ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf84j02 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os01g73140:12001.t06596:unspliced-genomic ubiquitin-fold modifier 1 precursor, putative, expressed| Length = 2199 Score = 71.6 bits (150), Expect(4) = 1e-35 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -2 / -1 Query: 310 LVMMALVWGGTLNSSAANLSTAVKGAASGTLN 215 LVMMALVWGGTLNSSAANLSTAV GAASGTLN Sbjct: 459 LVMMALVWGGTLNSSAANLSTAVNGAASGTLN 364 Score = 56.5 bits (117), Expect(4) = 1e-35 Identities = 26/40 (65%), Positives = 30/40 (75%) Frame = -2 / -2 Query: 463 LYIGFFIVDSNND*KDAAVAPTLSRGMRRSSEPCFKNTLP 344 LY F+ + *K AA APTLSRGMRR+SEPCF+NTLP Sbjct: 1868 LYSVKFLNYNYRI*KGAANAPTLSRGMRRNSEPCFRNTLP 1749 Score = 46.4 bits (95), Expect(4) = 1e-35 Identities = 19/25 (76%), Positives = 19/25 (76%) Frame = -1 / -2 Query: 212 FEGELGVGGEDHLERHLPPSSAAAA 138 FEGELGVGGED LERHLP S A Sbjct: 236 FEGELGVGGEDDLERHLPASGRPRA 162 Score = 38.2 bits (77), Expect(4) = 1e-35 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -2 / -2 Query: 352 TLPALCCGLMPTPS 311 T+PALCCGLMPTPS Sbjct: 1268 TVPALCCGLMPTPS 1227 Score = 75.8 bits (159), Expect(4) = 2e-35 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 / +2 Query: 216 FSVPEAAPFTAVLKFAAEEFKVPPQTSAIITN 311 FSVPEAAPFTAVLKFAAEEFKVPPQTSAIITN Sbjct: 365 FSVPEAAPFTAVLKFAAEEFKVPPQTSAIITN 460 Score = 59.7 bits (124), Expect(4) = 2e-35 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 / +1 Query: 342 AGNVFLKHGSELRLIPRDRVGATAASF*SL 431 +GNVFLKHGSELRLIPRDRVGA AA F* L Sbjct: 1747 SGNVFLKHGSELRLIPRDRVGALAAPF*IL 1836 Score = 43.2 bits (88), Expect(4) = 2e-35 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = +3 / +3 Query: 162 KVSFKVILTSDPKLPFKV 215 KVSFK+ILTSDPKLPFKV Sbjct: 186 KVSFKIILTSDPKLPFKV 239 Score = 33.6 bits (67), Expect(4) = 2e-35 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +3 / +1 Query: 312 DGVGINPQQSAGNV 353 DGVGINPQQSAG V Sbjct: 1228 DGVGINPQQSAGTV 1269 Score = 40.5 bits (82), Expect(4) = 1e-13 Identities = 20/41 (48%), Positives = 25/41 (60%) Frame = -3 / -3 Query: 462 YI*VSSLLTLTMTRKTPP*LQLCRGE*GAAPSHASRTRCLH 340 +I +S + +RK P LQL RGE*GA SHA T CL+ Sbjct: 1867 FILLSFSIITIESRKAQPMLQLYRGE*GATLSHALETHCLN 1745 Score = 39.6 bits (80), Expect(4) = 1e-13 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -2 / -3 Query: 217 NTLKGSLGSEVRITLNDTF 161 +TLKGSLGSEVR+ LNDTF Sbjct: 241 HTLKGSLGSEVRMILNDTF 185 Score = 29.0 bits (57), Expect(4) = 1e-13 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = -3 / -2 Query: 315 HRW**WRWS 289 HRW**WRWS Sbjct: 464 HRW**WRWS 438 Score = 27.2 bits (53), Expect(4) = 1e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 / -1 Query: 344 CTLLWVDAYSI 312 CTLLWVDA SI Sbjct: 1260 CTLLWVDANSI 1228 Score = 44.6 bits (91), Expect(4) = 3e-10 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = +1 / +2 Query: 334 SKVQATCS*SMARSCASFPATELELRRRLS 423 S VQA C *SMA+SCASFPA ELE RLS Sbjct: 1739 SFVQAMCF*SMAQSCASFPAIELEHWLRLS 1828 Score = 32.2 bits (64), Expect(4) = 3e-10 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 / +2 Query: 182 PHLRPQAPLQSV 217 PHLRPQAPLQSV Sbjct: 206 PHLRPQAPLQSV 241 Score = 24.0 bits (46), Expect(4) = 3e-10 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 / +1 Query: 206 LQSVQRAGGGALHXXXXXXXXXXXXPAPD 292 L V RA GGA+H PAPD Sbjct: 355 LLQV*RARGGAVHRGAQVRRRGVQGPAPD 441 Score = 23.5 bits (45), Expect(4) = 3e-10 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +1 / +2 Query: 313 ME*ASTHSKVQ 345 ME ASTHSKVQ Sbjct: 1229 MELASTHSKVQ 1261 Score = 43.7 bits (89), Expect = 0.001 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +2 / +3 Query: 344 RQRVLEAWLGAAPHSPRQSWSYGGVFL 424 RQ V +AWL APHSPR SWS G FL Sbjct: 1749 RQCVSKAWLRVAPHSPR*SWSIGCAFL 1829 Score = 30.4 bits (60), Expect(2) = 0.20 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = -1 / -1 Query: 425 LEXXXXXXXSVAGNEAQLRAMLQEHVACT 339 LE S+AGNEAQL AML +H+A T Sbjct: 1830 LERRSQCSNSIAGNEAQL*AML*KHIA*T 1744 Score = 26.7 bits (52), Expect(2) = 0.20 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -3 / -3 Query: 345 LHFAVG*CLLH 313 LHFAVG*C LH Sbjct: 1261 LHFAVG*CQLH 1229
>LOC_Os06g01410:12006.t00040:unspliced-genomic glutamine cyclotransferase precursor, putative, expressed| Length = 2945 Score = 30.9 bits (61), Expect(2) = 0.037 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSPA 2 PPPPP L P RP C ++RL S A Sbjct: 174 PPPPPAHRRCRAPLPPCHRRPRCCPSLRLRSMA 272 Score = 25.4 bits (49), Expect(2) = 0.037 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 / +2 Query: 121 VLSGAETPPPPPC 83 +L+ A PPPPPC Sbjct: 74 LLTVAPPPPPPPC 112
>LOC_Os01g12500:12001.t01117:unspliced-genomic hypothetical protein| Length = 427 Score = 30.4 bits (60), Expect(2) = 0.058 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 / +3 Query: 103 TPPPPPCRGSRDRV 62 TPPPPP RG R R+ Sbjct: 294 TPPPPPARGGRRRL 335 Score = 26.3 bits (51), Expect(2) = 0.058 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 / +3 Query: 209 EGELGVGGEDHLERHLPPSS 150 EGE G G L HLPP S Sbjct: 66 EGEAGGGRRRRLPSHLPPRS 125
>LOC_Os04g17700:12004.t01517:unspliced-genomic kinesin heavy chain isolog, putative, expressed| Length = 8466 Score = 30.4 bits (60), Expect(2) = 0.064 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 / -2 Query: 100 PPPPPCRGSRDRV 62 PPPPP G RDRV Sbjct: 1013 PPPPPLNGDRDRV 975 Score = 24.9 bits (48), Expect(2) = 0.064 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 / -2 Query: 133 AAMGVLSGAETPPPPP 86 A MG S PPPPP Sbjct: 1055 ARMGTQSSVMPPPPPP 1008
>LOC_Os04g24410:12004.t02154:unspliced-genomic kinesin heavy chain isolog, putative, expressed| Length = 8426 Score = 30.4 bits (60), Expect(2) = 0.064 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 / -1 Query: 100 PPPPPCRGSRDRV 62 PPPPP G RDRV Sbjct: 1004 PPPPPLNGDRDRV 966 Score = 24.9 bits (48), Expect(2) = 0.064 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 / -1 Query: 133 AAMGVLSGAETPPPPP 86 A MG S PPPPP Sbjct: 1046 ARMGTQSSVMPPPPPP 999
>LOC_Os02g45590:12002.t04146:unspliced-genomic expressed protein| Length = 5093 Score = 29.5 bits (58), Expect(3) = 0.12 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 / +2 Query: 118 LSGAETPPPPPCR 80 LS A PPPPPCR Sbjct: 1385 LSPASQPPPPPCR 1423 Score = 25.4 bits (49), Expect(3) = 0.12 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMR 32 PPPP R R + A RP+R Sbjct: 2262 PPPPAARARRGSLHARPRARPLR 2330 Score = 23.5 bits (45), Expect(3) = 0.12 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 / +3 Query: 200 LGVGGEDHLERHLPPSSAAA 141 +G GG RH PP AAA Sbjct: 1050 VGDGGGREERRHSPPRGAAA 1109 Score = 30.9 bits (61), Expect = 8.6 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 / -3 Query: 3 AGLVRRIASHRIGRNS*GAKTLSRDPRQGGGGGVSAPDS 119 AG RR A R+ + G RQGGGGG A +S Sbjct: 1500 AGATRRQAGRRLRQTMPGRGERVGGGRQGGGGGCDAGES 1384
>LOC_Os09g33480:12009.t02924:unspliced-genomic DAG protein, chloroplast precursor, putative, expressed| Length = 3147 Score = 36.3 bits (73), Expect = 0.19 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -2 / +2 Query: 136 SAAMGVLSGAETPPPPPCRGSRDRVLAPHEFRPMRCDAMRLT 11 S G S +PPPP R R R +P RP RC R T Sbjct: 125 SPPRGASSRRRSPPPPRARRRRRRGASPRSPRPPRCGTRRRT 250
>LOC_Os04g09790:12004.t00813:unspliced-genomic spidroin 1, putative| Length = 474 Score = 24.4 bits (47), Expect(3) = 0.23 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 / -1 Query: 100 PPPPPCRGSRDRVLA 56 PPPPP R RV A Sbjct: 57 PPPPPAASLRPRVRA 13 Score = 23.5 bits (45), Expect(3) = 0.23 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 / -2 Query: 121 VLSGAETPPPPP 86 V +GA PPPPP Sbjct: 77 VPAGAPPPPPPP 42 Score = 22.6 bits (43), Expect(3) = 0.23 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 / -1 Query: 158 PSSAAAALRRHGCAVRC 108 P +AAA R CAV C Sbjct: 261 PPAAAATACRRRCAVAC 211
>LOC_Os03g40060:12003.t03437:unspliced-genomic conserved hypothetical protein| Length = 1317 Score = 29.9 bits (59), Expect(2) = 0.23 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 / -2 Query: 109 AETPPPPPCRGSRDRVLAPH 50 A +PPPPP R +R APH Sbjct: 257 AASPPPPPTRVTRPPPTAPH 198 Score = 23.5 bits (45), Expect(2) = 0.23 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 / -2 Query: 170 RHLPPSSAAAALRRHGCA 117 R PP+ A LR GCA Sbjct: 395 RRSPPARPPAPLRSRGCA 342
>LOC_Os02g43150:12002.t03900:unspliced-genomic GATA zinc finger family protein, expressed| Length = 2263 Score = 30.4 bits (60), Expect(2) = 0.31 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 / +2 Query: 100 PPPPPCRGSRDRVLA 56 PPPPPCR SR +A Sbjct: 158 PPPPPCRRSRTTTMA 202 Score = 22.6 bits (43), Expect(2) = 0.31 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 / +2 Query: 121 VLSGAETPPPPP 86 +L + TPPPPP Sbjct: 89 LLPTSSTPPPPP 124
>LOC_Os05g38020:12005.t03344:unspliced-genomic expressed protein| Length = 503 Score = 29.5 bits (58), Expect(2) = 0.31 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +3 / +1 Query: 222 VPEAAPFTAVLKFAAEEFKVPPQTSAIITNDGVGINPQQSAGNVF 356 VP +P L+ + + ++PP +A + +GVG N + + +F Sbjct: 367 VPLRSPLRVPLRLSPQPGRLPPNAAAAWSREGVGSNTRPTQ*IIF 501 Score = 24.9 bits (48), Expect(2) = 0.31 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 / +2 Query: 72 RDPRQGGGGGVSA 110 RDPR G GGG+ A Sbjct: 101 RDPRGGDGGGLRA 139
>LOC_Os06g22650:12006.t02079:unspliced-genomic VHS and GAT domain protein, putative, expressed| Length = 8117 Score = 35.4 bits (71), Expect = 0.36 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 / +2 Query: 136 SAAMGVLSGAETPPPPPCR 80 +A+ GVL G PPPPPCR Sbjct: 116 AASTGVLGGEARPPPPPCR 172
