjct: 695 STASWTSISCTSSTRPSTS 751 Score = 24.4 bits (47), Expect(3) = 2.1 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -1 / +2 Query: 69 ARAVRLPSRCC 37 AR+++ PSRCC Sbjct: 1226 ARSIQTPSRCC 1258 Score = 22.1 bits (42), Expect(3) = 2.1 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 / +1 Query: 516 SHSSSKTKVAIAHVITLPVPHKHALHYTQY 427 S + K + A + +P+P ALH Y Sbjct: 334 SSMAEKAEQAYTSALAIPLPVDPALHNAAY 423
>LOC_Os02g41720:12002.t03759:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 8905 Score = 24.9 bits (48), Expect(2) = 2.2 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +2 / +3 Query: 422 LSYCV*CNACLC 457 + +C+*C+AC C Sbjct: 8319 VQFCI*CSACYC 8354 Score = 24.9 bits (48), Expect(2) = 2.2 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 / +2 Query: 506 LLCEFLVNLYV*YTRV*CVALYNI 577 LLC L+NL+ ++ + C L+N+ Sbjct: 8348 LLCSALLNLHTMFSLLLCSMLFNL 8419
>LOC_Os07g37840:12007.t03452:unspliced-genomic monoglyceride lipase, putative, expressed| Length = 1336 Score = 32.7 bits (65), Expect = 2.4 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +3 / +1 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 +A S R A PSS+C + KSPS S SCTAA Sbjct: 781 SASSPRATPCAIAAGRGSAPSSSCCAPPTSSAPASAKSPSRSSSCTAA 924
>LOC_Os07g37830:12007.t03451:unspliced-genomic peptidyl-prolyl cis-trans isomerase CYP37, chloroplast precursor,| putative, expressed Length = 4876 Score = 32.7 bits (65), Expect = 2.4 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +3 / -1 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 +A S R A PSS+C + KSPS S SCTAA Sbjct: 4813 SASSPRATPCAIAAGRGSAPSSSCCAPPTSSAPASAKSPSRSSSCTAA 4670
>LOC_Os07g09384:12007.t00813:unspliced-genomic expressed protein| Length = 4045 Score = 32.7 bits (65), Expect = 2.4 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +3 / +3 Query: 156 ACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 AC + C + W+S CS +S WT R + SR C + Sbjct: 3768 ACPAASGGVCRSAWTSSMAPRCCSSTSRRPVWTPRARTAWSRRCATS 3908
>LOC_Os06g49100:12006.t04594:unspliced-genomic LRX2, putative, expressed| Length = 1833 Score = 32.7 bits (65), Expect = 2.4 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +3 / +2 Query: 171 TLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSR 281 T A TA + RTP +A S SSP T SP SR Sbjct: 209 TCAATTACSARRTPPTAASASSPGSTSTTPTSPGISR 319
>LOC_Os05g10650:12005.t00899:unspliced-genomic 6-phosphofructokinase 2, putative, expressed| Length = 2281 Score = 32.7 bits (65), Expect = 2.4 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +3 / +2 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 +A S TCTA + + +GS+ A RW+ ++PST+ + AA Sbjct: 749 SASSSAASTTCTA*RAWWASRAGTAGSTRATRWSSPRAPSTASTSAAA 892
>LOC_Os02g22230:12002.t02011:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 968 Score = 32.7 bits (65), Expect = 2.4 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 / -2 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 W TPS CS SSP+ W S +RS Sbjct: 103 WCINTPSGRCSSSSPSRTWFSPSPSSQTRS 14
>LOC_Os01g60860:12001.t05467:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 2493 Score = 32.7 bits (65), Expect = 2.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 / +3 Query: 204 RTPSSACSGSSPAFRWTCRKSPSTSRSC 287 R P+ +CSG A+R TC S RSC Sbjct: 240 RRPTGSCSGRCTAWRATCPPSTRPRRSC 323
>LOC_Os08g05280:12008.t00422:unspliced-genomic oxidoreductase family, NAD-binding Rossmann fold containing protein,| expressed Length = 8190 Score = 32.7 bits (65), Expect = 2.4 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -1 / +2 Query: 150 CCWTRLHCCCMRAVVTRMASLSISSWAARAVRLPSRCC 37 C + CCC + TR SW A R RCC Sbjct: 1499 CVFYSCACCCTES*TTRRFQDLFRSWGAAGQRALRRCC 1612
>LOC_Os02g43290:12002.t03914:unspliced-genomic protein kinase APK1A, chloroplast precursor, putative, expressed| Length = 1506 Score = 32.7 bits (65), Expect = 2.4 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -1 / +2 Query: 294 PPYSCVRWTGISCTSIGTPASSPSTRSWEFCCS 196 P S RW + T GTP SS +T S CCS Sbjct: 674 PSRSRWRWRWSTSTRAGTPPSSTATSSPRTCCS 772
>LOC_Os02g01870:12002.t00087:unspliced-genomic expressed protein| Length = 1628 Score = 32.7 bits (65), Expect = 2.4 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 / +3 Query: 294 PPYSCVRWTGISCTSIGTPASSPSTRSWEFC 202 PP+ T ISCTS T A SPST + C Sbjct: 453 PPHCPALATSISCTSPATTAFSPSTSTAAVC 545
>LOC_Os01g38690:12001.t03403:unspliced-genomic conserved hypothetical protein| Length = 3563 Score = 32.7 bits (65), Expect = 2.4 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -1 / -3 Query: 228 PSTRSWEFCCSRRLYR*RASAESTRFCCWTRLHCCCMR 115 P+T S RL R R S R CC R +CCC R Sbjct: 2976 PTTTSRRCRRCLRLRRRRRRCLSRRGCCRRRRYCCCRR 2863
>LOC_Os10g20770:12010.t01570:unspliced-genomic expressed protein| Length = 2628 Score = 27.6 bits (54), Expect(2) = 2.5 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -1 / -3 Query: 300 CRPPYSCVRWTGISCTSIGTPASSPSTRSWEFCCSRR 190 CRPP + W G + T + PS + CS R Sbjct: 2122 CRPPAAAAPWPGCRRRTAPTCSRRPSQPPASWTCSPR 2012 Score = 25.8 bits (50), Expect(2) = 2.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 / -3 Query: 174 ASAESTRFCCWTRLHCCC 121 A+ ++R W R HCCC Sbjct: 421 AAGMASRRRRWRRTHCCC 368
>LOC_Os11g27850:12011.t02399:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4425 Score = 25.4 bits (49), Expect(3) = 2.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 / -1 Query: 595 TNLTYSYIV*SNTSHSC 545 TN+TY Y++ T H+C Sbjct: 3267 TNITYCYVLCDFTLHTC 3217 Score = 24.9 bits (48), Expect(3) = 2.6 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = -1 / -3 Query: 144 WTRLHCCC 121 W LHCCC Sbjct: 73 WDSLHCCC 50 Score = 22.6 bits (43), Expect(3) = 2.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -1 / -2 Query: 213 WEFCCSRRLY 184 W F CS RLY Sbjct: 713 WRFFCSMRLY 684
>LOC_Os01g60450:12001.t05426:unspliced-genomic trans-cinnamate 4-monooxygenase, putative| Length = 1667 Score = 25.8 bits (50), Expect(3) = 2.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 / +3 Query: 1 GPPLGAEVPRKEAAARGQSDR 63 GPPL E PR+ +R DR Sbjct: 3 GPPLRGEAPRRPPRSRRGRDR 65 Score = 22.6 bits (43), Expect(3) = 2.7 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 136 PGPAAEPRALCGRSLPVQPS 195 PG A+ PRA C + P+ Sbjct: 1306 PGTASPPRARCSSTRGTSPT 1365 Score = 21.7 bits (41), Expect(3) = 2.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 / +1 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 SSR PSSA ++ + +C + P + S Sbjct: 1501 SSRCPSSASPSAASSRTSSCCRRPGRTGS 1587
>LOC_Os03g60260:12003.t05268:unspliced-genomic ANT1, putative, expressed| Length = 1752 Score = 30.4 bits (60), Expect(2) = 3.2 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 / +2 Query: 225 STRSWEFCCSRRLYR*RASAESTRFCCW 142 STRSW CSRR R SA R W Sbjct: 1214 STRSWRRGCSRRRAGGRGSARRCRRAAW 1297 Score = 22.1 bits (42), Expect(2) = 3.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 / +2 Query: 258 CTSIGTPASSPST 220 C+S +PAS PST Sbjct: 941 CSSTPSPASPPST 979
>LOC_Os10g40750:12010.t03315:unspliced-genomic expressed protein| Length = 877 Score = 32.2 bits (64), Expect = 3.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 / -3 Query: 195 WSSRTPSSACSGSSPAFRWTCRKS 266 W S +P+S C S P RW+C S Sbjct: 800 WCSPSPASPCPPSCPPARWSCWSS 729
>LOC_Os10g12804:12010.t01057:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1835 Score = 32.2 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 / -3 Query: 231 SSPAFRWTCRKSPSTSRSCTAA 296 SSPA +W CR ++SR C AA Sbjct: 393 SSPAKQWRCRHCSASSRPCRAA 328
>LOC_Os10g12790:12010.t01055:unspliced-genomic conserved hypothetical protein| Length = 603 Score = 32.2 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 / -1 Query: 231 SSPAFRWTCRKSPSTSRSCTAA 296 SSPA +W CR ++SR C AA Sbjct: 393 SSPAKQWRCRHCTASSRPCRAA 328
>LOC_Os10g12640:12010.t01040:unspliced-genomic conserved hypothetical protein| Length = 603 Score = 32.2 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 / -1 Query: 231 SSPAFRWTCRKSPSTSRSCTAA 296 SSPA +W CR ++SR C AA Sbjct: 393 SSPAKQWRCRHCTASSRPCRAA 328
