| Clone Name | FLbaf80g05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q58D65:TYW2_BOVIN tRNA wybutosine-synthesizing protein 2 homolog... | 32 | 3.6 | 2 | Q9NRI5:DISC1_HUMAN Disrupted in schizophrenia 1 protein - Homo s... | 32 | 4.7 |
|---|
>Q58D65:TYW2_BOVIN tRNA wybutosine-synthesizing protein 2 homolog - Bos taurus| (Bovine) Length = 438 Score = 32.3 bits (72), Expect = 3.6 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Frame = +3 Query: 27 KHSL--PKDKLSRLIYTLVAVP-RRAAEGERHVSAVHCKLTPGSCCAPGAILLPPPGEKC 197 KH L + ++ +L VA+P R A E+H+ + ++ PGS C P +L P P +K Sbjct: 30 KHKLLDRQHRVKKLRDGTVALPVLREALLEQHLRELRNRVAPGSTCVPTQLLDPVPSKKA 89 Query: 198 FPYA 209 Y+ Sbjct: 90 QSYS 93
>Q9NRI5:DISC1_HUMAN Disrupted in schizophrenia 1 protein - Homo sapiens (Human)| Length = 854 Score = 32.0 bits (71), Expect = 4.7 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 11/72 (15%) Frame = -3 Query: 187 PGGGRRMAPGAQQEPGVSLQCTAETCLSPSA-------ARR----GTATSV*INLDNLSL 41 PGGG + AP A GVS + + CL P+A ARR ++T I + ++ Sbjct: 2 PGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAV 61 Query: 40 GSECLFPGNFSG 5 G+ FPG SG Sbjct: 62 GTLFRFPGGVSG 73 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 188,011,352 Number of extensions: 4155041 Number of successful extensions: 12734 Number of sequences better than 10.0: 2 Number of HSP's gapped: 12724 Number of HSP's successfully gapped: 2 Length of query: 371 Length of database: 100,686,439 Length adjustment: 115 Effective length of query: 256 Effective length of database: 69,142,514 Effective search space: 17700483584 Effective search space used: 17700483584 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)