>LOC_Os10g25260:12010.t01947:unspliced-genomic hypothetical protein| Length = 1713 Score = 35.0 bits (70), Expect = 0.49 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 / -3 Query: 121 VLSGAETPPPPPCRGSRDRVLAPHEFRPMRC 29 V +G+ TPP PP RG R PH R + C Sbjct: 787 VAAGSTTPPVPPHRGPLRRPPRPHRVRDLLC 695
>LOC_Os03g02544:12003.t005793:unspliced-genomic expressed protein| Length = 571 Score = 35.0 bits (70), Expect = 0.49 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 / -1 Query: 20 HRIASHRPKLVRRQNSITRPP 82 H +ASHRP RR++S TRPP Sbjct: 94 HHLASHRPHRRRRRSSSTRPP 32
>LOC_Os02g58500:12002.t05505:unspliced-genomic phospholipase A2, putative, expressed| Length = 1511 Score = 35.0 bits (70), Expect = 0.49 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -2 / +3 Query: 130 AMGVLSGAETPPPPPCRGS 74 A GVLS A +PPPPPC S Sbjct: 81 AAGVLSSATSPPPPPCSRS 137
>LOC_Os03g57130:12003.t04982:unspliced-genomic cell differentiation protein rcd1, putative, expressed| Length = 6060 Score = 26.7 bits (52), Expect(2) = 0.52 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMR 32 PPPPP R +A H R +R Sbjct: 75 PPPPPPRNGESAAVALHRRRLLR 143 Score = 25.4 bits (49), Expect(2) = 0.52 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 / +3 Query: 121 VLSGAETPPPPP 86 VLS TPPPPP Sbjct: 51 VLSPLSTPPPPP 86
>LOC_Os07g44010:12007.t04043:unspliced-genomic expressed protein| Length = 583 Score = 26.3 bits (51), Expect(2) = 0.61 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 / -3 Query: 136 SAAMGVLSGAETPPPPPCRGSRDR 65 S+A S + PPPPP R R R Sbjct: 215 SSAAAAASPCKPPPPPPRRRRRRR 144 Score = 25.8 bits (50), Expect(2) = 0.61 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 / -1 Query: 185 EDHLERHLPPSSAAAALRRH 126 + H LPP++AAAA RH Sbjct: 307 QPHQPHLLPPAAAAAAAARH 248
>LOC_Os07g28070:12007.t02498:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 752 Score = 31.8 bits (63), Expect(2) = 0.61 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / -2 Query: 112 GAETPPPPPCRGSRDRVLAPHEFRP 38 G PPP +GS DR+L+PH +P Sbjct: 295 GHPPPPPRRIKGSPDRLLSPHTPQP 221 Score = 22.1 bits (42), Expect(2) = 0.61 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -2 / -3 Query: 400 TLSRGMRRSSEPCFKNTLPALCCG 329 T+S G+ S PCF + + CG Sbjct: 417 TVSLGVYLQSTPCFG*STKSKICG 346
>LOC_Os03g06680:12003.t00535:unspliced-genomic plant-specific domain TIGR01615 family protein, expressed| Length = 1589 Score = 29.5 bits (58), Expect(2) = 0.67 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 / -3 Query: 39 GRNS*GAKTLSRDPRQGGGGGVSAPDSTPMA 131 GR S*G + R PR GGGG TP A Sbjct: 1089 GRAS*GWRARRRRPRPRGGGGGPPSRRTPTA 997 Score = 25.4 bits (49), Expect(2) = 0.67 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = +2 / -3 Query: 329 PTAKCRQRVLEAWLGAAPHSPRQSW 403 P KC +R A++ +P + R++W Sbjct: 663 PEEKCEKRSAPAFVAFSPPATRRTW 589
>LOC_Os04g42290:12004.t03782:unspliced-genomic DNA-3-methyladenine glycosylase I, putative, expressed| Length = 3343 Score = 29.0 bits (57), Expect(3) = 0.72 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 / -2 Query: 112 GAETPPPPPCRGSRDRVLAP 53 G+E+PPPP SR LAP Sbjct: 558 GSESPPPPEAGESRPLALAP 499 Score = 23.1 bits (44), Expect(3) = 0.72 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -2 / -1 Query: 397 LSRGMRRSSEPCFKNTLPALCCGLMPTPS 311 L R RR P + LP+ C G P P+ Sbjct: 658 LLRRRRRRIPPRPRRRLPSPCSGNRPRPA 572 Score = 22.1 bits (42), Expect(3) = 0.72 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 / -1 Query: 574 LANCIHPVNHR 542 LA C+HP +H+ Sbjct: 1306 LATCLHPHHHK 1274
>LOC_Os07g43800:12007.t04024:unspliced-genomic EF hand family protein, expressed| Length = 935 Score = 27.2 bits (53), Expect(2) = 0.75 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 / -1 Query: 118 LSGAETPPPPPCRG 77 LS +PPPPPC G Sbjct: 416 LSAP*SPPPPPCSG 375 Score = 26.7 bits (52), Expect(2) = 0.75 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -1 / -2 Query: 203 ELGVGGEDHLERHLPPSSAAAALRRHGCA 117 E G+ D LE+ P AAAA R HG A Sbjct: 709 EAGLEELDELEQVHPGVDAAAARRDHGAA 623
>LOC_Os05g37730:12005.t03315:unspliced-genomic MYB-like transcription factor DIVARICATA, putative, expressed| Length = 2124 Score = 31.8 bits (63), Expect(2) = 0.87 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 / +2 Query: 136 SAAMGVLSGAETPPPPPCRGSRDRVLAPHEFRPMRCDA 23 S GVL + PPPP RG+ PH + ++ +A Sbjct: 1244 SEQFGVLVDGKPPPPPLGRGAGHHHFMPHPYAQVKIEA 1357 Score = 23.1 bits (44), Expect(2) = 0.87 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 / +1 Query: 197 GVGGEDHLERHLPPSSAAAALRRHGC 120 G G ++ + P+ A A LRR GC Sbjct: 385 GRGDDEGVVHGGAPAGAGALLRRPGC 462
>LOC_Os09g30260:12009.t02704:unspliced-genomic expressed protein| Length = 1032 Score = 25.8 bits (50), Expect(2) = 1.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -1 / -1 Query: 167 HLPPSSAAAALRRH 126 HLPPSS+AAA H Sbjct: 603 HLPPSSSAAAAGDH 562 Score = 25.4 bits (49), Expect(2) = 1.1 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 / -3 Query: 115 SGAETPPPPPCRGSRDRVLAP 53 + A PPPPP R SR +P Sbjct: 439 TAAAAPPPPPPRPSRASSSSP 377
>LOC_Os05g47810:12005.t04216:unspliced-genomic UL36 very large tegument protein, putative, expressed| Length = 1366 Score = 33.6 bits (67), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 / +2 Query: 127 MGVLSGAETPPPPPCRGSRDRV 62 +G + A PPPPPCR S R+ Sbjct: 194 VGAAAAAPPPPPPPCRSSSARI 259
>LOC_Os05g18950:12005.t01662:unspliced-genomic methyltransferase small domain, putative, expressed| Length = 1732 Score = 33.6 bits (67), Expect = 1.3 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMR 17 PPP P RG R+LAP RP R R Sbjct: 456 PPPRPRRGPLRRLLAPQRLRPRRPSCAR 539
>LOC_Os03g33280:12003.t02921:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4004 Score = 33.6 bits (67), Expect = 1.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +3 / +1 Query: 66 LSRDPRQGGGGGVSAPDSTPMAAE 137 L DP Q GGG VSAP P +AE Sbjct: 106 LDSDPNQSGGGQVSAPFGIPNSAE 177
>LOC_Os03g02280:12003.t00119:unspliced-genomic expressed protein| Length = 875 Score = 29.9 bits (59), Expect(2) = 1.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 / +1 Query: 209 EGELGVGGEDHLERHLPPSSAAAALRRHGCAVRCR 105 +G+ V G PP +A RR G AVR R Sbjct: 109 DGDAAVAGRGLAPVSWPPEAAGVGARRRGAAVRAR 213 Score = 23.1 bits (44), Expect(2) = 1.3 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 / +1 Query: 112 GAETPPPPPCRGSRDRVLAP 53 GA PP P R DR+ P Sbjct: 640 GARPPPRPQRRAPADRIPRP 699
>LOC_Os01g13930:12001.t01252:unspliced-genomic expressed protein| Length = 1677 Score = 26.7 bits (52), Expect(2) = 1.4 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 / -1 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSP 5 PPPPPC VL +++ +A + SP Sbjct: 240 PPPPPCLPFFPSVLLKNQYSSSSSNAGAVPSP 145 Score = 24.0 bits (46), Expect(2) = 1.4 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 / -1 Query: 127 MGVLSGAETPPPPP 86 +G + G PPPPP Sbjct: 270 LGSIGGLPPPPPPP 229
>LOC_Os02g07930:12002.t00689:unspliced-genomic B-box zinc finger family protein, expressed| Length = 1475 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = -1 / -1 Query: 188 GEDHLERHLPPSSAAAALRRHGCAVR 111 G RH PP A RR CA R Sbjct: 728 GRGRRRRHGPPRGAPPRPRRRACAPR 651 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 / -1 Query: 115 SGAETPPPPPCRGSRDRVLAPHEFRP 38 S + TPP PP R AP RP Sbjct: 635 SASPTPPEPPPRAGHAARAAPSS*RP 558
>LOC_Os06g36330:12006.t03330:unspliced-genomic antiporter/ drug transporter/ transporter, putative, expressed| Length = 1707 Score = 24.9 bits (48), Expect(3) = 1.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 / -3 Query: 100 PPPPPCRGSRDR 65 PPPP CR R R Sbjct: 1414 PPPPACRRGRTR 1379 Score = 24.0 bits (46), Expect(3) = 1.7 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 / -2 Query: 167 HLPPSSAAAAL 135 HLPP SAA+AL Sbjct: 1610 HLPPPSAASAL 1578 Score = 22.1 bits (42), Expect(3) = 1.7 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 / -1 Query: 206 GELGVGGEDHLERHLPP 156 G LG+G +RH+PP Sbjct: 1695 GRLGIGLLARDQRHVPP 1645
>LOC_Os03g51740:12003.t04503:unspliced-genomic 1-aminocyclopropane-1-carboxylate synthase 1, putative, expressed| Length = 2266 Score = 31.8 bits (63), Expect(2) = 1.7 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -2 / +3 Query: 136 SAAMGVLSGAETPPPPPCRGSRDRVLAPHEFRPMRCDAMRLTS 8 SA+ G S TPP PP R R A RP R + R S Sbjct: 1320 SASRGSASAPSTPPTPPSCPRRPRCPASASCRPRRSTSSRRCS 1448 Score = 22.1 bits (42), Expect(2) = 1.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -1 / +1 Query: 194 VGGEDHLERHLPPSSAAAALRRH 126 V G L+ PPS A L RH Sbjct: 610 VHGRQKLQLANPPSICARGLHRH 678 Score = 31.8 bits (63), Expect = 4.5 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +3 / -1 Query: 15 RRIASHRIGRNS*GAKTLSRDPRQGGGGGVSAPDSTPMAAE 137 RR R+GR+ A L R GG GGV D+ P AE Sbjct: 1441 RREEVLRLGRHEAEAGHLGRRGHDGGVGGVDGADAEPREAE 1319
>LOC_Os03g50520:12003.t04392:unspliced-genomic dynamin-related protein 1C, putative, expressed| Length = 5948 Score = 25.4 bits (49), Expect(2) = 1.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 / +2 Query: 100 PPPPPCRG 77 PPPPPC G Sbjct: 77 PPPPPCSG 100 Score = 24.9 bits (48), Expect(2) = 1.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 / +2 Query: 133 AAMGVLSGAETPPPPP 86 A+ LSG PPPPP Sbjct: 35 ASASPLSGRSHPPPPP 82
>LOC_Os02g35660:12002.t03204:unspliced-genomic helix-loop-helix DNA-binding domain containing protein, expressed| Length = 4351 Score = 25.4 bits (49), Expect(2) = 1.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 / -3 Query: 179 HLERHLPPSSAAAALRRHG 123 HL R PP++ AAA R G Sbjct: 1781 HLPRRRPPAARAAAALRRG 1725 Score = 24.9 bits (48), Expect(2) = 1.7 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 / -3 Query: 81 GGRVIEFWRLTSFGRCDAMRCASR 10 G R+++ WR ++ RC C R Sbjct: 1727 GSRLLQAWRRSARSRCCRWSCCCR 1656