>LOC_Os08g10280:12008.t00913:unspliced-genomic conserved hypothetical protein| Length = 306 Score = 32.2 bits (64), Expect = 3.2 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = +3 / -2 Query: 174 LATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 L T T S+ PSS+ S SSP R PS+SRS Sbjct: 299 LLTATVLLSAAPPSSSPSPSSPPSSSPSRSPPSSSRS 189
>LOC_Os07g39530:12007.t03614:unspliced-genomic photoreceptor-interacting protein-like, putative, expressed| Length = 3071 Score = 32.2 bits (64), Expect = 3.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 / +1 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 SS P+SA + + + RW CR + S SC+ A Sbjct: 574 SSTCPASARAATCTSTRWCCRAGTTPSSSCSDA 672
>LOC_Os07g38130:12007.t03481:unspliced-genomic polygalacturonase inhibitor 1 precursor, putative, expressed| Length = 1456 Score = 32.2 bits (64), Expect = 3.2 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 / +3 Query: 171 TLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 T +T S TP S+ + P+ RWT R + STS S +++ Sbjct: 711 TPSTSRTTASPATPPSSSPPAGPSARWTSRGTTSTSTSASSS 836
>LOC_Os07g10940:12007.t00968:unspliced-genomic exo70 exocyst complex subunit family protein| Length = 9339 Score = 32.2 bits (64), Expect = 3.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 / -1 Query: 213 SSACSGSSPAFRWTCRKSP 269 SS C GS+P +RW C SP Sbjct: 6492 SSWCGGSTPPWRWICPPSP 6436
>LOC_Os07g07130:12007.t04720:unspliced-genomic expressed protein| Length = 11710 Score = 32.2 bits (64), Expect = 3.2 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +3 / +2 Query: 231 SSPAFRWTCRKSPSTSRSCTAA 296 SSPA +W CR ++SR C AA Sbjct: 422 SSPAKQWRCRHCTASSRPCRAA 487
>LOC_Os06g41980:12006.t03890:unspliced-genomic protein kinase, putative, expressed| Length = 2004 Score = 32.2 bits (64), Expect = 3.2 Identities = 17/34 (50%), Positives = 19/34 (55%) Frame = +3 / +2 Query: 180 TCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSR 281 T TA WS P S SG+S R T R S +TSR Sbjct: 1088 TSTASWSG*RPGSRRSGASGTRRSTAR*STATSR 1189
>LOC_Os06g27790:12006.t02484:unspliced-genomic selenium-binding protein, putative, expressed| Length = 3974 Score = 32.2 bits (64), Expect = 3.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 / -2 Query: 222 CSGSSPAFRWTCRKSPSTSRSCT 290 CS +SP W C K P +R CT Sbjct: 757 CSRASPRAPWACCKHPEWTRKCT 689
>LOC_Os05g02890:12005.t00187:unspliced-genomic stigma/style ABC transporter, putative, expressed| Length = 2316 Score = 32.2 bits (64), Expect = 3.2 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +3 / +2 Query: 156 ACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCR 260 AC + A C + +S T S CS +SP WT R Sbjct: 605 ACPAGSAAACPSARTSSTTPSCCSSTSPPPGWTRR 709
>LOC_Os04g55159:12004.t005504:unspliced-genomic expressed protein| Length = 1963 Score = 32.2 bits (64), Expect = 3.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 / +3 Query: 219 ACSGSSPAFRWTCRKSPSTSRSC 287 +C GSS RW R+SPS R C Sbjct: 378 SCRGSSSGRRWNRRESPSRRRRC 446
>LOC_Os04g55150:12004.t04988:unspliced-genomic UBA/TS-N domain containing protein, expressed| Length = 5454 Score = 32.2 bits (64), Expect = 3.2 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 / -3 Query: 219 ACSGSSPAFRWTCRKSPSTSRSC 287 +C GSS RW R+SPS R C Sbjct: 5077 SCRGSSSGRRWNRRESPSRRRRC 5009
>LOC_Os01g65500:12001.t05914:unspliced-genomic chloride channel protein CLC-c, putative, expressed| Length = 4662 Score = 32.2 bits (64), Expect = 3.2 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = +3 / +2 Query: 156 ACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 AC+ R A + RTPS AC+ SPA R SPS + +A Sbjct: 3644 ACTSRWCA*RGSLTWRRTPSRACAAWSPATSCPRRSSPSPASRASA 3781
>LOC_Os01g36090:12001.t03159:unspliced-genomic DNA-damage-repair/toleration protein DRT102, putative, expressed| Length = 1616 Score = 32.2 bits (64), Expect = 3.2 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +3 / +2 Query: 162 SLRTLATCTAFWSSRTPSSACSGSS 236 S R ATCTA +SRTPSS+ +G++ Sbjct: 791 SSRRPATCTASSTSRTPSSSSAGTA 865
>LOC_Os01g10270:12001.t00902:unspliced-genomic hypothetical protein| Length = 1266 Score = 32.2 bits (64), Expect = 3.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 / +2 Query: 159 CSLRTLATCTAFWSSRTPSSACSGSSPAFRW 251 CS R C+A W++ T S+A + + A+RW Sbjct: 2 CSRRGARRCSAPWTAATISTATAATPSAWRW 94
>LOC_Os08g45030:12008.t04224:unspliced-genomic multidrug resistance protein 1, putative, expressed| Length = 5864 Score = 32.2 bits (64), Expect = 3.3 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = -1 / +2 Query: 300 CRPPYSCVRWTGISCTSIGTPASSPSTRSWEFCCSRRLYR*RASAESTRFCCW 142 C PP S R G + + PAS P R C+ S+ TR CW Sbjct: 4016 CSPPCSATRSPGSTWRTTPAPASPPGWRWTPRTCAPPSATASPSSSRTRRSCW 4174
>LOC_Os06g01490:12006.t00047:unspliced-genomic monocopper oxidase precursor, putative, expressed| Length = 4653 Score = 32.2 bits (64), Expect = 3.3 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -1 / +1 Query: 294 PPYSCVRWTGISCTSIGTPASSPSTRSWEFCCSRRLYR*RASAESTRF 151 PP++C R + + +S+ +SP T W CS +S T+F Sbjct: 835 PPFTCFRLSQSTSSSLAPS*TSPPTTMWSSMCSTAWMSHYSSLGQTQF 978
>LOC_Os05g10730:12005.t00906:unspliced-genomic multidrug resistance-associated protein 6 precursor, putative,| expressed Length = 7405 Score = 32.2 bits (64), Expect = 3.3 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -1 / +2 Query: 129 CCCMRAVVTRMASLSISSWAARAVRLPSRCCLFTRDLRAERRS 1 C C + + A++ +S AA A R PSRCC RRS Sbjct: 827 CSCACSWLVEPAAVMMSPVAATARRRPSRCCRREAAASGRRRS 955
>LOC_Os04g46000:12004.t04132:unspliced-genomic nuc-1 negative regulatory protein preg, putative, expressed| Length = 2288 Score = 32.2 bits (64), Expect = 3.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 / +2 Query: 273 WTGISCTSIGTPASSPSTRSWEFC 202 WT +CT+ +P SP + SW C Sbjct: 293 WTRTACTASSSPPCSPPSSSWTTC 364
>LOC_Os04g45020:12004.t04037:unspliced-genomic transcription factor LAF1, putative, expressed| Length = 2844 Score = 32.2 bits (64), Expect = 3.3 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = -1 / -2 Query: 558 HHTLVYYTYKFTRNSHSSSKTKVAIAHVITLPVPHKH 448 +HTL++ ++ +R H+S T +++ V LP H H Sbjct: 1814 YHTLIFSRFRQSRGFHNSQ*TVISLIVVQQLPYVHVH 1704
>LOC_Os07g48940:12007.t04522:unspliced-genomic F-box domain containing protein| Length = 1915 Score = 28.1 bits (55), Expect(2) = 3.4 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 / +3 Query: 249 IGTPASSPSTRSWEFCCSRR 190 + +P+S+P+TR EF SRR Sbjct: 1719 VASPSSTPTTRHGEFLTSRR 1778 Score = 24.4 bits (47), Expect(2) = 3.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 / +3 Query: 572 CIEQHITLLCTTRTSSQETHIVVPKQK*P*LTSS 471 C+ + T CT RT S E +++ P TSS Sbjct: 1392 CLRREATSTCTRRTRSPEKCSSSRRRRSPSTTSS 1493
>LOC_Os03g28130:12003.t02486:unspliced-genomic F-box protein, putative, expressed| Length = 1537 Score = 29.5 bits (58), Expect(2) = 3.7 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 / +2 Query: 189 AFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 A WS T +A S SSPA + +PSTS TA Sbjct: 890 ARWSPATRRAARSPSSPASSRSTSSTPSTSWPATA 994 Score = 22.6 bits (43), Expect(2) = 3.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 / +3 Query: 4 PPLGAEVPRKEAAA 45 PPL A PR+ AAA Sbjct: 522 PPLAAGGPRRRAAA 563
>LOC_Os02g18760:12002.t01669:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4378 Score = 27.6 bits (54), Expect(2) = 3.9 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 / -1 Query: 297 RPPYSCVRWTGISCTSIGTPAS 232 R P SCVRW CTS AS Sbjct: 1159 RCPMSCVRWHRCPCTSRWRQAS 1094 Score = 25.8 bits (50), Expect(2) = 3.9 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 / -1 Query: 195 RRLYR*RASAESTRFCCWTRLHCCCMR 115 RR R R+ + FCC R CC R Sbjct: 709 RRRCRPRSRCVDSDFCCCRRHLVCCRR 629
>LOC_Os10g35470:12010.t02843:unspliced-genomic oxidoreductase, putative, expressed| Length = 3887 Score = 25.8 bits (50), Expect(2) = 4.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 / +2 Query: 62 RSDCPRAAASLRGTSA 15 RS CPRAAAS T A Sbjct: 317 RSRCPRAAASASATPA 364 Score = 23.1 bits (44), Expect(2) = 4.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -1 / +2 Query: 162 STRFCCWTRLHC 127 S R CCW R C Sbjct: 260 SWRRCCWRRWRC 295
