| Clone Name | FLbaf74i06 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g56830:12002.t05255:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2831 Score = 36.8 bits (74), Expect = 0.86 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +2 / +2 Query: 2555 PIRIYMPDHMKGFCYVVYHVIKVELGYVFLQLCGRAHDG 2671 PI ++P H+ + YVV H K+ G+ LQ C A DG Sbjct: 497 PISRFLPKHLYPY*YVVLHF*KIICGFFLLQNCLGAIDG 613
>LOC_Os07g06980:12007.t00577:unspliced-genomic histone deacetylase HDA110 isoform 1, putative, expressed| Length = 8859 Score = 29.5 bits (58), Expect(2) = 2.0 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +3 / +2 Query: 876 LCCVLCYKGRAGICISSTVWTCSWW 950 +CC C + C ++W CS W Sbjct: 3548 MCCQTCSRDMC*SC*LDSIWACSQW 3622 Score = 23.1 bits (44), Expect(2) = 2.0 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 / +1 Query: 741 VKFCSFCFSYRSCM 782 V +C+ CFS +CM Sbjct: 3379 VLYCTVCFSIINCM 3420
>LOC_Os10g14230:12010.t01143:unspliced-genomic transposon protein, putative, unclassified| Length = 2386 Score = 35.0 bits (70), Expect = 3.0 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 / -1 Query: 834 PRKPSTNFLYLLLTLTKSCRNGMKSKNCRILLS 736 P+ + F +LLL + +C+NG K +NC LLS Sbjct: 283 PKALRSLFHHLLLPFSHTCQNGSKPRNCTSLLS 185
>LOC_Os02g35140:12002.t03152:unspliced-genomic auxin response factor 1, putative, expressed| Length = 6036 Score = 35.0 bits (70), Expect = 3.0 Identities = 18/36 (50%), Positives = 21/36 (58%) Frame = -1 / -2 Query: 2422 RDKALCIQNNTESP*IEQTKPNHNLQSLSPIMSNIS 2315 R+KAL + NN ESP I HN SLSP +N S Sbjct: 644 REKALFMVNNAESPRIPTNSTPHNNPSLSPP*TNKS 537
>LOC_Os01g71660:12001.t06459:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2254 Score = 35.0 bits (70), Expect = 3.0 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -2 / -2 Query: 837 RPRKPSTNFLYLLLTLTKSCRNGMKSKNCRILLSTVHKPL 718 RP +P+ +FL + + + N SKN +LL+ HKPL Sbjct: 1323 RPCRPAKSFLSFMKLVNQDFVNEKTSKNIHLLLADRHKPL 1204
>LOC_Os09g39160:12009.t03382:unspliced-genomic thiol protease SEN102 precursor, putative, expressed| Length = 2139 Score = 33.1 bits (66), Expect(2) = 3.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 / +2 Query: 1521 SHLISVNYDFILFMGVGYICI*LDLLRFYIV 1613 S LI +Y+F+++ GVGY + L YI+ Sbjct: 1157 SVLIEASYEFMIYQGVGYTAVCLQYFSLYIL 1249 Score = 24.9 bits (48), Expect(2) = 3.3 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +1 / +1 Query: 514 TVEQFVCFHLCLLRWIGLCRLVGLVDSLEMFDMI 615 T+ Q +LC+ +IG C +V+++E + I Sbjct: 652 TIIQIHTCYLCIYTYIGSCWAFSVVEAVEGINAI 753
>LOC_Os12g16670:12012.t01520:unspliced-genomic expressed protein| Length = 1625 Score = 34.5 bits (69), Expect = 4.2 Identities = 20/54 (37%), Positives = 26/54 (48%) Frame = -3 / +1 Query: 170 LGINGGQNARLEYSQTKNSETRSARSEPITPLAITYLRLTRREGEEKRSEVKSS 9 L + Q A+ S T+ S RS RS TPLA + + EEKR E K + Sbjct: 1315 LSVRRLQRAKCSCSTTQESFGRSTRSTTFTPLAKSGTHGEEKRKEEKRREGKKA 1476
>LOC_Os12g07260:12012.t00610:unspliced-genomic DNA-binding protein, putative, expressed| Length = 5018 Score = 34.1 bits (68), Expect = 5.7 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = +3 / -2 Query: 1011 FVCVLDVTFLGSTLKEH 1061 F+C++DV+FLG T+K+H Sbjct: 4486 FLCIMDVSFLGITIKQH 4436
>LOC_Os01g17320:12001.t01578:unspliced-genomic DNA-binding protein, putative, expressed| Length = 4338 Score = 34.1 bits (68), Expect = 5.7 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = +3 / -3 Query: 1011 FVCVLDVTFLGSTLKEH 1061 F+C++DV+FLG T+K+H Sbjct: 3874 FLCIMDVSFLGITIKQH 3824