>LOC_Os04g49990:12004.t04512:unspliced-genomic AT-hook protein 1, putative, expressed| Length = 4106 Score = 25.8 bits (50), Expect(2) = 1.7 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 / -1 Query: 91 PPCRGSRDRVLAPHEFRPMRCDAMRLTSP 5 PPCR R+R A R RC T P Sbjct: 608 PPCRHRRNRAAAACPARRDRCGTWSPTYP 522 Score = 24.4 bits (47), Expect(2) = 1.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 / -1 Query: 185 EDHLERHLPPSSAAAALRRHGCAVR 111 +DH P SS+ A LRR C R Sbjct: 665 QDHTSSASPSSSSRAPLRRPPCRHR 591
>LOC_Os08g38790:12008.t03613:unspliced-genomic conserved hypothetical protein| Length = 2250 Score = 33.1 bits (66), Expect = 1.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 / -3 Query: 106 ETPPPPPCRGSRDRVLAPHEFRPMR 32 +TPPPPPC+ +R + H+ +P R Sbjct: 1645 KTPPPPPCQETRRPPRSRHQDKPRR 1571
>LOC_Os07g36330:12007.t03305:unspliced-genomic F-box domain containing protein| Length = 3188 Score = 33.1 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 / +3 Query: 118 LSGAETPPPPPCRGSRDRVLAPHEFRPMR 32 L GA +PPP P R R R PH+ P R Sbjct: 312 LPGAGSPPPRPRRRRRPRRSGPHQQSPQR 398
>LOC_Os02g29040:12002.t02598:unspliced-genomic ankyrin-2, putative, expressed| Length = 8491 Score = 33.1 bits (66), Expect = 1.8 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 / +1 Query: 100 PPPPPCRGSRDRVLAP 53 PPPPPCR RD AP Sbjct: 181 PPPPPCRPRRDAAAAP 228
>LOC_Os01g15580:12001.t01409:unspliced-genomic disease resistance protein RGA2, putative, expressed| Length = 4377 Score = 33.1 bits (66), Expect = 1.8 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 / -3 Query: 209 EGELGVGGEDHLERHLPPSSAAAALRRHGCAVRC 108 E EL G L +HLP + RHGCA+ C Sbjct: 166 ERELVPDGGAELGQHLPHDGRGESTLRHGCALEC 65
>LOC_Os06g10790:12006.t00956:unspliced-genomic protein kinase, putative, expressed| Length = 2368 Score = 26.3 bits (51), Expect(2) = 1.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 / -3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMR 32 PPPPP SR+R A P R Sbjct: 377 PPPPPAPSSRNRTGAAWNAWPTR 309 Score = 24.0 bits (46), Expect(2) = 1.8 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 / -3 Query: 136 SAAMGVLSGAETPPPPP 86 S VL+ TPPPPP Sbjct: 416 SRTNAVLNDDTTPPPPP 366
>LOC_Os11g25530:12011.t02170:unspliced-genomic hypothetical protein| Length = 1283 Score = 27.6 bits (54), Expect(2) = 1.9 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 / +1 Query: 209 EGELGVGGEDHLERHLPPSSAAAALRRHGCA 117 E L V D RH PPS+AA + HG A Sbjct: 241 EAVLIVARSDDSSRHHPPSAAAFVVFPHGGA 333 Score = 22.6 bits (43), Expect(2) = 1.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 / +1 Query: 103 TPPPPPCRGSRDRVLA 56 +PPPPP R D + A Sbjct: 415 SPPPPPVRTRTDTLPA 462
>LOC_Os05g42240:12005.t03760:unspliced-genomic hypothetical protein| Length = 1251 Score = 25.4 bits (49), Expect(2) = 1.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDA 23 PPPPP R R RP+R A Sbjct: 372 PPPPPPASPRPRRRRRRRGRPLRAAA 449 Score = 24.9 bits (48), Expect(2) = 1.9 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 / +2 Query: 136 SAAMGVLSGAETPPPPP 86 SAA G S TPP PP Sbjct: 296 SAAAGTRSATSTPPWPP 346 Score = 27.6 bits (54), Expect(2) = 5.8 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 / +2 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTS 8 PPPPP R + ++P + P+ RL S Sbjct: 890 PPPPPTRRTTPSTISPPPWPPLARYTHRLVS 982 Score = 23.5 bits (45), Expect(2) = 5.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 / +2 Query: 112 GAETPPPPP 86 G TPPPPP Sbjct: 26 GPRTPPPPP 52
>LOC_Os12g09620:12012.t00841:unspliced-genomic expressed protein| Length = 763 Score = 28.1 bits (55), Expect(2) = 2.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 / +2 Query: 81 GGRVIEFWRLTSFGRCDAMRCASR 10 GG WR TS GR A RC SR Sbjct: 212 GGSCRWGWRGTSSGRTGASRCTSR 283 Score = 22.1 bits (42), Expect(2) = 2.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -2 / +3 Query: 118 LSGAETPPPPP 86 L G PPPPP Sbjct: 60 LHGRHPPPPPP 92
>LOC_Os07g27630:12007.t02456:unspliced-genomic hypothetical protein| Length = 634 Score = 25.8 bits (50), Expect(2) = 2.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 / +2 Query: 100 PPPPPCRGSRDRVLAP 53 PPPPPC G AP Sbjct: 239 PPPPPCPG*PGSAAAP 286 Score = 24.4 bits (47), Expect(2) = 2.0 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 / +2 Query: 133 AAMGVLSGAETPPPPP 86 AA G TPPPPP Sbjct: 197 AAAGTARPPPTPPPPP 244
>LOC_Os03g41080:12003.t03526:unspliced-genomic seed maturation protein PM23, putative, expressed| Length = 5592 Score = 26.7 bits (52), Expect(2) = 2.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 / +3 Query: 188 GEDHLERHLPPSSAAAALRR 129 G H +R LPP +AA LRR Sbjct: 135 GGPHADRLLPPPAAAPLLRR 194 Score = 23.1 bits (44), Expect(2) = 2.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 / +1 Query: 136 SAAMGVLSGAETPPPPP 86 SAA G+ PPPPP Sbjct: 205 SAARGLRVPLPPPPPPP 255
>LOC_Os03g55600:12003.t04821:unspliced-genomic serine/threonine-protein kinase SAPK8, putative, expressed| Length = 5559 Score = 27.6 bits (54), Expect(2) = 2.3 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 / -1 Query: 100 PPPPPCRGSRDRVLAP 53 PPPPP R +R R L P Sbjct: 117 PPPPPPRPNRRRALLP 70 Score = 22.1 bits (42), Expect(2) = 2.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 / -3 Query: 136 SAAMGVLSGAETPPPPP 86 SA G S PPPPP Sbjct: 151 SATRGGGSPPRAPPPPP 101
>LOC_Os07g33110:12007.t02991:unspliced-genomic calcium-dependent protein kinase, isoform 2, putative, expressed| Length = 5472 Score = 26.7 bits (52), Expect(2) = 2.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAP 53 PPPPP RG R + +P Sbjct: 267 PPPPPPRGRRAELSSP 314 Score = 23.1 bits (44), Expect(2) = 2.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 / +3 Query: 118 LSGAETPPPPP 86 LS A PPPPP Sbjct: 228 LSPAPNPPPPP 260
>LOC_Os04g49870:12004.t04501:unspliced-genomic poly, putative| Length = 1671 Score = 32.7 bits (65), Expect = 2.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -2 / -3 Query: 115 SGAETPPPPPCRGSRDRVLAPHEFRPM 35 SG PP PPCR S R P P+ Sbjct: 1468 SGGRAPPRPPCRASSSRTCTPPP*TPL 1388
>LOC_Os04g37930:12004.t03363:unspliced-genomic hypothetical protein| Length = 3867 Score = 32.7 bits (65), Expect = 2.4 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 / -2 Query: 103 TPPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSP 5 TPPP R R L PH+ P RC + L P Sbjct: 3365 TPPPGAIHHCRRRPLPPHQIWPERCGSGGLPPP 3267
>LOC_Os02g28720:12002.t02566:unspliced-genomic spotted leaf protein 11, putative, expressed| Length = 4167 Score = 32.7 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 / -3 Query: 60 KTLSRDPRQGGGGGVSAPDSTPMA 131 + LSR PR G GGG + P S P A Sbjct: 280 RRLSRRPRGGAGGGAAPPPSPPRA 209
>LOC_Os02g05030:12002.t00401:unspliced-genomic sucrose phosphate synthase, putative, expressed| Length = 5948 Score = 32.7 bits (65), Expect = 2.4 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = -2 / +2 Query: 589 STWHCLANCIHPVNHRAGCWWQIILNHVTSIIQPSIDMLLFLLYIGFFIVDS 434 S+ +C+ N + P + + C + LN SII + L LLYI I++S Sbjct: 5345 SSTNCINNAVMPGDVWSCCLTSLALNAKVSIIYVQSETYLCLLYICIHIINS 5500
>LOC_Os11g19790:12011.t01749:unspliced-genomic O-methyltransferase ZRP4, putative| Length = 1337 Score = 24.0 bits (46), Expect(3) = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 / +3 Query: 161 PPSSAAAALRRHGCAVRCRD 102 PP AAA RH RCRD Sbjct: 228 PPPHAAAGPLRHLRLRRCRD 287 Score = 23.5 bits (45), Expect(3) = 2.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 / +2 Query: 115 SGAETPPPPPCRGS 74 S + T PPPPC S Sbjct: 314 SSSWTAPPPPCPSS 355 Score = 22.1 bits (42), Expect(3) = 2.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 / +3 Query: 61 LAPHEFRPMRC 29 L PHEFR + C Sbjct: 1266 LFPHEFRGLHC 1298
>LOC_Os11g44820:12011.t04010:unspliced-genomic expressed protein| Length = 840 Score = 24.9 bits (48), Expect(2) = 2.6 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -1 / +2 Query: 161 PPSSAAAALRRHGCAVRCR 105 PP S RRH C CR Sbjct: 605 PPPSVCRRPRRHTCTTICR 661 Score = 24.9 bits (48), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 / +1 Query: 100 PPPPPCRG 77 PPPPPC G Sbjct: 664 PPPPPCYG 687
>LOC_Os08g04160:12008.t00311:unspliced-genomic hypothetical protein| Length = 513 Score = 27.2 bits (53), Expect(2) = 2.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 / -3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSPA 2 PPP P R SR AP P R A +PA Sbjct: 361 PPPSPTRPSRPPPAAPPPPPPPRASASPPPAPA 263 Score = 22.6 bits (43), Expect(2) = 2.7 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 / -3 Query: 115 SGAETPPPPP 86 SG PPPPP Sbjct: 385 SGGAPPPPPP 356
>LOC_Os11g37420:12011.t03284:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 8557 Score = 26.3 bits (51), Expect(2) = 3.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 / +3 Query: 161 PPSSAAAALRRHGCAV 114 PP +AAAA +RH AV Sbjct: 3567 PPRNAAAACQRHAAAV 3614 Score = 23.1 bits (44), Expect(2) = 3.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 / +1 Query: 103 TPPPPPCRGSRDR 65 TPPPPP R +R Sbjct: 3703 TPPPPPPRRRANR 3741
>LOC_Os05g41580:12005.t03695:unspliced-genomic calcium-transporting ATPase 4, plasma membrane-type, putative,| expressed Length = 7339 Score = 25.8 bits (50), Expect(2) = 3.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 / +3 Query: 127 MGVLSGAETPPPPP 86 +G+L G PPPPP Sbjct: 465 IGLLCGCALPPPPP 506 Score = 23.5 bits (45), Expect(2) = 3.0 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPH 50 PPPPP RV PH Sbjct: 495 PPPPPPPDVDARVCIPH 545
>LOC_Os09g37590:12009.t03233:unspliced-genomic expressed protein| Length = 7191 Score = 24.9 bits (48), Expect(2) = 3.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 / +3 Query: 115 SGAETPPPPP 86 SGA PPPPP Sbjct: 3690 SGAHPPPPPP 3719 Score = 24.4 bits (47), Expect(2) = 3.0 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -2 / +2 Query: 100 PPPPPCRGSRDRVLAP 53 PPPPPC L P Sbjct: 3710 PPPPPCPSFHPSSLVP 3757