>LOC_Os03g05500:12003.t00422:unspliced-genomic LOB domain protein 16, putative, expressed| Length = 900 Score = 29.0 bits (57), Expect(2) = 4.2 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 / -2 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 R +TC A S+R ++ CS S A R + ++ S + + AA Sbjct: 644 RRSSTCPAATSTRRSAARCSSRSSASRSSSTRAQSATPAAAAA 516 Score = 22.1 bits (42), Expect(2) = 4.2 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +3 / -1 Query: 528 TCTCSTQECDV 560 TCTCS C + Sbjct: 435 TCTCSVASCGI 403
>LOC_Os03g26280:12003.t02316:unspliced-genomic hypothetical protein| Length = 1266 Score = 27.6 bits (54), Expect(2) = 4.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 / -2 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSPAFR 248 + CS TL+ AF+SSR+ S+ S S R Sbjct: 914 SCCSSSTLSREVAFYSSRSTSATSSSGSAPAR 819 Score = 24.0 bits (46), Expect(2) = 4.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 / -2 Query: 225 SGSSPAFRWTCRKSPSTSRSCTA 293 S SSP + ++ R SPS+ R T+ Sbjct: 170 SSSSPRWSFSSRMSPSSQRRQTS 102
>LOC_Os03g47010:12003.t04063:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 2787 Score = 25.8 bits (50), Expect(2) = 4.3 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 / +1 Query: 177 RASAESTRFCCWTRLHCCCMRAVVTR 100 RA S R WTR+ CC +R Sbjct: 1924 RAPPCSGRRASWTRMRCCSSTTTTSR 2001 Score = 23.1 bits (44), Expect(2) = 4.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 / +1 Query: 261 SCTSIGTPASSPSTRSWEFCCS 196 + +S GT ASS +T S CC+ Sbjct: 1825 TASSPGTRASSGTTTSTTRCCT 1890
>LOC_Os11g43990:12011.t03929:unspliced-genomic expressed protein| Length = 5065 Score = 31.8 bits (63), Expect = 4.5 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +3 / +2 Query: 156 ACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 A S R T+ S ++ C+GS A RWT + S +RS TA+ Sbjct: 326 AASTRPSTRRTSSSSPAAETARCTGSWAAARWTPSWTASITRSATAS 466
>LOC_Os11g06870:12011.t00579:unspliced-genomic glyoxal oxidase, putative| Length = 1886 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 / +1 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 SS S+C+ + + R TC SP+T+ SC+ A Sbjct: 172 SSPASGSSCTRTPASRRCTCSCSPATTSSCSTA 270
>LOC_Os11g05970:12011.t00488:unspliced-genomic disulfide oxidoreductase/ electron carrier/ oxidoreductase,| putative, expressed Length = 1482 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 / +2 Query: 183 CTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSR 281 C+ W+ R P SGS+P +C PSTS+ Sbjct: 602 CSW*WARRRPPRPSSGSAPRTSPSCSTRPSTSQ 700
>LOC_Os10g28800:12010.t02229:unspliced-genomic hypothetical protein| Length = 917 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 / -2 Query: 174 LATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSR 281 +++C+A+W S T S+A +SP R C T+R Sbjct: 748 ISSCSAWWGSSTCSAATGLASPPRRRRCEPLSPTAR 641
>LOC_Os09g38360:12009.t03304:unspliced-genomic hypothetical protein| Length = 1080 Score = 31.8 bits (63), Expect = 4.5 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +3 / +2 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSR 281 R A S R+ SS PS+ +G +P W C +P+TSR Sbjct: 638 REAGSCRSTGRRCTCGSSAPPSAWDAGRAPTAGWCCGCAPATSR 769
>LOC_Os09g25490:12009.t02228:unspliced-genomic CESA9 - cellulose synthase, expressed| Length = 4643 Score = 31.8 bits (63), Expect = 4.5 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 / +3 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 RT T T + +S T ++ S R CR + S R CTA Sbjct: 546 RTRRTLTTWSTSSTSTTRSRSSCSRIRMACRTATSPRRCCTA 671
>LOC_Os08g15650:12008.t01439:unspliced-genomic expressed protein| Length = 1330 Score = 31.8 bits (63), Expect = 4.5 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 / +2 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 TACS R +A + SR+P + + SS R C ++PS S Sbjct: 149 TACSSRRVAAACSCRCSRSPRRSRARSSSRTRSPCSRAPSPRSS 280
>LOC_Os06g42690:12006.t03960:unspliced-genomic ocs-element binding factor 1, putative, expressed| Length = 525 Score = 31.8 bits (63), Expect = 4.5 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +2 / +1 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNEAMRV 106 +R SARRSRV+R+++ L++ A+L N + V Sbjct: 232 NRESARRSRVRRRRQLDELSSHVAELRAANHRLAV 336
>LOC_Os05g25640:12005.t02220:unspliced-genomic trans-cinnamate 4-monooxygenase, putative, expressed| Length = 4560 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 / -2 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSR 281 S PS+ CSG SPA R+ R + ++SR Sbjct: 3791 SPPAPSTGCSGGSPAPRFPIRSTTASSR 3708
>LOC_Os05g19500:12005.t01716:unspliced-genomic ATCHX19, putative, expressed| Length = 2877 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +3 / +2 Query: 210 PSSACSGSSPAFRWTCRKSPSTSRSCTA 293 P S+CS S+ + RWT SPS + + T+ Sbjct: 1964 PRSSCSPSTSSTRWTATWSPSATSTSTS 2047
>LOC_Os04g38400:12004.t03411:unspliced-genomic ETHYLENE-INSENSITIVE3-like 4 protein, putative, expressed| Length = 1338 Score = 31.8 bits (63), Expect = 4.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 / -3 Query: 204 RTPSSACSGSSPAFRWTCRKSPSTSR 281 R+P+ +CS +S A RW+C P R Sbjct: 1144 RSPAGSCSRASSARRWSCGPPPGRRR 1067
>LOC_Os03g24430:12003.t02138:unspliced-genomic cytokinin-O-glucosyltransferase 3, putative| Length = 1518 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 / +2 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSR 281 WS+ S S S+P+ RW+ SP+T R Sbjct: 623 WSAPARSPTASSSTPSSRWSRSTSPATRR 709
>LOC_Os03g21730:12003.t01926:unspliced-genomic receptor-like protein kinase precursor, putative, expressed| Length = 3950 Score = 31.8 bits (63), Expect = 4.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 / +3 Query: 201 SRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 SRT SSA + +S W SP+TSR+ +A Sbjct: 912 SRTASSATAATSATSPWPTTPSPATSRATSA 1004
>LOC_Os02g33710:12002.t03012:unspliced-genomic histidine decarboxylase, putative, expressed| Length = 3115 Score = 31.8 bits (63), Expect = 4.5 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +3 / -3 Query: 216 SACSGSSPAFRWTCRKSPSTSRSC 287 SA SGSSPA RW+ SP R C Sbjct: 3011 SARSGSSPACRWSHWASPRHERCC 2940
>LOC_Os02g07040:12002.t00601:unspliced-genomic biotin--protein ligase, putative, expressed| Length = 3146 Score = 31.8 bits (63), Expect = 4.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 / +1 Query: 216 SACSGSSPAFRWTCRKSPSTS 278 S C+G SP+FRW SP+ S Sbjct: 502 SECAGISPSFRWASSASPTCS 564
>LOC_Os01g39860:12001.t03512:unspliced-genomic 1-aminocyclopropane-1-carboxylate oxidase 1, putative, expressed| Length = 1980 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 / +2 Query: 201 SRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 S P +A S+ A RW C + T SCTA+ Sbjct: 1058 SARPGAAGCSSTSATRWRCSAAAPTRASCTAS 1153
>LOC_Os01g36220:12001.t03171:unspliced-genomic common plant regulatory factor 7, putative, expressed| Length = 845 Score = 31.8 bits (63), Expect = 4.5 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 / +2 Query: 2 DRLSARRSRVKRQQREGSLTARAAQLEIDNEAM 100 +RLSA+RSR ++QQ+ L + A L N A+ Sbjct: 230 NRLSAQRSRARKQQQLDELAGQVAALRARNGAL 328
>LOC_Os09g20860:12009.t01820:unspliced-genomic calmodulin binding protein, putative, expressed| Length = 3658 Score = 31.8 bits (63), Expect = 4.5 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = -1 / +3 Query: 243 TPASSPSTRSWEFCCSRRLYR*RASA 166 TP+SS STR W CSRR R R + Sbjct: 189 TPSSSTSTRRWRTRCSRRGTRWRGGS 266
>LOC_Os08g16260:12008.t01500:unspliced-genomic cytochrome P450 86A1, putative, expressed| Length = 1697 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -1 / +3 Query: 294 PPYSCVRWTGISCTSIGTPASSPSTRSWEFCC 199 PP S R T SCT +P SP W C Sbjct: 882 PPTSTTRTTSASCTPSSSPTWSPGATRWAPPC 977
>LOC_Os08g08000:12008.t00687:unspliced-genomic DNA binding protein, putative, expressed| Length = 8391 Score = 31.8 bits (63), Expect = 4.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 / -3 Query: 174 ASAESTRFCCWTRLHCCCMRAVVTRMA 94 A A + CCW +HCC ++ R+A Sbjct: 6421 ALAPESGCCCWVIMHCCMCLSLAKRIA 6341