>LOC_Os12g10340:12012.t00911:unspliced-genomic rust resistance-like protein RP1-3, putative, expressed| Length = 2111 Score = 34.1 bits (68), Expect = 5.8 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +1 / -1 Query: 2557 YPDIHARPYERILLCCVP 2610 YPD+HA+ Y +I L CVP Sbjct: 1301 YPDVHAKMYSKIELSCVP 1248
>LOC_Os11g30410:12011.t02645:unspliced-genomic ubiquitin-like 1-activating enzyme E1A, putative, expressed| Length = 6316 Score = 34.1 bits (68), Expect = 5.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 / -1 Query: 171 PRHQRRTERSPGIQSNEEQRNKERE 97 P H+RR + +PG+ E +R +ERE Sbjct: 346 PPHKRRAKENPGLLGEERERERERE 272
>LOC_Os10g32348:12010.t02548:unspliced-genomic psbP family protein, expressed| Length = 15197 Score = 34.1 bits (68), Expect = 5.8 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 / -2 Query: 1875 KNSMCHAYNLNQLRGES*QYVPCLIST 1795 KNS+ H N+ L+ E YV CLIST Sbjct: 1864 KNSIIHVLNIINLKNEDCLYVQCLIST 1784
>LOC_Os10g32300:12010.t02546:unspliced-genomic TPR Domain containing protein, expressed| Length = 6086 Score = 34.1 bits (68), Expect = 5.8 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -2 / -1 Query: 1875 KNSMCHAYNLNQLRGES*QYVPCLIST 1795 KNS+ H N+ L+ E YV CLIST Sbjct: 1850 KNSIIHVLNIINLKNEDCLYVQCLIST 1770
>LOC_Os07g14850:12007.t01348:unspliced-genomic CESA6 - cellulose synthase, expressed| Length = 5718 Score = 34.1 bits (68), Expect = 5.8 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -1 / -3 Query: 754 LQNFTVNCPQTAVFHRKKIKHFVRRTLLNHLEWNRQNETTTFNLSVRSCQTSPGN 590 +Q F V+ + + KH + +L N ++ TTF L+ RSC++ P N Sbjct: 3397 IQTFHVDLYNANIRNHNSNKHNIDHKVLVPERLNLTSKKTTFRLAYRSCRSIPSN 3233
>LOC_Os09g27670:12009.t02445:unspliced-genomic hypothetical protein| Length = 1084 Score = 33.6 bits (67), Expect = 7.9 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +3 / -2 Query: 63 VCYGQWGNRFRSRAPCFAVLRL 128 VC+G WG R R R PC A RL Sbjct: 849 VCHGCWGRRARWRGPCPASARL 784
>LOC_Os09g24730:12009.t02154:unspliced-genomic hypothetical protein| Length = 1933 Score = 33.6 bits (67), Expect = 7.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -2 / +3 Query: 180 GTRPRHQRRTERSPGIQSNEEQRNKERE 97 G+ R QR E +PG Q+ E +R +ERE Sbjct: 594 GSHTREQRGGENAPGGQTRERERERERE 677
>LOC_Os06g37070:12006.t03402:unspliced-genomic expressed protein| Length = 2440 Score = 33.6 bits (67), Expect = 7.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 / +1 Query: 2585 KGFCYVVYHVIKVELGYV 2638 K FC V+Y ++KV LGYV Sbjct: 2104 KAFCCVIYSIVKVHLGYV 2157
>LOC_Os04g33480:12004.t005542:unspliced-genomic histone deacetylase 1, putative, expressed| Length = 5736 Score = 33.6 bits (67), Expect = 7.9 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 / +1 Query: 665 VIQ*CSAYKVLYLFAVKNSGLWTVDSKILQFLLFIPFLHDL 787 +++*CS K+L +F V +W V L +L +PF H++ Sbjct: 2734 ILR*CSTNKLLNIFYVLFGMMWLVIGPSLHSVLSLPFSHEV 2856
>LOC_Os01g43774:12001.t03892:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 4699 Score = 33.6 bits (67), Expect = 7.9 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 / +1 Query: 730 PQTAVFHRKKIKHFVRRTLLNHLEWNRQNETTTFNLSVR 614 P +++ IKH +RRT++N LE T NL+VR Sbjct: 682 PNLQHYYKNPIKH*IRRTIINELEEQLLFGTARGNLNVR 798 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 1,147,475,116 Number of extensions: 17625618 Number of successful extensions: 51120 Number of sequences better than 10.0: 19 Length of query: 1031 Length of database: 55,613,886 Length adjustment: 53 Effective length of query: 978 Effective length of database: 52,631,152 Effective search space: 51473266656 Effective search space used: 51473266656 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)