>LOC_Os12g06300:12012.t00516:unspliced-genomic hypothetical protein| Length = 2309 Score = 29.0 bits (57), Expect(2) = 3.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 / -3 Query: 115 SGAETPPPPPCRGSR 71 SG + PPPPCR SR Sbjct: 435 SGNQEQPPPPCRTSR 391 Score = 24.0 bits (46), Expect(2) = 3.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 / -3 Query: 539 WLLVANYTQPCYIHYTTE 486 +L+ T+ C+IHYT + Sbjct: 834 YLIYREKTRSCFIHYTLQ 781
>LOC_Os07g10610:12007.t00935:unspliced-genomic expressed protein| Length = 4705 Score = 25.8 bits (50), Expect(2) = 3.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 / +2 Query: 100 PPPPPCRGSRDRVLAPHEFRP 38 PPPP R RVL PH P Sbjct: 236 PPPPAPRPLPPRVLRPHAPAP 298 Score = 23.5 bits (45), Expect(2) = 3.1 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -2 / +2 Query: 124 GVLSGAETPPPPP 86 G L G PPPPP Sbjct: 206 GHLPGPRPPPPPP 244
>LOC_Os05g39720:12005.t03513:unspliced-genomic OsWRKY70 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 2976 Score = 26.3 bits (51), Expect(3) = 3.2 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 / -2 Query: 206 GELGVGGEDHLERHLPPSSAAAALRRHGCAVR 111 G + V G ++R ++AAA LRR G AVR Sbjct: 1619 GGVCVAGGAAMQRVAGAAAAAAVLRRLGVAVR 1524 Score = 23.1 bits (44), Expect(3) = 3.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 / -2 Query: 421 KDAAVAPTLSRGMRR 377 KDAA A ++RG+RR Sbjct: 2288 KDAAAALQVARGLRR 2244 Score = 22.1 bits (42), Expect(3) = 3.2 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = -2 / -1 Query: 124 GVLSGAETPPPPPCRGSRDRVLAPHEFRPMR 32 G G+ PPP P G R H P R Sbjct: 1356 GSADGSRRPPPAPPPGCSCRSRPRHPPPPTR 1264
>LOC_Os07g28430:12007.t02534:unspliced-genomic growth-regulating factor, putative, expressed| Length = 2745 Score = 25.4 bits (49), Expect(2) = 3.2 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 / -1 Query: 100 PPPPPCRGSRDR 65 PPPPPC S R Sbjct: 249 PPPPPCSASAAR 214 Score = 24.0 bits (46), Expect(2) = 3.2 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 / -3 Query: 121 VLSGAETPPPPP 86 +LS + +PPPPP Sbjct: 328 LLSSSSSPPPPP 293
>LOC_Os03g01540:12003.t05711:unspliced-genomic DNA binding protein, putative, expressed| Length = 2686 Score = 25.4 bits (49), Expect(2) = 3.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 / +3 Query: 158 PSSAAAALRRHGCAVRCR 105 P++A A+LRR + RCR Sbjct: 273 PATATASLRRRASSPRCR 326 Score = 24.0 bits (46), Expect(2) = 3.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 / +2 Query: 109 AETPPPPPCRGSRDRVLAPH 50 A PPPPP + + APH Sbjct: 314 APLPPPPPPQPQPPTLPAPH 373
>LOC_Os04g38740:12004.t03444:unspliced-genomic DNA binding protein, putative, expressed| Length = 2623 Score = 25.8 bits (50), Expect(2) = 3.3 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 / -3 Query: 100 PPPPPCRGSRDRVLAPHEFRP 38 PPPPP RG P RP Sbjct: 1928 PPPPPTRGVPGGAARPGSRRP 1866 Score = 23.5 bits (45), Expect(2) = 3.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 / -3 Query: 136 SAAMGVLSGAETPPPPP 86 SA G E PPPPP Sbjct: 1967 SAWTSASRGREPPPPPP 1917
>LOC_Os08g35939:12008.t03335:unspliced-genomic expressed protein| Length = 9412 Score = 32.2 bits (64), Expect = 3.3 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -2 / +2 Query: 91 PPCRGSRDRVLAPHEFRPMRCDAMRLTSPA 2 PP R +R R AP+ +RP R R SPA Sbjct: 14 PPARSARRRCRAPNRWRPKRRPPPRPASPA 103
>LOC_Os04g30170:12004.t02704:unspliced-genomic hypothetical protein| Length = 616 Score = 32.2 bits (64), Expect = 3.3 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 / +3 Query: 115 SGAETPPPPPCRGSRDRVLAPH 50 SG E+PPPPP R R PH Sbjct: 162 SGQESPPPPPTRSPRPLPPPPH 227
>LOC_Os03g15810:12003.t01367:unspliced-genomic ATP binding protein, putative, expressed| Length = 7670 Score = 32.2 bits (64), Expect = 3.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 / +1 Query: 586 TWHCLANCIHPVNHRAGCWW 527 T++CLAN I P + CWW Sbjct: 6181 TYNCLANYIEPGSISISCWW 6240
>LOC_Os01g55370:12001.t04949:unspliced-genomic expressed protein| Length = 1511 Score = 32.2 bits (64), Expect = 3.3 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -2 / -3 Query: 136 SAAMGVLSGAETPPPPPCRGSRDRV 62 SAA G++SG PPPPP R R R+ Sbjct: 663 SAAGGLISGFFPPPPPPRRRGRLRL 589
>LOC_Os11g09990:12011.t00891:unspliced-genomic mTERF family protein, expressed| Length = 1670 Score = 25.8 bits (50), Expect(2) = 3.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 / +3 Query: 121 VLSGAETPPPPP 86 +LSG + PPPPP Sbjct: 171 LLSGPQPPPPPP 206 Score = 23.5 bits (45), Expect(2) = 3.4 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 / +3 Query: 170 RHLPPSSAAAALRRH 126 RH PP AA RRH Sbjct: 114 RHAPPPPAAPRPRRH 158
>LOC_Os11g10530:12011.t00943:unspliced-genomic expressed protein| Length = 1422 Score = 25.4 bits (49), Expect(2) = 3.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 / -1 Query: 164 LPPSSAAAALRRHGCAVR 111 LPP + LRRH C +R Sbjct: 192 LPPPRSVMELRRHRCRLR 139 Score = 24.0 bits (46), Expect(2) = 3.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 / -1 Query: 112 GAETPPPPPC 83 G PPPPPC Sbjct: 84 GPVKPPPPPC 55
>LOC_Os11g11720:12011.t01059:unspliced-genomic protein Z, putative| Length = 1353 Score = 24.9 bits (48), Expect(2) = 3.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -1 / -3 Query: 170 RHLPPSSAAAALRRHGCAVRCR 105 R PP+SAAA RR + R R Sbjct: 1261 RRSPPASAAACSRRRTASTRGR 1196 Score = 24.4 bits (47), Expect(2) = 3.4 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = -2 / -3 Query: 115 SGAETPPPPPCRGSRDRVLAPHEFRP 38 S +PPPPPC R RP Sbjct: 1162 SPPRSPPPPPCGSRCSRTSPRPRRRP 1085
>LOC_Os07g01560:12007.t00055:unspliced-genomic sugar transport protein 1, putative, expressed| Length = 5212 Score = 28.1 bits (55), Expect(2) = 3.5 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -1 / -2 Query: 515 QPCYIHYTTEHRHAFIPV 462 +PC++H EH H +P+ Sbjct: 3894 EPCHVHADEEHHHRRVPL 3841 Score = 25.8 bits (50), Expect(2) = 3.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = -2 / -3 Query: 103 TPPPPPCRGSRDRVLAPHEFRPMR 32 +P PPC R R PH RP R Sbjct: 179 SPCLPPCSPPRRRPSRPHRRRPGR 108
>LOC_Os06g48250:12006.t04511:unspliced-genomic cell Division Protein AAA ATPase family, putative, expressed| Length = 1937 Score = 23.5 bits (45), Expect(3) = 3.6 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 / -1 Query: 112 GAETPPPPP 86 G TPPPPP Sbjct: 599 GLNTPPPPP 573 Score = 23.5 bits (45), Expect(3) = 3.6 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = -2 / -1 Query: 100 PPPPPCRGSRDRVLAPHEFRPMR 32 PPPPP R A H R R Sbjct: 584 PPPPPAEAPRSTGRAVHLTRTPR 516 Score = 23.1 bits (44), Expect(3) = 3.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 / -1 Query: 274 NSSAANLSTAVKGAASGTLNTLKGSLG 194 +SSA+ LS AV A S +NT S G Sbjct: 1628 SSSASFLSAAVAPAPSQPMNTSAMSAG 1548
>LOC_Os10g27260:12010.t02132:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 15984 Score = 26.7 bits (52), Expect(2) = 3.8 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -2 / +3 Query: 103 TPPPPPCRGSRDRVLAPHEFRPM 35 TPPPPP R R R A PM Sbjct: 8037 TPPPPPPRRRRRRHAAAPTAAPM 8105 Score = 22.1 bits (42), Expect(2) = 3.8 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = -1 / +1 Query: 161 PPSSAAAALRRHGCAVRCR 105 PP AAAA RH A R Sbjct: 7954 PPRHAAAATPRHATAATPR 8010
>LOC_Os10g37630:12010.t03023:unspliced-genomic fas-associated factor 1-like protein, putative, expressed| Length = 4352 Score = 25.4 bits (49), Expect(2) = 4.2 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 / -1 Query: 136 SAAMGVLSGAETPPPPP 86 SAA G S + +PPPPP Sbjct: 641 SAADGGSSRSRSPPPPP 591 Score = 23.5 bits (45), Expect(2) = 4.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 / -1 Query: 100 PPPPPCRGSR 71 PPPPPC R Sbjct: 602 PPPPPCARPR 573
>LOC_Os01g22720:12001.t02003:unspliced-genomic hypothetical protein| Length = 4332 Score = 26.3 bits (51), Expect(2) = 4.2 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 / +3 Query: 109 AETPPPPPCRGSRDRVLAPHEFR 41 A PPPPPC L+P R Sbjct: 45 AAPPPPPPCLRGSPGSLSPRPHR 113 Score = 22.6 bits (43), Expect(2) = 4.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 / +3 Query: 136 SAAMGVLSGAETPPPPP 86 S + + S A PPPPP Sbjct: 15 SRVLRLCSRAAAPPPPP 65
>LOC_Os02g02340:12002.t00133:unspliced-genomic glycerol-3-phosphate acyltransferase 8, putative, expressed| Length = 2863 Score = 26.7 bits (52), Expect(2) = 4.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 / -3 Query: 115 SGAETPPPPPCR 80 S + PPPPPCR Sbjct: 119 SSSPPPPPPPCR 84 Score = 22.1 bits (42), Expect(2) = 4.3 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -1 / -1 Query: 176 LERHLPPSSAAAALRRH 126 + RH PP + +RRH Sbjct: 184 VRRHRPPRARRRVVRRH 134
>LOC_Os11g33250:12011.t02919:unspliced-genomic expressed protein| Length = 1956 Score = 26.7 bits (52), Expect(2) = 4.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 / +3 Query: 97 PPPPCRGSRDRVLAPHEFRPMR 32 PP P R R R+L P RP+R Sbjct: 231 PPRPPRQPRRRLLLP*RLRPLR 296 Score = 22.1 bits (42), Expect(2) = 4.5 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = -2 / +2 Query: 193 SEVRITLNDTFXXXXXXXPSAAMGVLSGAETPPPPPC 83 S RIT T S+A P PPPC Sbjct: 38 SRDRITAASTAYRRSPTTSSSASSASRRPTRPRPPPC 148
>LOC_Os12g43790:12012.t04047:unspliced-genomic ocs element-binding factor 1, putative, expressed| Length = 809 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 / +2 Query: 118 LSGAETPPPPPCRGSRDR 65 LSG+ TPPPPP SR R Sbjct: 431 LSGSSTPPPPPAVASRCR 484