>LOC_Os06g51210:12006.t04804:unspliced-genomic ubiquitin-protein ligase/ zinc ion binding protein, putative| Length = 1623 Score = 31.8 bits (63), Expect = 4.5 Identities = 22/65 (33%), Positives = 26/65 (40%) Frame = -1 / +2 Query: 294 PPYSCVRWTGISCTSIGTPASSPSTRSWEFCCSRRLYR*RASAESTRFCCWTRLHCCCMR 115 P SC R SC+ I TP SP+T RR R R+ R T C R Sbjct: 188 PTPSCSRTGRSSCSCIPTPPPSPTTPPARSRAPRRPPRARSGGCRPRAATPTPAPCRSRR 367 Query: 114 AVVTR 100 A +R Sbjct: 368 AATSR 382
>LOC_Os04g13210:12004.t01142:unspliced-genomic multidrug resistance-associated protein 4, putative, expressed| Length = 10723 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -1 / -2 Query: 291 PYSCVRWTGISCTSIGTPASSPSTRS 214 P+S V TG+S TS + +SSPS+ S Sbjct: 1302 PFSTVSRTGVSSTSFSSSSSSPSSSS 1225
>LOC_Os03g60030:12003.t05247:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2422 Score = 31.8 bits (63), Expect = 4.5 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 / -1 Query: 156 RFCCWTRLHCCCMRAVVTRMASL 88 R+CC TRLH C + + ++ +ASL Sbjct: 265 RYCCPTRLHSCSLVSSISCVASL 197
>LOC_Os03g42780:12003.t03679:unspliced-genomic ubiquitin-protein ligase/ zinc ion binding protein, putative| Length = 5135 Score = 31.8 bits (63), Expect = 4.5 Identities = 18/53 (33%), Positives = 23/53 (43%) Frame = -1 / -3 Query: 270 TGISCTSIGTPASSPSTRSWEFCCSRRLYR*RASAESTRFCCWTRLHCCCMRA 112 TG C S P+SSP R C+RR + A A R + H C + A Sbjct: 4551 TGAPCASRRPPSSSPPRRRSGCSCARRCWSSCAPARWPRRTASCKQHSCMVVA 4393
>LOC_Os12g38880:12012.t03568:unspliced-genomic tetratricopeptide-like helical, putative, expressed| Length = 2670 Score = 26.7 bits (52), Expect(2) = 4.5 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 / -1 Query: 68 RERSDCPRAAASLRGTSAPRG 6 R R CPR + R SAPRG Sbjct: 609 RSRRRCPRRTRA*RRASAPRG 547 Score = 25.8 bits (50), Expect(2) = 4.5 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 / -3 Query: 279 VRWTGISCTSIGTPASSPS 223 V ++GIS + TPASSPS Sbjct: 781 VSFSGISSNNFLTPASSPS 725
>LOC_Os09g12150:12009.t01004:unspliced-genomic expressed protein| Length = 1386 Score = 29.0 bits (57), Expect(2) = 4.6 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 / +1 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRW 251 RT +TCTA SSR S+ SP RW Sbjct: 34 RTCSTCTATCSSRRWSACRRPISPPRRW 117 Score = 22.6 bits (43), Expect(2) = 4.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 / +1 Query: 243 FRWTCRKSPSTSRSCTAA 296 +RW ++P SRS +AA Sbjct: 520 WRWVTGRTPRPSRSTSAA 573
>LOC_Os04g36890:12004.t05435:unspliced-genomic peptidyl-prolyl cis-trans isomerase, FKBP-type family protein,| expressed Length = 4286 Score = 30.4 bits (60), Expect(2) = 5.1 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -3 / -3 Query: 229 PEHAELGVLLLQKAVQVASVR 167 PEH E VLLL+ +QVAS+R Sbjct: 714 PEHRERDVLLLELELQVASLR 652 Score = 22.6 bits (43), Expect(2) = 5.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 / -3 Query: 482 LTSSHYQYH 456 L SHYQYH Sbjct: 933 LAESHYQYH 907
>LOC_Os10g38834:12010.t03122:unspliced-genomic NAC-domain protein Ze567, putative, expressed| Length = 6594 Score = 30.4 bits (60), Expect(2) = 5.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 / +1 Query: 243 TPASSPSTRSWEFCCS 196 TPA P+T +W+ CCS Sbjct: 6100 TPAGPPTTTTWQRCCS 6147 Score = 23.1 bits (44), Expect(2) = 5.5 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 / +3 Query: 537 TYKFTRNSHSSSKTKVAIAHVITLPVPHKHALHYTQY 427 T FT + ++S+ + + TLPV LH+T + Sbjct: 3426 TLSFTACNFAASRPALELRLCRTLPVVKLFRLHHTLF 3536
>LOC_Os03g25710:12003.t02268:unspliced-genomic hypothetical protein| Length = 2763 Score = 24.4 bits (47), Expect(2) = 5.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 / -1 Query: 249 WTCRKSPSTSRSCTAA 296 WT SPS+S CTA+ Sbjct: 1767 WTNTLSPSSSAPCTAS 1720 Score = 24.0 bits (46), Expect(2) = 5.7 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 / -1 Query: 150 RTACSLRTLATCTAFWSSRTPSSA 221 RT CS T+ TCT + R S A Sbjct: 1890 RTPCSCLTIDTCTLPATDRATSLA 1819
>LOC_Os03g12660:12003.t01064:unspliced-genomic cytochrome P450 724B1, putative, expressed| Length = 6958 Score = 27.2 bits (53), Expect(2) = 5.8 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = -1 / +2 Query: 609 FFFFSQT*LIHILYRATHHTLVYYTYKFTRNSHSSSKTKVAIAHVITL 466 FFFFSQ L+ + + + +YY ++N + + A+ ++++ Sbjct: 2609 FFFFSQRQLLKVKF*QRSYEYIYYLPNMSQNLYIVNSKNHALVLLLSM 2752 Score = 26.3 bits (51), Expect(2) = 5.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 / +1 Query: 126 CCMRAVVTRMASLSISSWAARAVRLPSRCC 37 CC R V R A +S +A R SR C Sbjct: 4930 CCCRLPVARPAPKKVSESSALLFRRQSRTC 5019
>LOC_Os06g10930:12006.t00970:unspliced-genomic galactoside 2-alpha-L-fucosyltransferase, putative, expressed| Length = 2507 Score = 26.3 bits (51), Expect(2) = 5.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 / +1 Query: 201 SRTPSSACSGSSPAFRW 251 +R +ACS S+PA RW Sbjct: 1210 TRCSPTACSSSTPATRW 1260 Score = 22.1 bits (42), Expect(2) = 5.8 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = +2 / +3 Query: 152 NRVLSADARYLYSLL 196 NR+L+A + +LY++L Sbjct: 1176 NRILAAASAFLYAML 1220
>LOC_Os03g48270:12003.t04184:unspliced-genomic calcium-dependent protein kinase, isoform 2, putative, expressed| Length = 5347 Score = 27.2 bits (53), Expect(2) = 6.1 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 / +1 Query: 222 CSGSSPAFRWTCRKSPSTSRSCTAA 296 CSG + A RWT S+S S AA Sbjct: 3697 CSGETTARRWTSGPPASSSTSSCAA 3771 Score = 25.8 bits (50), Expect(2) = 6.1 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 / +2 Query: 168 RTLATCTAFWSSRTPSSACSGS 233 RT CT WSS T +S +GS Sbjct: 647 RTPTRCTW*WSSATAASCSTGS 712
>LOC_Os12g02980:12012.t00191:unspliced-genomic apyrase precursor, putative, expressed| Length = 3138 Score = 31.3 bits (62), Expect = 6.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 / +1 Query: 192 FWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 +W+ P+ C+ S WT +S +TS S Sbjct: 175 YWTPAAPAHGCTSSGSTTSWTSSRSATTSSS 267
>LOC_Os11g35180:12011.t03066:unspliced-genomic ligA, putative| Length = 822 Score = 31.3 bits (62), Expect = 6.1 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +3 / -2 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSC 287 SS +PSS S +SP R T PSTS+ C Sbjct: 233 SSTSPSSVGSCTSPVRRSTSPSPPSTSQRC 144
>LOC_Os11g10460:12011.t00936:unspliced-genomic peroxidase 43 precursor, putative, expressed| Length = 2325 Score = 31.3 bits (62), Expect = 6.1 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +3 / +3 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 R AT T +SRTPS++ + SSP T R S S++ S Sbjct: 909 RASATPTCSPTSRTPSTSSAPSSPPMASTTRTSSSSAVS 1025
>LOC_Os11g03230:12011.t00214:unspliced-genomic nucleoside-triphosphatase, putative, expressed| Length = 2337 Score = 31.3 bits (62), Expect = 6.1 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +3 / +1 Query: 192 FWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 +W+ P+ C+ S WT +S +TS S Sbjct: 202 YWTPAAPAHGCTSSGSTTSWTSSRSATTSSS 294
>LOC_Os10g32580:12010.t02567:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 1697 Score = 31.3 bits (62), Expect = 6.1 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 / +3 Query: 156 ACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 +CS + AT ++ ++ +PS + SSP+ + SPST +S Sbjct: 606 SCSSPSAATTSSTTTTSSPSPSAPSSSPSPTTSASSSPSTRKS 734
>LOC_Os10g20890:12010.t01581:unspliced-genomic cortical cell-delineating protein precursor, putative, expressed| Length = 668 Score = 31.3 bits (62), Expect = 6.1 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 / +3 Query: 180 TCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSC 287 TC+A +S PS++ S S+ A R T SP+ SC Sbjct: 354 TCSASSTSTCPSTSASSSTSAARTTRPVSPANYLSC 461
>LOC_Os09g35600:12009.t03038:unspliced-genomic antiporter/ drug transporter/ transporter, putative, expressed| Length = 2009 Score = 31.3 bits (62), Expect = 6.1 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 / +3 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 S+ +P+S CS SS T +SPS SRS T Sbjct: 606 SAPSPTSPCSASSTPSASTSARSPSRSRSPT 698
