| Clone Name | FLbaf86o06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q851Y7:GRXS7_ORYSJ Monothiol glutaredoxin-S7, chloroplast precur... | 32 | 0.51 | 2 | P83714:CTF2_MOUSE Cardiotrophin-2 precursor - Mus musculus (Mouse) | 30 | 2.5 | 3 | Q84Y95:GRS14_ARATH Monothiol glutaredoxin-S14, chloroplast precu... | 30 | 2.5 | 4 | Q9JJ74:RAMP1_RAT Receptor activity-modifying protein 1 precursor... | 29 | 5.6 |
|---|
>Q851Y7:GRXS7_ORYSJ Monothiol glutaredoxin-S7, chloroplast precursor - Oryza sativa| subsp. japonica (Rice) Length = 168 Score = 32.3 bits (72), Expect = 0.51 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +3 Query: 3 YKSGELQETLEKAMCS 50 YKSGELQETLEKAM S Sbjct: 153 YKSGELQETLEKAMLS 168
>P83714:CTF2_MOUSE Cardiotrophin-2 precursor - Mus musculus (Mouse)| Length = 204 Score = 30.0 bits (66), Expect = 2.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 84 VYCMMSLVICAKSTLLSPASPAVPHS 7 +YC+++ +C S LL P SPA P S Sbjct: 1 MYCLLATPLCLLSLLLPPLSPAAPIS 26
>Q84Y95:GRS14_ARATH Monothiol glutaredoxin-S14, chloroplast precursor - Arabidopsis| thaliana (Mouse-ear cress) Length = 173 Score = 30.0 bits (66), Expect = 2.5 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = +3 Query: 3 YKSGELQETLEKAMCS 50 +K+GELQE +EKAMCS Sbjct: 158 FKTGELQEEVEKAMCS 173
>Q9JJ74:RAMP1_RAT Receptor activity-modifying protein 1 precursor - Rattus norvegicus| (Rat) Length = 148 Score = 28.9 bits (63), Expect = 5.6 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = -3 Query: 247 THCTKFTIAKVHCTF----VTRYFIFLNHLQLSDC 155 THCTK K+ C + V ++FI ++H S C Sbjct: 70 THCTKLVANKIGCFWPNPEVDKFFIAVHHRYFSKC 104 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 52,061,012 Number of extensions: 1124138 Number of successful extensions: 2312 Number of sequences better than 10.0: 4 Number of HSP's gapped: 2312 Number of HSP's successfully gapped: 4 Length of query: 95 Length of database: 100,686,439 Length adjustment: 65 Effective length of query: 30 Effective length of database: 82,857,264 Effective search space: 2485717920 Effective search space used: 2485717920 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)