>LOC_Os08g43130:12008.t04040:unspliced-genomic protein NAP1, putative, expressed| Length = 12839 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -2 / +1 Query: 103 TPPPPPCRGSRDRVLAP 53 TPPPPP RGS +R L P Sbjct: 25 TPPPPPPRGS*ERELPP 75
>LOC_Os08g05720:12008.t00466:unspliced-genomic integral membrane protein| Length = 750 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 / -3 Query: 124 GVLSGAETPPPPPCRGSRDRVLAP 53 GV S PPPP CR +R R P Sbjct: 430 GVASSCAGPPPPRCRTARTRTRTP 359
>LOC_Os07g42740:12007.t03923:unspliced-genomic calmodulin binding protein, putative, expressed| Length = 1583 Score = 31.8 bits (63), Expect = 4.5 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 / -3 Query: 115 SGAETPPPPPCRGSRDRV 62 S + PPPPP G RDRV Sbjct: 858 SSSAPPPPPPLNGERDRV 805
>LOC_Os07g38270:12007.t03493:unspliced-genomic insulin-degrading enzyme, putative, expressed| Length = 16948 Score = 31.8 bits (63), Expect = 4.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 / +1 Query: 522 LYSTMLHPLYNRASTCFYSCYI 457 L+ LHPLY C+ SCYI Sbjct: 10993 LWKQFLHPLYRYTFGCYCSCYI 11058
>LOC_Os07g05270:12007.t00410:unspliced-genomic hypothetical protein| Length = 392 Score = 31.8 bits (63), Expect = 4.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -2 / +3 Query: 136 SAAMGVLSGAETPPPPPCRGSRDRVLAPHE 47 S+ G + +PP PPCR R R + P E Sbjct: 30 SSLHGAAQSSTSPPCPPCRRWRQRGITPRE 119
>LOC_Os06g24230:12006.t02235:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2511 Score = 31.8 bits (63), Expect = 4.5 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -2 / -1 Query: 574 LANCIHPVNHRAGCWWQIILNHVTSIIQPSIDMLLFLLYI 455 L NCI V+ GCW +++ V I +P + + + + YI Sbjct: 558 LVNCISKVHDILGCWKVYLVHPVILIYRPHLYLGIVIWYI 439
>LOC_Os06g04500:12006.t00340:unspliced-genomic ER-derived vesicles protein ERV14, putative, expressed| Length = 3628 Score = 31.8 bits (63), Expect = 4.5 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +2 / +3 Query: 332 TAKCRQRVLEAWLGAAPHSPRQSWSYGGVFLVIVRVNNEETYI* 463 + +C + + +W G SWS+ LV+V VN ++T I* Sbjct: 2871 SCRCNRNI*SSWPGEETPPF*DSWSHYSPILVLVLVNKQQTTI* 3002
>LOC_Os03g40000:12003.t03431:unspliced-genomic expressed protein| Length = 1915 Score = 31.8 bits (63), Expect = 4.5 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -1 / -1 Query: 206 GELGVGGEDHLERHLPPSSAAAALRRHGCAVRCR 105 G G +H E LP AAA RR GC CR Sbjct: 1534 GAWGEAKGEHGEAQLPVCPDAAAARRRGCGRGCR 1433
>LOC_Os09g37720:12009.t03246:unspliced-genomic RNA binding protein, putative, expressed| Length = 992 Score = 25.8 bits (50), Expect(2) = 4.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -2 / +2 Query: 115 SGAETPPPPPCR 80 S A TPPPPP R Sbjct: 356 SAARTPPPPPPR 391 Score = 23.1 bits (44), Expect(2) = 4.7 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 / +2 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSPA 2 PPPPP +R AP R A + +S A Sbjct: 374 PPPPPRCTARSSTAAPSPPPSRRTTAAQPSSSA 472
>LOC_Os05g18604:12005.t004711:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass, expressed| Length = 33185 Score = 25.4 bits (49), Expect(2) = 4.7 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 / -3 Query: 94 PPPCRGSRDRVLAPHEFRPMRCDAMR 17 PPP R +++R PH+ P+ + R Sbjct: 22137 PPPLRPAKNRRHHPHDAAPLPLEIRR 22060 Score = 23.1 bits (44), Expect(2) = 4.7 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = -2 / -1 Query: 100 PPPPPC 83 PPPPPC Sbjct: 22202 PPPPPC 22185
>LOC_Os04g34570:12004.t03132:unspliced-genomic expressed protein| Length = 5520 Score = 25.4 bits (49), Expect(3) = 5.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 / +3 Query: 103 TPPPPPCRGSRDRV 62 +PPPPP G R R+ Sbjct: 4863 SPPPPPFGGGRRRI 4904 Score = 24.4 bits (47), Expect(3) = 5.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -1 / +3 Query: 83 PGVA**SFGASRVSADAMRCDAPHESG 3 PG A R +AD RC P E G Sbjct: 5190 PGAAATKVDVLRAAADVPRCGEPSEPG 5270 Score = 22.6 bits (43), Expect(3) = 5.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -3 / +3 Query: 414 PP*LQLCRGE*GAAPS 367 PP*LQL R + A PS Sbjct: 4074 PP*LQLRRAQPAATPS 4121
>LOC_Os01g53630:12001.t04782:unspliced-genomic ulp1 protease family, C-terminal catalytic domain containing| protein, expressed Length = 7827 Score = 24.4 bits (47), Expect(2) = 5.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 / +1 Query: 127 MGVLSGAETPPPPP 86 +G S A TPPPPP Sbjct: 166 VGSSSPAVTPPPPP 207 Score = 24.0 bits (46), Expect(2) = 5.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 / +2 Query: 176 LERHLPPSSAAAALRRHGC 120 L+R PP AAA RR C Sbjct: 35 LDRRKPPPCAAACRRRWPC 91
>LOC_Os10g27230:12010.t02129:unspliced-genomic CCR4-NOT transcription complex subunit 6, putative, expressed| Length = 5498 Score = 26.3 bits (51), Expect(2) = 5.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 / -2 Query: 136 SAAMGVLSGAETPPPPP 86 SAA+ + S A PPPPP Sbjct: 481 SAALLLFSPAPAPPPPP 431 Score = 22.1 bits (42), Expect(2) = 5.5 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -2 / -2 Query: 100 PPPPPCRGSRDRVLAPH 50 PPPPP R + PH Sbjct: 433 PPPPPPSAHRRKR*IPH 383
>LOC_Os05g44922:12005.t03980:unspliced-genomic 6-phosphofructokinase, putative, expressed| Length = 5302 Score = 24.4 bits (47), Expect(2) = 5.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 / +3 Query: 118 LSGAETPPPPP 86 L+ A TPPPPP Sbjct: 6 LADAPTPPPPP 38 Score = 24.0 bits (46), Expect(2) = 5.5 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHE 47 PPPPP + ++ P E Sbjct: 27 PPPPPLTHTSSAIIKPQE 80
>LOC_Os03g56050:12003.t04865:unspliced-genomic ANT-like protein, putative, expressed| Length = 5190 Score = 24.4 bits (47), Expect(2) = 5.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 / +2 Query: 188 GEDHLERHLPPSSAAAA 138 G+D E+H PP A AA Sbjct: 3026 GQDPGEQHAPPGGAGAA 3076 Score = 24.0 bits (46), Expect(2) = 5.6 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -2 / +1 Query: 124 GVLSGAETPPPPPCRGSRDR 65 G PPPP C+ R+R Sbjct: 3148 GTWRSGRWPPPPRCQRRRER 3207
>LOC_Os08g27120:12008.t02476:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5081 Score = 25.4 bits (49), Expect(2) = 5.6 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 / -3 Query: 118 LSGAETPPPPPCRG 77 ++G P PPPC G Sbjct: 2145 VAGGRMPAPPPCHG 2104 Score = 23.1 bits (44), Expect(2) = 5.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 / -2 Query: 200 LGVGGEDHLERHLPPSSAAAALR 132 LG+ G L R PP+ AA +R Sbjct: 2338 LGIAGLRRLPRFSPPAIAAPPVR 2270
>LOC_Os05g44100:12005.t03899:unspliced-genomic trehalose synthase, putative, expressed| Length = 4815 Score = 24.4 bits (47), Expect(2) = 5.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMR 17 PPPPP R R A H P R +R Sbjct: 492 PPPPPRRRPRRDGGALHRHAPRRRARLR 575 Score = 24.0 bits (46), Expect(2) = 5.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 / +3 Query: 127 MGVLSGAETPPPPPCR 80 +GVL G PPPP R Sbjct: 462 VGVLVGRRLAPPPPPR 509
>LOC_Os05g08854:12005.t004721:unspliced-genomic expressed protein| Length = 3613 Score = 25.4 bits (49), Expect(2) = 5.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 / -3 Query: 88 PCRGSRDRVLAPHEFRP 38 PCRG++ APH+ RP Sbjct: 3383 PCRGAQGLGGAPHQERP 3333 Score = 23.1 bits (44), Expect(2) = 5.7 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 / -2 Query: 109 AETPPPPPCRGSR 71 + +PPPP C SR Sbjct: 3438 SRSPPPPSCTTSR 3400
>LOC_Os04g44330:12004.t03973:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3095 Score = 25.8 bits (50), Expect(2) = 5.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 / -2 Query: 100 PPPPPCRGSR 71 PPPP CRG R Sbjct: 118 PPPPHCRGRR 89 Score = 22.6 bits (43), Expect(2) = 5.8 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -2 / -2 Query: 85 CRGSRDRVLAPHEFRPMRC 29 C G R+ PH RP C Sbjct: 79 CGGGGGRLSPPHRRRPSYC 23
>LOC_Os05g08850:12005.t00762:unspliced-genomic cytochrome P450 86A2, putative, expressed| Length = 2598 Score = 25.4 bits (49), Expect(2) = 5.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 / +3 Query: 88 PCRGSRDRVLAPHEFRP 38 PCRG++ APH+ RP Sbjct: 1467 PCRGAQGLGGAPHQERP 1517 Score = 23.1 bits (44), Expect(2) = 5.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 / +2 Query: 109 AETPPPPPCRGSR 71 + +PPPP C SR Sbjct: 1412 SRSPPPPSCTTSR 1450
>LOC_Os10g04610:12010.t00345:unspliced-genomic F-box domain containing protein, expressed| Length = 2409 Score = 24.4 bits (47), Expect(2) = 5.9 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -1 / +2 Query: 188 GEDHLERHLPPSSAAAALRRH 126 G L LPP AA LRRH Sbjct: 314 GTPRLPLPLPPRRAAPPLRRH 376 Score = 24.0 bits (46), Expect(2) = 5.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -2 / +1 Query: 103 TPPPPPCRGSRDR 65 TPPPPP SR R Sbjct: 361 TPPPPPPPPSRGR 399
>LOC_Os07g02910:12007.t00181:unspliced-genomic F-box domain containing protein, expressed| Length = 1823 Score = 24.4 bits (47), Expect(2) = 6.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 / +2 Query: 136 SAAMGVLSGAETPPPPP 86 +AA S A +PPPPP Sbjct: 239 TAATAPTSPASSPPPPP 289 Score = 24.0 bits (46), Expect(2) = 6.0 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFRP 38 PPPP + R L P RP Sbjct: 369 PPPPTLQSHRPHGLGPDHRRP 431
>LOC_Os03g16660:12003.t01448:unspliced-genomic hypothetical protein| Length = 1719 Score = 24.9 bits (48), Expect(2) = 6.1 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -2 / +1 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSPA 2 PP PP R PH P+R AM + A Sbjct: 541 PPLPPPPRRRPLPPCPHRAPPLRLSAMAAIASA 639 Score = 23.5 bits (45), Expect(2) = 6.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 / +1 Query: 115 SGAETPPPPP 86 S AE PPPPP Sbjct: 502 SRAERPPPPP 531
>LOC_Os07g03190:12007.t00209:unspliced-genomic CF9, putative, expressed| Length = 1378 Score = 25.8 bits (50), Expect(2) = 6.2 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -2 / +2 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSPA 2 PPPPP R P+ A R SPA Sbjct: 398 PPPPPVTRRPSRTACSTGSYPLPASASRRPSPA 496 Score = 22.6 bits (43), Expect(2) = 6.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 / +2 Query: 109 AETPPPPP 86 A TPPPPP Sbjct: 377 AATPPPPP 400