>LOC_Os09g12730:12009.t01063:unspliced-genomic RNA binding protein, putative, expressed| Length = 7545 Score = 31.3 bits (62), Expect = 6.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 / +3 Query: 171 TLATCTAFWSSRTPSSACSG 230 T ATCT+ W++ P++ CSG Sbjct: 6078 TSATCTSLWTTD*PATVCSG 6137
>LOC_Os08g28410:12008.t02598:unspliced-genomic retinal pigment epithelial membrane protein, expressed| Length = 10196 Score = 31.3 bits (62), Expect = 6.1 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +3 / +3 Query: 159 CSLRTLATCTAFWSSR 206 CS TLATCT WSSR Sbjct: 234 CSAWTLATCTLAWSSR 281
>LOC_Os07g20340:12007.t01839:unspliced-genomic ATFP3, putative, expressed| Length = 2350 Score = 31.3 bits (62), Expect = 6.1 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 / -3 Query: 83 SRAGPRERSDCPRAAASLRGTSAPRG 6 S+AGP RS CPR S G P G Sbjct: 578 SKAGPSSRSSCPRPPQSQPGPPLPWG 501
>LOC_Os07g12330:12007.t01105:unspliced-genomic L-tyrosine transporter, putative, expressed| Length = 6356 Score = 31.3 bits (62), Expect = 6.1 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +3 / +3 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSR 281 W S TP SA SSPA + R PS+SR Sbjct: 2124 WPSSTPPSASPCSSPASPASARWCPSSSR 2210
>LOC_Os06g43370:12006.t04027:unspliced-genomic cytochrome P450 71D10, putative, expressed| Length = 1752 Score = 31.3 bits (62), Expect = 6.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 / +2 Query: 189 AFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSC 287 A W + T S C GS RW CR+ R C Sbjct: 191 ATWRAATGRS*CYGSERCPRWWCRRGTRRGR*C 289
>LOC_Os06g28194:12006.t02522:unspliced-genomic phosphoglucomutase/phosphomannomutase family protein, putative,| expressed Length = 21531 Score = 31.3 bits (62), Expect = 6.1 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 / +2 Query: 186 TAFWSSRTPSSACSGSSPAFRWTCRKSPST 275 TA SSR+ +C S+PA RW+ + P+T Sbjct: 7328 TAIGSSRSCPPSCWTSTPARRWSRTRGPAT 7417
>LOC_Os06g17490:12006.t01621:unspliced-genomic protein kinase, putative, expressed| Length = 2562 Score = 31.3 bits (62), Expect = 6.1 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 / +1 Query: 216 SACSGSSPAFRWTCRKSPSTSRSCTAA 296 S CS S+PA R +CR+SP + + +AA Sbjct: 2116 SRCSCSAPARRSSCRRSPLPAATTSAA 2196
>LOC_Os06g04150:12006.t00306:unspliced-genomic magnesium-protoporphyrin O-methyltransferase, putative, expressed| Length = 1120 Score = 31.3 bits (62), Expect = 6.1 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +3 / +2 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 R TCT +SRTP + G+SP + R S S S S Sbjct: 833 RRARTCTRSATSRTPCATPGGASPTAASSPRSSTSPSSS 949
>LOC_Os05g50460:12005.t04478:unspliced-genomic pentatricopeptide repeat protein PPR986-12, putative| Length = 1905 Score = 31.3 bits (62), Expect = 6.1 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +3 / +2 Query: 204 RTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 RT SS+ S SSPA R R S T R CT Sbjct: 50 RTLSSSASSSSPAPRRPTRGSSRTRRRCT 136
>LOC_Os05g49930:12005.t04426:unspliced-genomic DELLA protein GAI, putative, expressed| Length = 1736 Score = 31.3 bits (62), Expect = 6.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 / -2 Query: 237 PAFRWTCRKSPSTSRSCTAA 296 P F WT + +P SRSC AA Sbjct: 1366 PPFSWTPKPAPENSRSCIAA 1307
>LOC_Os05g44070:12005.t03896:unspliced-genomic ras-related protein RIC2, putative, expressed| Length = 2067 Score = 31.3 bits (62), Expect = 6.1 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +3 / +3 Query: 171 TLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 T TC+ + SS TP+SA SSPA T S + S +++ Sbjct: 111 TTTTCSRWCSSATPASASPTSSPASPRTSSASSPSPPSASSS 236
>LOC_Os05g08770:12005.t00754:unspliced-genomic receptor-like protein kinase precursor, putative, expressed| Length = 3364 Score = 31.3 bits (62), Expect = 6.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 / +2 Query: 162 SLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSR 281 S R+ ++ A + P SACSG SP +SP+ SR Sbjct: 929 STRSSSSTMASTPASRPRSACSGRSPCSTSASTRSPARSR 1048
>LOC_Os05g01480:12005.t00049:unspliced-genomic ras-related protein Rab11C, putative, expressed| Length = 2725 Score = 31.3 bits (62), Expect = 6.1 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +3 / +3 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 R+ TC+ ++SS TP+SA SSP T S + S +++ Sbjct: 135 RSTTTCSRWFSSATPASASPTSSPVSPATSSASSPSPPSASSS 263
>LOC_Os04g40770:12004.t03638:unspliced-genomic F-box domain containing protein| Length = 3342 Score = 31.3 bits (62), Expect = 6.1 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 / +2 Query: 186 TAFWSSRTPSSACSGSSPAFRWTCRK 263 +AF ++ TP+ CS +SPA+ W+ + Sbjct: 1004 SAFCTASTPTRTCSPASPAYIWSASR 1081
>LOC_Os04g32160:12004.t02895:unspliced-genomic conserved hypothetical protein| Length = 2957 Score = 31.3 bits (62), Expect = 6.1 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +3 / +1 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSR 281 +SR+ S+ SGSS + W CR S S+ R Sbjct: 2530 ASRSTSAPSSGSSSSSWWRCRSSSSSRR 2613
>LOC_Os04g21950:12004.t01926:unspliced-genomic OsWRKY51 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 1894 Score = 31.3 bits (62), Expect = 6.1 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 / +1 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 ++RTP SA S P R + R+SP+T+ T A Sbjct: 463 TARTPGSASPASPPRARPSSRRSPATAACPTGA 561
>LOC_Os03g63480:12003.t05565:unspliced-genomic ankyrin repeat domain-containing protein 2, putative, expressed| Length = 2615 Score = 31.3 bits (62), Expect = 6.1 Identities = 18/46 (39%), Positives = 23/46 (50%) Frame = +3 / +2 Query: 159 CSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 C R C A + S+ +SPA R T SPS++RS TAA Sbjct: 965 CRTRPCRPCLAASPTPPTRSSSRPASPA*RTTPPSSPSSTRSRTAA 1102
>LOC_Os03g59390:12003.t05186:unspliced-genomic calcium-dependent protein kinase 2, putative, expressed| Length = 4271 Score = 31.3 bits (62), Expect = 6.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 / +1 Query: 168 RTLATCTAFWSSRTPSSACSGSS 236 RT TCT+ WSS +S+ +GSS Sbjct: 763 RTRTTCTSSWSSARAASSSTGSS 831
>LOC_Os03g57880:12003.t05049:unspliced-genomic glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed| Length = 2436 Score = 31.3 bits (62), Expect = 6.1 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +3 / +3 Query: 156 ACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 +C R TC +S TP+ SSP + SP+ RS TA Sbjct: 1800 SCRPRA*RTCPGRGASSTPTPRTPASSPTTSTSPAPSPTARRSATA 1937
>LOC_Os03g50860:12003.t04420:unspliced-genomic histidine kinase, putative, expressed| Length = 6249 Score = 31.3 bits (62), Expect = 6.1 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +3 / +3 Query: 204 RTPSSACSGSSPAFRWTCRKSPSTS 278 R PSSAC+ S+PA T SPST+ Sbjct: 423 RRPSSACARSAPACCRTSSPSPSTT 497
>LOC_Os03g21160:12003.t01871:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 3825 Score = 31.3 bits (62), Expect = 6.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +3 / +2 Query: 198 SSRTPSSACSGSSPAF 245 +SRT SACSGSSP+F Sbjct: 1772 ASRTSRSACSGSSPSF 1819
>LOC_Os03g16150:12003.t01401:unspliced-genomic mannose-1-phosphate guanyltransferase, putative, expressed| Length = 3806 Score = 31.3 bits (62), Expect = 6.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 / +1 Query: 159 CSLRTLATCTAFWSSRTPSSACSGSSP 239 C+ T +T TA W SRT S+ + SSP Sbjct: 3361 CTSATRSTATAAWCSRTRRSSPASSSP 3441
>LOC_Os03g02210:12003.t00113:unspliced-genomic F-box domain containing protein, expressed| Length = 2772 Score = 31.3 bits (62), Expect = 6.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +3 / +1 Query: 198 SSRTPSSACSGSSPAFRWTCR 260 ++ TP SA S SPA WTCR Sbjct: 460 ATTTPPSASSTPSPATSWTCR 522
>LOC_Os01g70130:12001.t06314:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 6331 Score = 31.3 bits (62), Expect = 6.1 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 / +1 Query: 176 RYLYSLLEQQNSQLRVLGELAGVPMDVQEIPVHLT 280 R LYSLL Q N ++L +G+P +Q ++T Sbjct: 2389 RNLYSLLNQMNGYYKILRNSSGIPHSMQFFGENIT 2493
