| Clone Name | FLbaf88e12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O15105:SMAD7_HUMAN Mothers against decapentaplegic homolog 7 - H... | 32 | 2.1 | 2 | P04882:VGLG_VSNJO Glycoprotein G precursor - Vesicular stomatiti... | 31 | 4.6 | 3 | Q9P227:RHG23_HUMAN Rho GTPase-activating protein 23 - Homo sapie... | 30 | 6.0 |
|---|
>O15105:SMAD7_HUMAN Mothers against decapentaplegic homolog 7 - Homo sapiens (Human)| Length = 426 Score = 32.0 bits (71), Expect = 2.1 Identities = 19/53 (35%), Positives = 21/53 (39%) Frame = +3 Query: 309 GGRGSKFTWEGVDGYTDEDLDLVASKGPGTDACASGKNKS*GEGDALPHPPVA 467 GG G + EG TD GPG C GK +G PHPP A Sbjct: 31 GGGGGELRGEGA---TDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAA 80
>P04882:VGLG_VSNJO Glycoprotein G precursor - Vesicular stomatitis New Jersey virus| (strain Ogden subtype Concan) (VSNJV) Length = 517 Score = 30.8 bits (68), Expect = 4.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -1 Query: 173 CKKQDQDLASNEDGWMETSSMRCTSASVCSDLISLDGGFIYGVSDEIS 30 CK Q + N W +S SVCS L +L GG + S+EI+ Sbjct: 169 CKGQICETVHNSTKWFTSSD----GESVCSQLFTLVGGIFFSDSEEIT 212
>Q9P227:RHG23_HUMAN Rho GTPase-activating protein 23 - Homo sapiens (Human)| Length = 1491 Score = 30.4 bits (67), Expect = 6.0 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +1 Query: 400 TLAPPARTSPRERVMPCPTRPSPSD 474 T APPAR S R ++P PT PSD Sbjct: 194 TYAPPARASTRATMVPEPTSALPSD 218 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 101,609,950 Number of extensions: 2012955 Number of successful extensions: 5270 Number of sequences better than 10.0: 3 Number of HSP's gapped: 5267 Number of HSP's successfully gapped: 3 Length of query: 219 Length of database: 100,686,439 Length adjustment: 109 Effective length of query: 110 Effective length of database: 70,788,284 Effective search space: 7786711240 Effective search space used: 7786711240 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)