>LOC_Os05g05510:12005.t00441:unspliced-genomic expressed protein| Length = 1361 Score = 25.8 bits (50), Expect(2) = 6.2 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -1 / +1 Query: 173 ERHLPPSSAAAALRRHGCAVRCR 105 ER L P A LRRH C R R Sbjct: 895 ERRLLPRDLEALLRRHRCRHRRR 963 Score = 22.6 bits (43), Expect(2) = 6.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 / +1 Query: 109 AETPPPPP 86 AE PPPPP Sbjct: 1048 AERPPPPP 1071
>LOC_Os04g44710:12004.t04010:unspliced-genomic CPL1, putative, expressed| Length = 10472 Score = 28.1 bits (55), Expect(2) = 6.2 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 / -3 Query: 328 LMPTPSLVMMALVWGGTLNSSAANLSTAVKGAAS 227 ++PT L++ L WG T N AN S A G +S Sbjct: 9960 ILPTVMLLISTLHWGITGNRVRANHSRAPCGVSS 9859 Score = 25.8 bits (50), Expect(2) = 6.2 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -2 / -2 Query: 133 AAMGVLSGAETPPPPPCRGSRDRVLAPH 50 AA G G+ P PPP SR PH Sbjct: 103 AATGGPPGSPAPTPPPPGPSRPWATPPH 20
>LOC_Os10g33790:12010.t02680:unspliced-genomic expressed protein| Length = 4935 Score = 31.3 bits (62), Expect = 6.2 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 / +1 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSPA 2 PPPP R R L PH RP+ M +PA Sbjct: 52 PPPPSPRRLRR*PLPPHHRRPLTFSPMSTAAPA 150
>LOC_Os09g29140:12009.t02592:unspliced-genomic hypothetical protein| Length = 1643 Score = 31.3 bits (62), Expect = 6.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 / +1 Query: 115 SGAETPPPPPCRGSRDRVLAP 53 +G +PPPPP RG R + L P Sbjct: 733 AGRRSPPPPPRRGRRPQPLPP 795
>LOC_Os08g43460:12008.t04071:unspliced-genomic expressed protein| Length = 2106 Score = 31.3 bits (62), Expect = 6.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 / -3 Query: 112 GAETPPPPPCRGSRDRVLAPHEFRPM 35 GA +P PPP R R R ++ FRP+ Sbjct: 637 GARSPSPPPRRSPRLRSVSVRPFRPL 560
>LOC_Os08g27810:12008.t02540:unspliced-genomic OsWAK115 - OsWAK receptor-like protein (OsWAK-RLP), expressed| Length = 2191 Score = 31.3 bits (62), Expect = 6.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 / +3 Query: 5 RTREAHRIASHRPKLVRRQNSITRPP 82 R R HR A +P+++RR+ RPP Sbjct: 438 RRRRGHRAAQRQPRVLRRRRLRARPP 515
>LOC_Os08g06120:12008.t00502:unspliced-genomic RAV-like protein, putative| Length = 864 Score = 31.3 bits (62), Expect = 6.2 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -2 / +2 Query: 136 SAAMGVLSGAETPPPPPCRGSRDR 65 + A + A PPPPPCR R R Sbjct: 500 ATATAAATSASPPPPPPCRRRRGR 571
>LOC_Os07g39850:12007.t03646:unspliced-genomic expressed protein| Length = 5538 Score = 31.3 bits (62), Expect = 6.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 / -1 Query: 12 VRRIASHRIGRNS*GAKTLSRDPRQGGGGGVSAPDSTPMAAE 137 VRR+A H + + + +GGGGG A ST A E Sbjct: 4812 VRRLAQHGVALEDVAERHAAGGVARGGGGGGEAATSTECAGE 4687
>LOC_Os06g34690:12006.t03166:unspliced-genomic T-complex protein 1 subunit gamma, putative, expressed| Length = 6983 Score = 31.3 bits (62), Expect = 6.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 / +2 Query: 109 AETPPPPPCRGSRDRVLA 56 A TPPPPP R RDR +A Sbjct: 77 APTPPPPPPRLPRDRAMA 130
>LOC_Os05g45580:12005.t04046:unspliced-genomic expressed protein| Length = 2724 Score = 31.3 bits (62), Expect = 6.2 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 / +3 Query: 121 VLSGAETPPPPPCRGSRDRVLAP 53 +L G TP PPP +GSR R AP Sbjct: 108 LLPGNRTPHPPPPQGSRPRKPAP 176
>LOC_Os05g17820:12005.t01551:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 693 Score = 31.3 bits (62), Expect = 6.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +3 / +1 Query: 66 LSRDPRQGGGGGVSAPDSTPMAAE 137 L DP+Q G G VSAP P +AE Sbjct: 106 LGSDPKQSGRGQVSAPFGIPKSAE 177
>LOC_Os04g24430:12004.t02155:unspliced-genomic sucrose synthase 2, putative, expressed| Length = 5188 Score = 31.3 bits (62), Expect = 6.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 / -2 Query: 583 WHCLANCIHPVNHRAGC 533 WHCL N +H + + GC Sbjct: 129 WHCLGNAVHSLETQLGC 79
>LOC_Os04g17650:12004.t01515:unspliced-genomic sucrose synthase 2, putative| Length = 4916 Score = 31.3 bits (62), Expect = 6.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 / -3 Query: 583 WHCLANCIHPVNHRAGC 533 WHCL N +H + + GC Sbjct: 54 WHCLGNAVHSLETQLGC 4
>LOC_Os04g13210:12004.t01142:unspliced-genomic multidrug resistance-associated protein 4, putative, expressed| Length = 10723 Score = 31.3 bits (62), Expect = 6.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 / -3 Query: 136 SAAMGVLSGAETPPPPPCR 80 ++A G SGA PPPPCR Sbjct: 395 ASAPGTRSGARPAPPPPCR 339 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 / +2 Query: 365 WLGAAPHSPRQSWSYGGVFLVIVRVNNEETYI 460 W G P P + YGG+FL + NN T + Sbjct: 4280 WTGDHPDHPLDTPGYGGIFLNLTVENNGSTLL 4375
>LOC_Os03g63560:12003.t05573:unspliced-genomic CRR2, putative, expressed| Length = 2381 Score = 31.3 bits (62), Expect = 6.2 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = -2 / +2 Query: 118 LSGAETPPPPPCRGSRDRVLAPHEFRP 38 L A PPPPP R S R+L P RP Sbjct: 347 LPRARPPPPPPPRLSGPRLLRPPPVRP 427
>LOC_Os03g52980:12003.t04621:unspliced-genomic CWF19L2 protein, putative, expressed| Length = 5381 Score = 31.3 bits (62), Expect = 6.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 / +1 Query: 109 AETPPPPPCRGSRDRVLAPHEFRP 38 A PPPPP + SR +L+P++ P Sbjct: 55 AGAPPPPPLKPSRSPLLSPNQRSP 126
>LOC_Os03g50250:12003.t04367:unspliced-genomic luminal-binding protein 4 precursor, putative, expressed| Length = 2485 Score = 31.3 bits (62), Expect = 6.2 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 / -2 Query: 109 AETPPPPPCRGSRDRVLAPHEFRPMRCDAMRL 14 A P PPPC G R+ AP R R A ++ Sbjct: 618 ASRPCPPPCTGDTSRLAAPPRRRTCRRQAGKI 523
>LOC_Os03g33230:12003.t02916:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5764 Score = 31.3 bits (62), Expect = 6.2 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 / -1 Query: 121 VLSGAETPPPPPCRGSRDR 65 ++ A TPPPPP +GSR R Sbjct: 2857 IMRSAGTPPPPPRQGSRRR 2801
>LOC_Os02g52730:12002.t04853:unspliced-genomic ferredoxin--nitrite reductase, chloroplast precursor, putative,| expressed Length = 3309 Score = 31.3 bits (62), Expect = 6.2 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -1 / +2 Query: 176 LERHLPPSSAAAALRRHGCAVRCR 105 L+R LPPSS AA RR AVR R Sbjct: 275 LQRFLPPSSHVAASRRRPPAVRTR 346
>LOC_Os01g55340:12001.t04946:unspliced-genomic expressed protein| Length = 1077 Score = 31.3 bits (62), Expect = 6.2 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +3 / -3 Query: 18 RIASHRIGRNS*GAKTLSRDPRQGGGGG 101 R A+ R+GR G++ SR PR GGG G Sbjct: 703 RPATGRLGRTGWGSRGRSRRPRGGGGYG 620
>LOC_Os12g29650:12012.t02674:unspliced-genomic expressed protein| Length = 1893 Score = 26.7 bits (52), Expect(2) = 6.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 / -3 Query: 124 GVLSGAETPPPPPCRGSR 71 G SGA T PPPP G R Sbjct: 136 GRWSGAATTPPPPPTGRR 83 Score = 24.9 bits (48), Expect(2) = 6.3 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 / -1 Query: 185 EDHLERHLPPSSAAAA 138 E+H+ RH+ S+AAAA Sbjct: 1554 EEHVRRHVVASAAAAA 1507
>LOC_Os09g25390:12009.t02218:unspliced-genomic phospholipase D alpha 1, putative, expressed| Length = 3793 Score = 27.2 bits (53), Expect(2) = 6.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 / +2 Query: 329 PTAKCRQRVLEAWLGAAPHSPRQ 397 P A+ R RV + + APH PR+ Sbjct: 3185 PRARARARVPDVAVARAPHGPRR 3253 Score = 25.4 bits (49), Expect(2) = 6.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 / +1 Query: 72 RDPRQGGGGGVSAPD 116 R PR+ GGGG PD Sbjct: 2416 RVPRRAGGGGGDGPD 2460
>LOC_Os08g35870:12008.t03327:unspliced-genomic F-box domain containing protein, expressed| Length = 9449 Score = 24.9 bits (48), Expect(2) = 7.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 / +3 Query: 121 VLSGAETPPPPP 86 +LS E PPPPP Sbjct: 6105 ILSPCEQPPPPP 6140 Score = 23.1 bits (44), Expect(2) = 7.1 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLA 56 PPPPP R R R A Sbjct: 6132 PPPPPPRRRRPRQAA 6176
>LOC_Os08g44420:12008.t04166:unspliced-genomic kinesin-related protein, putative, expressed| Length = 6113 Score = 30.4 bits (60), Expect(2) = 7.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 / +1 Query: 115 SGAETPPPPPCRGSRDR 65 S + PPPPPCR R R Sbjct: 19 SSSSPPPPPPCRRGRTR 69 Score = 22.6 bits (43), Expect(2) = 7.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 / +2 Query: 72 VIEFWRLTSFGRCDAM 25 VI+ W L SFG C ++ Sbjct: 5900 VIKCWLLVSFGCCGSV 5947
>LOC_Os12g07810:12012.t00663:unspliced-genomic aldehyde dehydrogenase, dimeric NADP-preferring, putative,| expressed Length = 8783 Score = 24.4 bits (47), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 / +2 Query: 72 RDPRQGGGGG 101 RDP GGGGG Sbjct: 149 RDPADGGGGG 178 Score = 23.5 bits (45), Expect(2) = 7.1 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 / +2 Query: 87 GGGGGVSAPDSTPMAA 134 GGGGGV P P A Sbjct: 173 GGGGGVPRPPRRPRQA 220
>LOC_Os08g14770:12008.t01351:unspliced-genomic BIO1, putative, expressed| Length = 8232 Score = 24.0 bits (46), Expect(2) = 7.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 / +3 Query: 136 SAAMGVLSGAETPPPPP 86 SA+ L+ PPPPP Sbjct: 93 SASSATLAATPPPPPPP 143 Score = 24.0 bits (46), Expect(2) = 7.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 / +3 Query: 100 PPPPPCRGSR 71 PPPPPC R Sbjct: 144 PPPPPCPSPR 173