>LOC_Os01g67650:12001.t06122:unspliced-genomic DELLA protein DWARF8, putative| Length = 1599 Score = 31.3 bits (62), Expect = 6.1 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 / +2 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRK 263 R S R CTA SS + ++C GS RW R+ Sbjct: 533 RCCASCRPARPCTARRSSASRRASCRGSRTGCRWRTRR 646
>LOC_Os01g58130:12001.t05211:unspliced-genomic expressed protein| Length = 814 Score = 31.3 bits (62), Expect = 6.1 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 / +2 Query: 180 TCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 +CT+ WS+R P A S+ R +C ++ T CT Sbjct: 326 SCTS*WSARAPGMATGRSAGGPRSSCWRTS*TPARCT 436
>LOC_Os01g23580:12001.t02084:unspliced-genomic pyrophosphate-energized vacuolar membrane proton pump, putative,| expressed Length = 8936 Score = 31.3 bits (62), Expect = 6.1 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +3 / -3 Query: 165 LRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTS 278 ++ + T ++++ TP ++ PA WT +K P+TS Sbjct: 8202 MQNVHAATPYYTTCTPETSAPARRPASVWTPKKVPATS 8089
>LOC_Os01g05880:12001.t00472:unspliced-genomic F-box domain containing protein, expressed| Length = 1227 Score = 31.3 bits (62), Expect = 6.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 / +2 Query: 198 SSRTPSSACSGSSPAFRWTCRKSP 269 +SR P A + +S A+RW CR P Sbjct: 698 TSRAPPEATACTSSAWRWACRPQP 769
>LOC_Os09g38300:12009.t03298:unspliced-genomic kelch motif family protein, expressed| Length = 2033 Score = 31.3 bits (62), Expect = 6.2 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = -1 / +2 Query: 261 SCTSIGTPASSPSTRSWEFCCSRRLYR*RASAESTRFCCWTRLHCCC 121 +CT+ T +S ++ SRR R R SA + R CC R C C Sbjct: 1271 TCTASRTRSSPTTSTRASGPSSRRPARRRGSATTRRRCCAARRGC*C 1411
>LOC_Os09g25150:12009.t02195:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 3187 Score = 31.3 bits (62), Expect = 6.2 Identities = 17/61 (27%), Positives = 24/61 (39%) Frame = -1 / +1 Query: 225 STRSWEFCCSRRLYR*RASAESTRFCCWTRLHCCCMRAVVTRMASLSISSWAARAVRLPS 46 + R W+ R + AS S+ CW CC R S S S+ R+ +P Sbjct: 1225 TVRRWQSRRRARRPKSAASTSSSSAPCWWSARCCSRR*TPAPCTSSSTSTARPRSTPMPC 1404 Query: 45 R 43 R Sbjct: 1405 R 1407
>LOC_Os05g30454:12005.t02644:unspliced-genomic thiamin pyrophosphokinase 1, putative, expressed| Length = 4813 Score = 31.3 bits (62), Expect = 6.2 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -1 / +1 Query: 96 ASLSISSWAARAVRLPSRCCLFTRDLRAERRS 1 AS + SSW + LPS C L TR A RR+ Sbjct: 1906 ASSTCSSWCSPCTSLPSPCPLSTRVAHAWRRA 2001
>LOC_Os04g53720:12004.t04846:unspliced-genomic ATP binding protein, putative, expressed| Length = 6932 Score = 31.3 bits (62), Expect = 6.2 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -1 / -1 Query: 609 FFFFSQT*LIHILYRATHHTLVYYTYKFTRNSHSSSKTK 493 FF F + * + HHT+++YT++ + + SS+ K Sbjct: 2249 FFCFKKV*STVSTIKLNHHTIIFYTFRASSYTTLSSRPK 2133
>LOC_Os04g31290:12004.t02812:unspliced-genomic helix-loop-helix DNA-binding domain containing protein| Length = 1931 Score = 31.3 bits (62), Expect = 6.2 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -1 / -1 Query: 147 CWTRLHCCCMRAVVTRMASLSISSWAARA 61 C T C AVVT AS +++SWAA A Sbjct: 836 CATLAPCGAAAAVVTAAASAALASWAAAA 750
>LOC_Os03g05180:12003.t00391:unspliced-genomic expressed protein| Length = 3365 Score = 31.3 bits (62), Expect = 6.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = -1 / +2 Query: 108 VTRMASLSISSWAARAVRLPSRCC 37 + R+ +SI+SW + PSRCC Sbjct: 1721 MVRLVRVSIASWCSSLQAFPSRCC 1792
>LOC_Os10g17890:12010.t01345:unspliced-genomic OsWAK113 - OsWAK receptor-like protein (OsWAK-RLP)| Length = 912 Score = 26.3 bits (51), Expect(2) = 6.3 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 / -3 Query: 204 CCSRRLYR*RASAESTRFCCWTRLHCC 124 C SRRL R +S S R C R CC Sbjct: 469 CWSRRLPRSSSSQCSRRCCSRARPACC 389 Score = 22.1 bits (42), Expect(2) = 6.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -1 / -3 Query: 300 CRPPYSCVRWTG 265 C PPY C R G Sbjct: 628 CSPPYRCGRTPG 593
>LOC_Os04g03190:12004.t00209:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5495 Score = 28.1 bits (55), Expect(2) = 6.3 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -1 / -2 Query: 150 CCWTRLHCC 124 CCW HCC Sbjct: 1111 CCWAHFHCC 1085 Score = 24.9 bits (48), Expect(2) = 6.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 / -1 Query: 595 TNLTYSYIV*SNTSHSC 545 TN+T+SYI+ T H+C Sbjct: 4337 TNITHSYILCYLTLHTC 4287
>LOC_Os09g13110:12009.t01101:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 13342 Score = 28.1 bits (55), Expect(2) = 7.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 / -2 Query: 297 RPPYSCVRWTGISCTSIGTPASSPS 223 R P RW I+C S+G P PS Sbjct: 5544 RVPRLWNRWHYITCLSVGRPCQKPS 5470 Score = 25.8 bits (50), Expect(2) = 7.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 / -3 Query: 605 FFFHKLDLFIYCIEQHITLLCTT 537 FF H L LFI+C + + L +T Sbjct: 9398 FFIHLLTLFIFCTQNINSFLKST 9330
>LOC_Os07g36230:12007.t03295:unspliced-genomic transposon protein, putative, Mutator sub-class, expressed| Length = 4128 Score = 25.8 bits (50), Expect(2) = 7.4 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 / +3 Query: 50 PRAAASLRGTSAPRGG 3 PRAAAS RG A GG Sbjct: 2331 PRAAASARGAPAAPGG 2378 Score = 22.1 bits (42), Expect(2) = 7.4 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 / +3 Query: 204 CCSRRLYR*RASAESTRFC 148 CC RR R ++ S R+C Sbjct: 2193 CCRRRTPRGCSTGSSARWC 2249
>LOC_Os07g47550:12007.t04391:unspliced-genomic anthocyanidin 3-O-glucosyltransferase, putative, expressed| Length = 1723 Score = 27.6 bits (54), Expect(2) = 7.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 / -3 Query: 440 ITHNMIICSRVRATGDSLHR 381 +T N IIC++ R TGD L R Sbjct: 1637 MT*NNIICNKFRTTGDRLFR 1578 Score = 23.5 bits (45), Expect(2) = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 / -3 Query: 78 SWAARAVRLPSR 43 SWAAR V LP R Sbjct: 1415 SWAARPVPLPQR 1380
>LOC_Os02g19750:12002.t01767:unspliced-genomic stripe rust resistance protein Yr10, putative| Length = 3467 Score = 28.6 bits (56), Expect(2) = 7.7 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 / +2 Query: 180 TCTAFWSSRTPSSACSGSSPAFRWT 254 +C W TPSSACS WT Sbjct: 74 SCATSWPP*TPSSACSRRPARAPWT 148 Score = 23.5 bits (45), Expect(2) = 7.7 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +1 / +2 Query: 472 DDVSYGYFCF 501 D + YGYFC+ Sbjct: 905 DQMDYGYFCY 934
>LOC_Os03g03290:12003.t00214:unspliced-genomic ATP binding protein, putative, expressed| Length = 1833 Score = 26.7 bits (52), Expect(2) = 7.9 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 / +1 Query: 136 PGPAAEPRALCGRSLPVQP 192 P PAA PRA R LP +P Sbjct: 217 PTPAAPPRASAPRHLPSRP 273 Score = 24.4 bits (47), Expect(2) = 7.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 / +1 Query: 207 TPSSACSGSSPAFRWTCRKSPSTS 278 TP+S+ S SSP+ T +PS+S Sbjct: 514 TPTSSSSPSSPSRALTPSSTPSSS 585
>LOC_Os12g38250:12012.t03506:unspliced-genomic expressed protein| Length = 698 Score = 30.9 bits (61), Expect = 8.4 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 / -1 Query: 11 SARRSRVKRQQREGSLTARAAQLEIDN 91 + RR R +QQ+ SLT A Q+EID+ Sbjct: 83 TGRRRRALQQQQSSSLTESAEQVEIDS 3
>LOC_Os12g07280:12012.t00612:unspliced-genomic TRANSPARENT TESTA 1 protein, putative, expressed| Length = 2943 Score = 30.9 bits (61), Expect = 8.4 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +3 / -1 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 SSRT SS+ +GSS A C + TS S AA Sbjct: 2160 SSRTGSSSAAGSSRASGSACTRRAGTSTSSPAA 2062
>LOC_Os12g06840:12012.t00569:unspliced-genomic protein binding protein, putative, expressed| Length = 2494 Score = 30.9 bits (61), Expect = 8.4 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 / +3 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTS 278 SSR PS+ SSP+ C +SP+TS Sbjct: 1413 SSRAPSAPTPASSPSRAAPCTRSPATS 1493
>LOC_Os10g41850:12010.t03415:unspliced-genomic expressed protein| Length = 1560 Score = 30.9 bits (61), Expect = 8.4 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +3 / +3 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSR 281 +S SSACS SPA T R+SP SR Sbjct: 474 TSAPSSSACSTPSPATSPTSRRSPRCSR 557
>LOC_Os10g12290:12010.t01013:unspliced-genomic expressed protein| Length = 5041 Score = 30.9 bits (61), Expect = 8.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 / +3 Query: 162 SLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTS 278 S+ + A T + SSR P +AC+ + RW+ P S Sbjct: 147 SMSSSAGSTPWLSSRAPKAACTAAMALTRWSRTSPPPAS 263
>LOC_Os09g24954:12009.t02176:unspliced-genomic double-stranded RNA binding motif family protein, expressed| Length = 5241 Score = 30.9 bits (61), Expect = 8.4 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +3 / -2 Query: 159 CSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 CS R +ATCT + TPS + SS P R+ Sbjct: 611 CSTRPVATCTGSLLAETPSERAAASSITISMAAASIPCCCRT 486
>LOC_Os09g04710:12009.t00367:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 2752 Score = 30.9 bits (61), Expect = 8.4 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 / +2 Query: 159 CSLRTLATCTAFWSSRTPSSACSGSSPAFRWT 254 CS R +T W S +P SA S A RWT Sbjct: 713 CSTRWRSTRRTCWGSPSPPSATCTPSAAGRWT 808
>LOC_Os08g37456:12008.t03482:unspliced-genomic flavonol synthase/flavanone 3-hydroxylase, putative, expressed| Length = 3636 Score = 30.9 bits (61), Expect = 8.4 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 / +2 Query: 162 SLRTLATCTAFWSSRTPSSACSGSSPAFRW 251 S+ + ++ A SSR+PS A S SSPA W Sbjct: 2549 SMASRSSTMANGSSRSPSRAPSSSSPAISW 2638
>LOC_Os08g16300:12008.t01504:unspliced-genomic hypothetical protein| Length = 1759 Score = 30.9 bits (61), Expect = 8.4 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 / -3 Query: 198 SSRTPSSACSGSSPAFRWTCRKSP 269 +SRT ++ SGS PA RW R P Sbjct: 275 TSRTTTTTTSGSPPARRWKTRSHP 204
>LOC_Os07g41060:12007.t03762:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 4369 Score = 30.9 bits (61), Expect = 8.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 / +3 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCT 290 S+ TP+ S + A R +CR+SP+TS + T Sbjct: 3984 SAATPTPPSSTTRSACR*SCRRSPATSHATT 4076
>LOC_Os07g31884:12007.t02873:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 6914 Score = 30.9 bits (61), Expect = 8.4 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +3 / +1 Query: 204 RTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 R+ S+ S SS A TCR+SPS+ RS A Sbjct: 4990 RSRGSSPSPSSSASSGTCRRSPSSRRSSPA 5079
>LOC_Os07g30950:12007.t02782:unspliced-genomic taxane 10-beta-hydroxylase, putative, expressed| Length = 1846 Score = 30.9 bits (61), Expect = 8.4 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 / +1 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 SS T S+AC+ + RWTCR S S A Sbjct: 619 SSPTRSTACTRACGRCRWTCRSPRSAEASWRA 714
>LOC_Os07g08490:12007.t00724:unspliced-genomic hypothetical protein| Length = 441 Score = 30.9 bits (61), Expect = 8.4 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 / -2 Query: 198 SSRTPSSACSGSSPAFRWTCRKSPSTSR 281 SS TP+++C+ +S RW S +T+R Sbjct: 173 SSSTPAASCARTSSRSRWAASSSTATTR 90
>LOC_Os07g03710:12007.t00260:unspliced-genomic pathogenesis-related protein PRB1-3 precursor, putative, expressed| Length = 931 Score = 30.9 bits (61), Expect = 8.4 Identities = 18/45 (40%), Positives = 22/45 (48%) Frame = +3 / +3 Query: 162 SLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 S RT A TA SS P +A R CR+S T+ + TAA Sbjct: 324 STRTPAGSTARTSSGAPPAATGRRRAPCRRGCRRSSGTTTAATAA 458
>LOC_Os07g01340:12007.t00033:unspliced-genomic gibberellin 2-beta-dioxygenase 7, putative, expressed| Length = 5767 Score = 30.9 bits (61), Expect = 8.4 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 / +1 Query: 168 RTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTA 293 RT + SSRTPS+A S S A W +P+ S S +A Sbjct: 5077 RTATCSPSCTSSRTPSAASSCSRAAGGWP*SPAPAPSSSTSA 5202
>LOC_Os06g09230:12006.t00802:unspliced-genomic serine threonine kinase, putative, expressed| Length = 4511 Score = 30.9 bits (61), Expect = 8.4 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 / +1 Query: 171 TLATCTAFWSSRTPSSACSGSSPA 242 T A+CT+ W + ++ACSG++ A Sbjct: 2749 TAASCTSTWRTAASTTACSGAAAA 2820
>LOC_Os05g49830:12005.t04416:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 1310 Score = 30.9 bits (61), Expect = 8.4 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = +3 / +2 Query: 177 ATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRS 284 AT TA W+ T +SA S+ A R +PST+RS Sbjct: 65 ATGTASWTRSTSTSAAPSSATARWRRRRTTPSTTRS 172
>LOC_Os05g48270:12005.t04261:unspliced-genomic dopamine beta-monooxygenase, putative, expressed| Length = 3117 Score = 30.9 bits (61), Expect = 8.4 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +3 / +1 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 RT+ S R A A WSS SS+ + ++ C + STSRS +++ Sbjct: 877 RTSSSSRCAARRAARWSSTAASSSPTPTTTTTPSWCSRPGSTSRSSSSS 1023
>LOC_Os05g02250:12005.t00124:unspliced-genomic expressed protein| Length = 2676 Score = 30.9 bits (61), Expect = 8.4 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 / +1 Query: 198 SSRTPSSACSGSSPAFRWTCRK 263 S+R P + GSS AFRW+ R+ Sbjct: 2278 STRAPRTGSRGSSTAFRWSSRR 2343
>LOC_Os04g54200:12004.t04893:unspliced-genomic diacylglycerol kinase, putative, expressed| Length = 4781 Score = 30.9 bits (61), Expect = 8.4 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 / +2 Query: 195 WSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 WSSR+ +S S SPA R + R S + R C A Sbjct: 4361 WSSRSLTSVRSPCSPATRASRRASTTPRRRCAVA 4462
>LOC_Os04g51990:12004.t04675:unspliced-genomic transferase, putative, expressed| Length = 2078 Score = 30.9 bits (61), Expect = 8.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 / +1 Query: 177 ATCTAFWSSRTPSSACSGSSPAFR 248 ATCT W R P++ +GSS +R Sbjct: 1696 ATCTGGWRRRPPATTSAGSSTGWR 1767
>LOC_Os03g46590:12003.t04026:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 4526 Score = 30.9 bits (61), Expect = 8.4 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 / +3 Query: 234 SPAFRWTCRKSPSTSRSCTAA 296 SP+F +CR+ S RSCTAA Sbjct: 3738 SPSFHLSCRRHCSGRRSCTAA 3800
>LOC_Os03g43440:12003.t03739:unspliced-genomic CBL-interacting serine/threonine-protein kinase 15, putative,| expressed Length = 1707 Score = 30.9 bits (61), Expect = 8.4 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +3 / +3 Query: 150 RTACSLRTLATCTAFWSSRTPSSACSGSSPAFRWTCRKSPSTSRSCTAA 296 R C R A+C A + P ++ S SSP R + +S ST S ++ Sbjct: 804 RGGCRSRRAASCRASSTRTRPPASPSPSSPPTRGSSARSASTRSSAASS 950
>LOC_Os02g02190:12002.t00119:unspliced-genomic high affinity nitrate transporter, putative, expressed| Length = 1860 Score = 30.9 bits (61), Expect = 8.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 / +3 Query: 159 CSLRTLATCTAFWSSRTPSSACSGSSP 239 CS R A ++ S R PSSAC S+P Sbjct: 465 CSARATAAPSSSCSPRPPSSACRSSTP 545
>LOC_Os02g02170:12002.t00117:unspliced-genomic high affinity nitrate transporter, putative, expressed| Length = 1922 Score = 30.9 bits (61), Expect = 8.4 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 / +2 Query: 159 CSLRTLATCTAFWSSRTPSSACSGSSP 239 CS R A ++ S R PSSAC S+P Sbjct: 470 CSARATAAPSSSCSPRPPSSACRSSTP 550
>LOC_Os01g34470:12001.t03005:unspliced-genomic hypothetical protein| Length = 1566 Score = 30.9 bits (61), Expect = 8.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +3 / -2 Query: 180 TCTAFWSSRTPSSACSGSSPAFRWT 254 T A SSR PS AC +S + RWT Sbjct: 470 TAAASASSRRPSRACRVASSSLRWT 396
>LOC_Os01g13610:12001.t01222:unspliced-genomic isoflavone reductase homolog IRL, putative, expressed| Length = 5482 Score = 30.9 bits (61), Expect = 8.4 Identities = 15/29 (51%), Positives = 15/29 (51%) Frame = +3 / -2 Query: 153 TACSLRTLATCTAFWSSRTPSSACSGSSP 239 TA RTLA S PSSACS S P Sbjct: 2529 TASRTRTLAAMMLLAGSSVPSSACSTSHP 2443
>LOC_Os12g33090:12012.t03002:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 1915 Score = 30.9 bits (61), Expect = 8.5 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -1 / +2 Query: 240 PASSPSTRSWEFCCSRRLYR*RASAESTRFCCWT 139 PASSP RS C SRR * +T CW+ Sbjct: 1418 PASSPRWRSGRRCSSRRCGA*AHGTSATPRRCWS 1519