>LOC_Os05g51500:12005.t04576:unspliced-genomic eukaryotic translation initiation factor 5B, putative, expressed| Length = 6124 Score = 24.0 bits (46), Expect(2) = 7.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 / +1 Query: 136 SAAMGVLSGAETPPPPP 86 S M S TPPPPP Sbjct: 178 SMTMSTPSRRRTPPPPP 228 Score = 24.0 bits (46), Expect(2) = 7.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = -2 / +1 Query: 100 PPPPPCRGSRDRVLAPHEFR 41 PPPPP R S R A R Sbjct: 220 PPPPPTRTSPSRRAAARRAR 279
>LOC_Os08g32600:12008.t03005:unspliced-genomic protein kinase domain containing protein, expressed| Length = 5414 Score = 24.4 bits (47), Expect(2) = 7.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 / -2 Query: 191 GGEDHLERHLPPSSAAAALRRH 126 GGE LE +P S LRRH Sbjct: 394 GGEGLLEATIPSSPIPLDLRRH 329 Score = 23.5 bits (45), Expect(2) = 7.4 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 / -1 Query: 109 AETPPPPPCRGSR 71 A+ PP PP GSR Sbjct: 326 ADPPPEPPTAGSR 288
>LOC_Os01g50220:12001.t04458:unspliced-genomic retrotransposon protein, putative, LINE subclass| Length = 5173 Score = 24.0 bits (46), Expect(2) = 7.4 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 / +3 Query: 109 AETPPPPP 86 +ETPPPPP Sbjct: 4146 SETPPPPP 4169 Score = 24.0 bits (46), Expect(2) = 7.4 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFR 41 PPPP + R V A H R Sbjct: 4158 PPPPTAKFGRSGVAAAHHCR 4217
>LOC_Os02g50570:12002.t04641:unspliced-genomic actin binding protein, putative, expressed| Length = 4722 Score = 25.4 bits (49), Expect(2) = 7.5 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -2 / +1 Query: 133 AAMGVLSGAETPPPPP 86 AA V S A PPPPP Sbjct: 1255 AAAAVASPAPPPPPPP 1302 Score = 22.6 bits (43), Expect(2) = 7.5 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -2 / +1 Query: 100 PPPPPCRG 77 PPPPP +G Sbjct: 1378 PPPPPAKG 1401
>LOC_Os05g38480:12005.t03390:unspliced-genomic kinesin-like protein KIF22, putative, expressed| Length = 3641 Score = 24.0 bits (46), Expect(2) = 7.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 / +1 Query: 130 AMGVLSGAETPPPPP 86 A L+G PPPPP Sbjct: 22 AASFLNGRRPPPPPP 66 Score = 24.0 bits (46), Expect(2) = 7.7 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 / +1 Query: 100 PPPPPCRGSRDRVLAP 53 PPPPP + VL+P Sbjct: 130 PPPPPSAAATGLVLSP 177
>LOC_Os02g55140:12002.t05090:unspliced-genomic leucine aminopeptidase 3, chloroplast precursor, putative,| expressed Length = 3437 Score = 24.4 bits (47), Expect(2) = 7.7 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRC 29 PPPPP R R +P RC Sbjct: 219 PPPPPPRAPRSGSPSPTPSSRRRC 290 Score = 23.5 bits (45), Expect(2) = 7.7 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 / +3 Query: 112 GAETPPPPP 86 G +TPPPPP Sbjct: 204 GWDTPPPPP 230
>LOC_Os06g43850:12006.t04075:unspliced-genomic ATP synthase delta chain, mitochondrial precursor, putative,| expressed Length = 2851 Score = 24.9 bits (48), Expect(2) = 7.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRV 62 PPPPP RG R R+ Sbjct: 78 PPPPPHRGFRLRL 116 Score = 23.1 bits (44), Expect(2) = 7.8 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 / +3 Query: 121 VLSGAETPPPPP 86 +LS +PPPPP Sbjct: 51 LLSSPRSPPPPP 86
>LOC_Os01g15900:12001.t01441:unspliced-genomic expressed protein| Length = 3464 Score = 26.7 bits (52), Expect(2) = 7.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 / -3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSP 5 PPPPP SR P P A R P Sbjct: 321 PPPPPAGRSRPPPQQPQPLEPAGSPARRALCP 226 Score = 25.4 bits (49), Expect(2) = 7.9 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -2 / -3 Query: 616 FFFFANKDRST 584 FFFF NKDR T Sbjct: 3414 FFFFKNKDRHT 3382
>LOC_Os08g40840:12008.t03814:unspliced-genomic exo70 exocyst complex subunit family protein| Length = 2595 Score = 24.4 bits (47), Expect(2) = 7.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 / -3 Query: 115 SGAETPPPPP 86 SG TPPPPP Sbjct: 454 SGRGTPPPPP 425 Score = 23.5 bits (45), Expect(2) = 7.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = -2 / -3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSP 5 PPPPP R R P R R T P Sbjct: 436 PPPPPASRPRPRAPPPPRRRRAAGPRGRRTPP 341
>LOC_Os12g25440:12012.t02264:unspliced-genomic conserved hypothetical protein| Length = 2510 Score = 24.9 bits (48), Expect(2) = 7.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -2 / -1 Query: 106 ETPPPPPCRGSR 71 ++PPPP C G R Sbjct: 290 DSPPPPTCAGRR 255 Score = 23.1 bits (44), Expect(2) = 7.9 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = -2 / -2 Query: 325 MPTPSLVMMALVWGGTLNSSAANLSTAVKGAASGTLNTLKGSLG 194 +PT S A WG + S L AV + +TL G Sbjct: 541 VPTGSFSAAAAAWGAHAHRSRLRLQAAVSPSMHPPPSTLPPGSG 410
>LOC_Os10g07080:12010.t00570:unspliced-genomic expressed protein| Length = 2400 Score = 25.4 bits (49), Expect(2) = 7.9 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMR 17 P P G R + PH RP+R MR Sbjct: 498 PGGAPAGGVRAGGIQPHRHRPLRRPGMR 581 Score = 22.6 bits (43), Expect(2) = 7.9 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -1 / +3 Query: 182 DHLERHLPPSSAAAALR 132 DH HLPP+ A R Sbjct: 339 DHRRHHLPPARAREGRR 389
>LOC_Os12g32190:12012.t02920:unspliced-genomic expressed protein| Length = 2325 Score = 25.4 bits (49), Expect(2) = 7.9 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAP 53 PPPPP R S AP Sbjct: 1656 PPPPPSRSSAPGAAAP 1703 Score = 22.6 bits (43), Expect(2) = 7.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 / +3 Query: 136 SAAMGVLSGAETPPPPP 86 S + G +G PPPPP Sbjct: 1617 SRSRGRRAGPPPPPPPP 1667
>LOC_Os10g18720:12010.t01419:unspliced-genomic hypothetical protein| Length = 2272 Score = 24.4 bits (47), Expect(2) = 7.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 / -3 Query: 352 TLPALCCGLMPTPSLVMMAL 293 T PAL CG +P L++++L Sbjct: 350 TPPALSCGRPASPRLLLLSL 291 Score = 23.5 bits (45), Expect(2) = 7.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 / -2 Query: 179 HLERHLPPSSAAAALRR 129 +L+ HLPP A LRR Sbjct: 279 NLQPHLPPRLCAVRLRR 229
>LOC_Os09g32960:12009.t02912:unspliced-genomic expressed protein| Length = 2250 Score = 24.9 bits (48), Expect(2) = 8.0 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -2 / -1 Query: 100 PPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSP 5 PPPPP S P EF R ++ SP Sbjct: 276 PPPPPPPPSPTTSYHPQEFFKNRIQEIKNRSP 181 Score = 23.1 bits (44), Expect(2) = 8.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 / -1 Query: 109 AETPPPPP 86 A TPPPPP Sbjct: 411 ASTPPPPP 388
>LOC_Os07g43700:12007.t04014:unspliced-genomic malate dehydrogenase, glyoxysomal precursor, putative, expressed| Length = 2182 Score = 24.4 bits (47), Expect(2) = 8.0 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -1 / -2 Query: 161 PPSSAAAALRRHGC 120 PPS AAAA RR C Sbjct: 1863 PPSLAAAARRRRPC 1822 Score = 23.5 bits (45), Expect(2) = 8.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -2 / -2 Query: 112 GAETPPPPPCR 80 GA PPPPP R Sbjct: 1755 GAPPPPPPPPR 1723
>LOC_Os02g02900:12002.t00190:unspliced-genomic expressed protein| Length = 1893 Score = 24.4 bits (47), Expect(2) = 8.1 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 / -2 Query: 100 PPPPPCRGSRDRVLAPH 50 PPPPP S L PH Sbjct: 1274 PPPPPPAASDSPPLPPH 1224 Score = 23.5 bits (45), Expect(2) = 8.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 / -2 Query: 112 GAETPPPPP 86 G TPPPPP Sbjct: 1415 GGTTPPPPP 1389
>LOC_Os05g32370:12005.t02833:unspliced-genomic pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16, putative,| expressed Length = 3583 Score = 26.7 bits (52), Expect(2) = 8.1 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 / -2 Query: 206 GELGVGGEDHLERHL 162 GE+GV G DH RHL Sbjct: 2223 GEVGVDGADHQLRHL 2179 Score = 25.4 bits (49), Expect(2) = 8.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = -2 / -1 Query: 100 PPPPPCR 80 PPPPPCR Sbjct: 1387 PPPPPCR 1367
>LOC_Os11g22940:12011.t01964:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5074 Score = 27.2 bits (53), Expect(2) = 8.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 / -2 Query: 136 SAAMGVLSGAETPPPPPCR 80 S G + A PPPPPC+ Sbjct: 831 SPPQGAPASASHPPPPPCQ 775 Score = 25.4 bits (49), Expect(2) = 8.1 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 / -1 Query: 564 AFILSIIGLAVGGKLYSTMLHPLYNRASTCFYSCY 460 + I+S IGL GKL + YN+A T S Y Sbjct: 3922 SLIISCIGLDSIGKLKTCPTRRNYNQADTTPMSAY 3818
>LOC_Os03g50030:12003.t04348:unspliced-genomic phospholipase A2, putative, expressed| Length = 1680 Score = 24.4 bits (47), Expect(2) = 8.1 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = -2 / +1 Query: 100 PPPPPCRGS 74 PPPPPC S Sbjct: 433 PPPPPCSSS 459 Score = 23.5 bits (45), Expect(2) = 8.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 / +1 Query: 136 SAAMGVLSGAETPPPPP 86 S G G+ +PPPPP Sbjct: 394 SRGCGCARGSLSPPPPP 444
>LOC_Os12g41720:12012.t03848:unspliced-genomic patatin-like phospholipase family protein, expressed| Length = 1916 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 / -3 Query: 136 SAAMGVLSGAETPPPPPCRGSRDRVLAPHE 47 SA GV +TPPPPP + ++L+ E Sbjct: 222 SALPGVPGSEQTPPPPPAPAPKRKLLSRRE 133
>LOC_Os12g38020:12012.t03483:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4669 Score = 30.9 bits (61), Expect = 8.6 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 / +1 Query: 118 LSGAETPPPPPCRGSRDRVLAPHEFRPMRCDAMR 17 L GA PP P R R P +F+P R + +R Sbjct: 679 LLGARPPPTAPAPRGRRRNTIPPDFQPWRSERLR 780
>LOC_Os12g07840:12012.t00666:unspliced-genomic ankyrin-like protein, putative, expressed| Length = 4692 Score = 30.9 bits (61), Expect = 8.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 / -1 Query: 103 TPPPPPCRGSRDRVLAP 53 +PPPPPCRG R +P Sbjct: 4254 SPPPPPCRGRPARSASP 4204
>LOC_Os09g28530:12009.t02531:unspliced-genomic hypothetical protein| Length = 417 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 / +3 Query: 54 GAKTLSRDPRQGGGGGVSAPDSTPMAAE 137 GA+ R QGGGGG+ +P +P+ E Sbjct: 303 GARRRRRRGEQGGGGGLHSPPVSPLWTE 386