>LOC_Os11g44600:12011.t03988:unspliced-genomic calmodulin binding protein, putative, expressed| Length = 10397 Score = 30.9 bits (61), Expect = 8.5 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +1 / -2 Query: 130 MQPGPAAEPRALCGRSLP 183 M PGPAA P A C RS P Sbjct: 4792 MPPGPAALPPAACSRSAP 4739
>LOC_Os10g40720:12010.t03312:unspliced-genomic beta-expansin 1a precursor, putative, expressed| Length = 1922 Score = 30.9 bits (61), Expect = 8.5 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 / +2 Query: 597 SQT*LIHILYRATHHTLVYYTYKFTRNSHS 508 S+T +IH Y ++ ++ YYTY + R+ S Sbjct: 1511 SRTSIIHAYYSSSRSSISYYTYLYVRHLRS 1600
>LOC_Os10g40360:12010.t03277:unspliced-genomic proline oxidase, mitochondrial precursor, putative, expressed| Length = 2479 Score = 30.9 bits (61), Expect = 8.5 Identities = 18/56 (32%), Positives = 21/56 (37%) Frame = -1 / +1 Query: 171 SAESTRFCCWTRLHCCCMRAVVTRMASLSISSWAARAVRLPSRCCLFTRDLRAERR 4 S R CW R CC + TR S +R P+RC R R RR Sbjct: 1231 SRRCARSRCWRRRVICCGGSRSTRRRSCHGKCTGSRCCASPARCT*RRRSRRRWRR 1398
>LOC_Os10g25487:12010.t01965:unspliced-genomic NBS-LRR disease resistance protein, putative, expressed| Length = 12351 Score = 30.9 bits (61), Expect = 8.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -1 / -2 Query: 261 SCTSIGTPASSPSTRSWEFCCSRRLYR*RASA 166 SC G PAS+ + RSW C + RA+A Sbjct: 1673 SCGRRGDPASTRARRSWSSCLDTETHTARAAA 1578
>LOC_Os08g31000:12008.t02850:unspliced-genomic expressed protein| Length = 3085 Score = 30.9 bits (61), Expect = 8.5 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 / -3 Query: 177 RASAESTRFCCWTRL 133 R SAE+ R CCW+RL Sbjct: 512 RRSAEACRLCCWSRL 468
>LOC_Os07g04520:12007.t00340:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor, putative, expressed Length = 2196 Score = 30.9 bits (61), Expect = 8.5 Identities = 20/73 (27%), Positives = 28/73 (38%) Frame = -1 / -3 Query: 276 RWTGISCTSIGTPASSPSTRSWEFCCSRRLYR*RASAESTRFCCWTRLHCCCMRAVVTRM 97 R G SC+S + S+ ST + R R ST +CC R + V Sbjct: 451 RRAGRSCSSGASSCSAASTGRRSWSPPTAASRRRCGGSSTPWCCLRRRRAVDVAMVRNTT 272 Query: 96 ASLSISSWAARAV 58 ++ W AR V Sbjct: 271 SNGKSQQWRARRV 233
>LOC_Os06g48660:12006.t04552:unspliced-genomic tetratricopeptide-like helical, putative, expressed| Length = 2624 Score = 30.9 bits (61), Expect = 8.5 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 / -1 Query: 135 LHCCCMRAVVTRMASLSISSWAARAVRLPS 46 L C CM A+ TR+ S + SWA + PS Sbjct: 821 LPCICMSALATRVFSKNPFSWAYSSTHSPS 732
>LOC_Os06g01250:12006.t00025:unspliced-genomic cytochrome P450 93A1, putative, expressed| Length = 2335 Score = 30.9 bits (61), Expect = 8.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 / +2 Query: 219 RSWEFCCSRRLYR*RASAESTRFCCWT 139 RSW CC+RR R R + ST W+ Sbjct: 566 RSWRTCCARRSRRRRGARAST*ATSWS 646
>LOC_Os04g38910:12004.t03461:unspliced-genomic atypical receptor-like kinase MARK, putative, expressed| Length = 2511 Score = 30.9 bits (61), Expect = 8.5 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -1 / +2 Query: 144 WTRLHCCCMRAVVTRMASLSISSWAARAVRLPSRCCLFT 28 WT C R +S + SSWAARA R P C +T Sbjct: 2036 WTAP*PCRTSGRRCRRSSCASSSWAARAPRGPPGACRWT 2152
>LOC_Os04g03860:12004.t00275:unspliced-genomic expressed protein| Length = 5427 Score = 30.9 bits (61), Expect = 8.5 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 / -1 Query: 156 RFCCWTRLHCCC 121 +FCCW L CCC Sbjct: 1839 KFCCWFPLICCC 1804
>LOC_Os03g29750:12003.t02590:unspliced-genomic expressed protein| Length = 6207 Score = 30.9 bits (61), Expect = 8.5 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 / +2 Query: 513 HSSSKTKVAIAHVITLPVPHKHALHYTQYDNMLP 412 H+++ ++++ PVP + +H +QY N LP Sbjct: 4946 HAANFNQLSVTAATQHPVPQMYHMHVSQYPNCLP 5047
>LOC_Os03g28090:12003.t02482:unspliced-genomic pectinesterase-2 precursor, putative, expressed| Length = 2335 Score = 30.9 bits (61), Expect = 8.5 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -1 / -3 Query: 261 SCTSIGTPASSPSTRSWEFCCSRRLYR 181 S + GTPAS+P + CCSRR R Sbjct: 1919 STAAPGTPASAPPPTTTTCCCSRRRRR 1839
>LOC_Os02g34760:12002.t03115:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 1592 Score = 30.9 bits (61), Expect = 8.5 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 / -1 Query: 198 SRRLYR*RASAESTRFCCWTRLHCCCMRAVVTRM 97 +R LY + +T CC+ RL+ C+R ++ R+ Sbjct: 635 NRHLYTHEYESHNTIICCFPRLNFSCIRFLIRRI 534
>LOC_Os01g61370:12001.t05516:unspliced-genomic expressed protein| Length = 1704 Score = 30.9 bits (61), Expect = 8.5 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -1 / -3 Query: 234 SSPSTRSWEFCCSRRLYR*RASAESTRFCCWTRLHCC 124 S P+ R+W C RR R S R C +R CC Sbjct: 604 SRPADRAWRPCPGRRRTTHRRRRCSRRSSCRSRTSCC 494
>LOC_Os01g05730:12001.t00457:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2322 Score = 30.9 bits (61), Expect = 8.5 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 / -1 Query: 198 SRRLYR*RASAESTRFCCWTRLHCCCMRAVVTRM 97 +R LY + +T CC+ RL+ C+R ++ R+ Sbjct: 1551 NRHLYTHEYESHNTIICCFPRLNFSCIRFLIRRI 1450
>LOC_Os05g30090:12005.t02608:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 12917 Score = 28.6 bits (56), Expect(2) = 9.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -1 / -2 Query: 150 CCWTRLHCC 124 CCW R HCC Sbjct: 2239 CCWGRSHCC 2213 Score = 24.9 bits (48), Expect(2) = 9.7 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 / -3 Query: 595 TNLTYSYIV*SNTSHSC 545 TN+T+SYI+ T H+C Sbjct: 5457 TNITHSYILRYLTLHTC 5407
>LOC_Os04g51610:12004.t04638:unspliced-genomic calcium-transporting ATPase 9, plasma membrane-type, putative,| expressed Length = 12197 Score = 24.9 bits (48), Expect(3) = 9.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -1 / +2 Query: 213 WEFCCSRR 190 W FCCSRR Sbjct: 5003 WTFCCSRR 5026 Score = 24.4 bits (47), Expect(3) = 9.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 / +2 Query: 575 YCIEQHITLLCTT 537 YCI+Q LLC+T Sbjct: 2999 YCIDQRSQLLCST 3037 Score = 24.0 bits (46), Expect(3) = 9.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -1 / +2 Query: 84 ISSWAARAVRLPSRCCLFTRDLRAERRS 1 +S WA+R ++LP R + + + RS Sbjct: 9491 VSPWASRELKLPRRVLILSSWMTILHRS 9574
>LOC_Os08g43654:12008.t04090:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 5866 Score = 25.4 bits (49), Expect(2) = 9.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -1 / -3 Query: 138 RLHCCCMRAVVTRMASLSIS 79 RLHCCC + S S+S Sbjct: 116 RLHCCCDPMQIHSYCSFSLS 57 Score = 22.1 bits (42), Expect(2) = 9.7 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 / -3 Query: 240 PASSPSTRSWEFCC 199 P S+P+TR CC Sbjct: 140 PPSTPATRRLHCCC 99
>LOC_Os01g27170:12001.t02421:unspliced-genomic potassium transporter 3, putative, expressed| Length = 5286 Score = 24.4 bits (47), Expect(2) = 9.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 / +2 Query: 198 SSRTPSSACSGSSPAFRW 251 S+ +SA GSSP +RW Sbjct: 4232 STSAAASATMGSSPPWRW 4285 Score = 23.1 bits (44), Expect(2) = 9.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 / +2 Query: 153 TACSLRTLATCTAFWSSRTPSS 218 +AC+ + T T S RTP+S Sbjct: 4115 SACTAASFGTATRTCSPRTPTS 4180
>LOC_Os05g49900:12005.t04423:unspliced-genomic fatty acid elongase, putative, expressed| Length = 2354 Score = 29.5 bits (58), Expect(2) = 9.9 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 / +3 Query: 261 SCTSIGTPASSPSTRSWEFCCSRR 190 S TS TPA++P SW CS R Sbjct: 1767 SSTSASTPAAAPCWTSWRRTCSCR 1838 Score = 21.7 bits (41), Expect(2) = 9.9 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 / +1 Query: 374 YHRAGPAGA 348 +H AGPAGA Sbjct: 1642 HHHAGPAGA 1668 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 208,523,106 Number of extensions: 3349535 Number of successful extensions: 31722 Number of sequences better than 10.0: 251 Length of query: 203 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 155 Effective length of database: 52,912,542 Effective search space: 8201444010 Effective search space used: 8201444010 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