>LOC_Os09g24230:12009.t02106:unspliced-genomic catalytic/ hydrolase, putative, expressed| Length = 2371 Score = 30.9 bits (61), Expect = 8.6 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / -3 Query: 54 GAKTLSRDPRQGGGGGVSAPDS 119 G T RD R+GGGGG AP S Sbjct: 68 GEGTDGRDQRRGGGGGGGAPKS 3
>LOC_Os08g15190:12008.t01393:unspliced-genomic expressed protein| Length = 1879 Score = 30.9 bits (61), Expect = 8.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 / -3 Query: 136 SAAMGVLSGAETPPPPPCRGSRDRVLAPHEFRP 38 S L G PPP P + S D +L+PH +P Sbjct: 1385 SGRFSPLPGRSPPPPRPIKRSPDPLLSPHIPQP 1287
>LOC_Os08g02220:12008.t00117:unspliced-genomic endoglucanase 1 precursor, putative, expressed| Length = 1911 Score = 30.9 bits (61), Expect = 8.6 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -1 / -2 Query: 170 RHLPPSSAAAALRRHGCAVR 111 RHLPP SAAA R G A R Sbjct: 1370 RHLPPRSAAAVAARRGGAAR 1311
>LOC_Os07g15220:12007.t01385:unspliced-genomic hypothetical protein| Length = 2983 Score = 30.9 bits (61), Expect = 8.6 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 / +3 Query: 22 SHRIASAETREAPKLYHATPG 84 +HR A A+ E P+LYH PG Sbjct: 792 AHRCAVAKPPEVPRLYHGWPG 854
>LOC_Os05g44300:12005.t03919:unspliced-genomic plant-specific domain TIGR01615 family protein, expressed| Length = 2117 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 / +2 Query: 18 RIASHRIGRNS*GAKTLSRDPRQGGGGG 101 R H G + L R+PR+GGGGG Sbjct: 542 RGGGHEADARGGGGRLLLREPRRGGGGG 625
>LOC_Os04g40490:12004.t03611:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 4074 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 / -3 Query: 179 HLERHLPPSSAAAALRRHGCAVR 111 H R +P ++A ALRRHG VR Sbjct: 238 HARRDVPKAAARQALRRHGLQVR 170
>LOC_Os03g53180:12003.t04641:unspliced-genomic hypothetical protein| Length = 459 Score = 30.9 bits (61), Expect = 8.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 / -1 Query: 121 VLSGAETPPPPPCR 80 +LS TPPPPPCR Sbjct: 456 LLSRTRTPPPPPCR 415
>LOC_Os03g44310:12003.t03819:unspliced-genomic translation initiation factor eIF-2B delta subunit, putative,| expressed Length = 5492 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 / +2 Query: 103 TPPPPPCRGSRDRVLAPHEFRPMR 32 +PPPPP + SR +L P RP R Sbjct: 245 SPPPPPLQRSRRLLLPPPRRRPRR 316
>LOC_Os03g38210:12003.t03270:unspliced-genomic myb-like DNA-binding domain containing protein, expressed| Length = 2953 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 / -1 Query: 115 SGAETPPPPPCRGSRDRVLAPHEF 44 S ++ PPPPP R R R AP E+ Sbjct: 2632 SCSDEPPPPPVRMGRSRTSAPLEW 2561
>LOC_Os03g31150:12003.t02714:unspliced-genomic expressed protein| Length = 3512 Score = 30.9 bits (61), Expect = 8.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPH 50 PPPPP RGS L PH Sbjct: 210 PPPPPLRGSPGSSLPPH 260
>LOC_Os03g16390:12003.t01423:unspliced-genomic expressed protein| Length = 1937 Score = 30.9 bits (61), Expect = 8.6 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -2 / -3 Query: 136 SAAMGVLSGAETPPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSP 5 +A+ G A PPPP GSRD R R +TSP Sbjct: 357 TASGGATRAATWPPPPRTPGSRDPPPPWRRHRTARAGRRAMTSP 226
>LOC_Os02g56160:12002.t05190:unspliced-genomic kelch motif family protein| Length = 1206 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -2 / -3 Query: 103 TPPPPPCRGSRDRVLAPHEFRPMR 32 TPPPPPC G R A R R Sbjct: 496 TPPPPPCHGRRTASAARRRRRSSR 425
>LOC_Os02g48990:12002.t04483:unspliced-genomic phosphatidylinositol transporter/ transporter, putative, expressed| Length = 6165 Score = 30.9 bits (61), Expect = 8.6 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = -2 / -2 Query: 115 SGAETPPPPPCRGSRDRVLAPHEFRPMRCDAMR 17 SG+ T PP P R SRDR RP +R Sbjct: 386 SGSRTQPPQPPRESRDRKQLARSNRPRSAGELR 288
>LOC_Os02g27790:12002.t02473:unspliced-genomic splicing factor 3B subunit 1, putative, expressed| Length = 3950 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 / +2 Query: 91 PPCRGSRDRVLAPHEFRPMRCDAM 20 P C SRDR L H + RCDA+ Sbjct: 821 P*CCNSRDRALGRHAWARRRCDAL 892
>LOC_Os02g16030:12002.t01396:unspliced-genomic harpin-induced protein, putative, expressed| Length = 5122 Score = 30.9 bits (61), Expect = 8.6 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 / -1 Query: 179 HLERHLPPSSAAAALRRHG 123 HLER LPP A RRHG Sbjct: 748 HLERQLPPPVPVADARRHG 692
>LOC_Os02g15950:12002.t01388:unspliced-genomic kelch motif family protein, expressed| Length = 2921 Score = 30.9 bits (61), Expect = 8.6 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 / +1 Query: 124 GVLSGAETPPPPPCRGSR 71 G + A+ PPPPP RG R Sbjct: 136 GAAAAAKPPPPPPARGQR 189
>LOC_Os02g09450:12002.t00792:unspliced-genomic glycerophosphodiester phosphodiesterase/ kinase, putative, expressed| Length = 4804 Score = 30.9 bits (61), Expect = 8.6 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -2 / +2 Query: 136 SAAMGVLSGAETPPPPPCRGSRDRVLAPHEFRPMRCDAMRLTS 8 S + S TPPPPP + +L P F+ +R +L S Sbjct: 3236 STSWPTASSPSTPPPPPPTSVSNNLLLPVSFQIIRARMKKLIS 3364
>LOC_Os01g34710:12001.t03028:unspliced-genomic transposon protein, putative, unclassified| Length = 5463 Score = 30.9 bits (61), Expect = 8.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -3 / -3 Query: 501 PLYNRASTCFYSCYI*VSSL 442 P+ N ASTCF SC++ ++ L Sbjct: 2269 PVVNNASTCFVSCFVVLTDL 2210
>LOC_Os12g02110:12012.t00108:unspliced-genomic conserved hypothetical protein| Length = 645 Score = 25.8 bits (50), Expect(2) = 8.7 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -2 / +2 Query: 136 SAAMGVLSGAETPPPPPC 83 S G + PPPPPC Sbjct: 68 SPGTGTSTSGHPPPPPPC 121 Score = 22.1 bits (42), Expect(2) = 8.7 Identities = 11/34 (32%), Positives = 13/34 (38%) Frame = -2 / +2 Query: 103 TPPPPPCRGSRDRVLAPHEFRPMRCDAMRLTSPA 2 +PPPPP +R P R R PA Sbjct: 173 SPPPPPSGTTRTSSAPPATSRSPSATNRRRRCPA 274
>LOC_Os04g39980:12004.t03563:unspliced-genomic gibberellin 20 oxidase 2, putative, expressed| Length = 2107 Score = 29.5 bits (58), Expect(2) = 9.2 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -1 / +1 Query: 158 PSSAAAALRRHGCAVRCRDXXXXALPGVA 72 P++AAA RR GCA R R G A Sbjct: 442 PAAAAARRRRRGCATRARGWAASGCRGTA 528 Score = 21.7 bits (41), Expect(2) = 9.2 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -2 / +1 Query: 94 PPPCRGSRDRVLAPHEFRPMRCDAMRLTSP 5 PP CR +R +P R R ++P Sbjct: 1006 PPACRSTRTPASSPCSRRTSALAGSRCSTP 1095
>LOC_Os10g05190:12010.t00398:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 11494 Score = 24.4 bits (47), Expect(2) = 9.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 / +3 Query: 161 PPSSAAAALRRHGCA 117 PP +AAAA +RH A Sbjct: 3438 PPRNAAAACQRHAAA 3482 Score = 23.1 bits (44), Expect(2) = 9.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 / +3 Query: 103 TPPPPPCRGSRDR 65 TPPPPP R +R Sbjct: 3597 TPPPPPPRRRANR 3635
>LOC_Os03g24930:12003.t02185:unspliced-genomic protein kinase APK1A, chloroplast precursor, putative, expressed| Length = 2184 Score = 26.3 bits (51), Expect(2) = 9.5 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 / -2 Query: 115 SGAETPPPPP 86 SG +TPPPPP Sbjct: 461 SGPDTPPPPP 432 Score = 24.9 bits (48), Expect(2) = 9.5 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 / -1 Query: 595 DRSTWHCLANCIHPVNHRAGCW 530 DRS W + + V R GCW Sbjct: 1200 DRSNWRRRS*VVCSVPSRGGCW 1135
>LOC_Os04g35910:12004.t03261:unspliced-genomic coiled-coil domain containing 55, putative, expressed| Length = 3148 Score = 28.1 bits (55), Expect(2) = 9.7 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 / +1 Query: 415 AAVAPTLSRGMRRSSEPCFKNTLPALCCGLMP 320 AA P R + PCF +LPA GL+P Sbjct: 55 AAGDPHRRRRRSPARRPCFLRSLPASSTGLLP 150 Score = 23.5 bits (45), Expect(2) = 9.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -2 / +1 Query: 115 SGAETPPPPPCR 80 S + PPPPP R Sbjct: 304 SSSRAPPPPPAR 339
>LOC_Os05g25210:12005.t02177:unspliced-genomic expressed protein| Length = 5607 Score = 24.0 bits (46), Expect(2) = 9.9 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -2 / +3 Query: 199 LGSEVRITLNDTFXXXXXXXPSAAMGVLSGAETPPPP 89 L S+VR T N T L + +PPPP Sbjct: 144 LASQVRPTPNSTMTMEAERDGEEQRRPLLSSSSPPPP 254 Score = 23.5 bits (45), Expect(2) = 9.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAPHEFR 41 P PP SRDR+ P FR Sbjct: 306 PDPPFQAPSRDRLTLPASFR 365
>LOC_Os02g36390:12002.t03276:unspliced-genomic nucleotide-sugar transporter/ sugar porter, putative, expressed| Length = 5589 Score = 24.9 bits (48), Expect(2) = 9.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 / +3 Query: 100 PPPPPCRGSRDRVLAP 53 PPPPP R SR + AP Sbjct: 390 PPPPPPRVSRRALGAP 437 Score = 22.6 bits (43), Expect(2) = 9.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 / +1 Query: 136 SAAMGVLSGAETPPPPP 86 SA+ G + PPPPP Sbjct: 352 SASSGTPHHHDAPPPPP 402
>LOC_Os01g70080:12001.t06309:unspliced-genomic NB-ARC domain containing protein, expressed| Length = 5355 Score = 24.9 bits (48), Expect(2) = 9.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 / -1 Query: 100 PPPPPCRGSRDRVLAP 53 PPPPP R S+ R P Sbjct: 4482 PPPPPPRVSQHRCCTP 4435 Score = 22.6 bits (43), Expect(2) = 9.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = -2 / -1 Query: 121 VLSGAETPPPPP 86 V SG PPPPP Sbjct: 4500 VPSGLPPPPPPP 4465 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 239,374,891 Number of extensions: 3986659 Number of successful extensions: 38061 Number of sequences better than 10.0: 176 Length of query: 205 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 157 Effective length of database: 52,912,542 Effective search space: 8307269094 Effective search space used: 8307269094 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
