ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf77e02 |
|---|---|
| Clone Library Name | barley_pub |
>P41347:FTRC_MAIZE Ferredoxin-thioredoxin reductase catalytic chain, chloroplast| precursor - Zea mays (Maize) Length = 152 Score = 35.0 bits (79), Expect = 0.39 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +2 Query: 425 RSRAEQYAHHSSTFFCYEKSFTAVGIK 505 R +EQYA S+TFFC +K+ TAV IK Sbjct: 51 RKFSEQYARRSNTFFCADKTVTAVVIK 77 Score = 32.3 bits (72), Expect = 2.5 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +2 Query: 260 AEQYAHRSGTFLCYDECVTAV 322 +EQYA RS TF C D+ VTAV Sbjct: 54 SEQYARRSNTFFCADKTVTAV 74
>O14102:SAP49_SCHPO Spliceosome-associated protein 49 - Schizosaccharomyces pombe| (Fission yeast) Length = 335 Score = 32.3 bits (72), Expect = 2.5 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 7/107 (6%) Frame = +3 Query: 213 LAREAMSQEQGMSLSERSSMPTAPVPFCAMTSVSLLSHQDERDYLV*GDLPGSKKGVARE 392 +AR+ + +G S TA AM + L++ Y + G + G E Sbjct: 131 VARDENGRSKGYGFVSYDSFETADAAIEAMNNQFLMNKPITVSYAFKREGKGERHGDIAE 190 Query: 393 GMLQE--KRMAPLGAEQSSMP-----TTPAPFSATRSPSPLSASSCP 512 L K+ QS++P TPAP SA +P+ ++A+S P Sbjct: 191 RKLAAAAKKNKVAVTPQSTLPPGFSPATPAPTSAANTPATIAATSIP 237
>Q5XIR6:IQCD_RAT IQ domain-containing protein D - Rattus norvegicus (Rat)| Length = 457 Score = 32.0 bits (71), Expect = 3.3 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Frame = +1 Query: 364 QEAKRAWQGK-----ECYKRNGWPLSEQSRAVCPPLQHLFLLREVLHRCRHQAAPGSIP 525 +EA+ W + E +K N WPL+ Q R + L + L R H APG P Sbjct: 117 EEAEEDWDQERLLSIELHKTNLWPLTHQFRDSTKTILRLLINEPQLTRLLHTQAPGRSP 175
>O49856:FTRC_SOYBN Ferredoxin-thioredoxin reductase catalytic chain, chloroplast| precursor - Glycine max (Soybean) Length = 144 Score = 32.0 bits (71), Expect = 3.3 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 425 RSRAEQYAHHSSTFFCYEKSFTAVGIK 505 R +EQYA S T+FC +K T+V IK Sbjct: 43 RKFSEQYARKSGTYFCVDKGVTSVVIK 69 Score = 30.8 bits (68), Expect = 7.4 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 260 AEQYAHRSGTFLCYDECVTAV 322 +EQYA +SGT+ C D+ VT+V Sbjct: 46 SEQYARKSGTYFCVDKGVTSV 66
>P41349:FTRC2_SPIOL Ferredoxin-thioredoxin reductase catalytic chain, chloroplast| precursor - Spinacia oleracea (Spinach) Length = 148 Score = 32.0 bits (71), Expect = 3.3 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 425 RSRAEQYAHHSSTFFCYEKSFTAVGIK 505 R +EQYA S T+FC +K T+V IK Sbjct: 47 RKFSEQYARKSGTYFCVDKGVTSVVIK 73 Score = 30.8 bits (68), Expect = 7.4 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 260 AEQYAHRSGTFLCYDECVTAV 322 +EQYA +SGT+ C D+ VT+V Sbjct: 50 SEQYARKSGTYFCVDKGVTSV 70
>P41348:FTRC1_SPIOL Ferredoxin-thioredoxin reductase catalytic chain, chloroplast| precursor - Spinacia oleracea (Spinach) Length = 144 Score = 31.6 bits (70), Expect = 4.3 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 425 RSRAEQYAHHSSTFFCYEKSFTAVGIK 505 R +EQ+ S T+FC +KS TAV IK Sbjct: 43 RKFSEQFCRKSDTYFCVDKSVTAVVIK 69
>2)glucan export ATP-binding/permease protein ndvA -| Agrobacterium tumefaciens Length = 588 Score = 31.2 bits (69), Expect = 5.6 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -3 Query: 486 KDFS*QKKVLEWWAYCSALLREGPSVSLVTFL 391 K S Q VL+WWA+ SAL R +VS++ L Sbjct: 227 KLLSAQYPVLDWWAFASALNRTASTVSMMIIL 258
>2)glucan export ATP-binding/permease protein ndvA -| Agrobacterium tumefaciens (strain C58 / ATCC 33970) Length = 588 Score = 31.2 bits (69), Expect = 5.6 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -3 Query: 486 KDFS*QKKVLEWWAYCSALLREGPSVSLVTFL 391 K S Q VL+WWA+ SAL R +VS++ L Sbjct: 227 KLLSAQYPVLDWWAFASALNRTASTVSMMIIL 258
>P14349:GAG_FOAMV Gag polyprotein - Human spumaretrovirus (SFVcpz(hu)) (Human foamy| virus) Length = 648 Score = 31.2 bits (69), Expect = 5.6 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +2 Query: 362 PRKQKGRGKGRNVTRETDGPSRS 430 PR +GRG+G+N +R + GP+ S Sbjct: 484 PRPSRGRGRGQNTSRPSQGPANS 506
>P55399:TRBE2_RHISN Probable conjugal transfer protein trbE part 2 - Rhizobium sp.| (strain NGR234) Length = 662 Score = 30.8 bits (68), Expect = 7.4 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +3 Query: 354 GDLPGSKKGVAREGMLQEKRMA---PLGAEQSSMPTTPAPFSATRSPSPLSASS 506 G LPG+ RE ++ +A PL + S P P PF SPS + +S Sbjct: 233 GSLPGNWYCNIREPLINTSNLADLIPLNSVWSGSPVAPCPFYPPNSPSLMQVAS 286
>P05962:POL_HV2NZ Gag-Pol polyprotein - Human immunodeficiency virus type 2 (isolate| NIH-Z subtype A) (HIV-2) Length = 1461 Score = 30.8 bits (68), Expect = 7.4 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +3 Query: 420 PLGAEQSSMPTTPAPFSATRSPSPLSASSCPWFDSSQERICAKG 551 PLG E +P P+P A + +P+ +SS P + R AKG Sbjct: 435 PLGKEGPQLPRGPSPAGANTNSTPIGSSSGPTGEIYAARKKAKG 478
>Q1XDA1:FTRC_PORYE Ferredoxin-thioredoxin reductase, catalytic chain - Porphyra| yezoensis Length = 116 Score = 30.8 bits (68), Expect = 7.4 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 260 AEQYAHRSGTFLCYDECVTAV 322 +E YA R+GTF C D VTAV Sbjct: 20 SETYAKRTGTFFCIDSSVTAV 40
>Q96J92:WNK4_HUMAN Serine/threonine-protein kinase WNK4 - Homo sapiens (Human)| Length = 1243 Score = 30.4 bits (67), Expect = 9.6 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 5/38 (13%) Frame = +3 Query: 417 APLGAEQSSMPT-----TPAPFSATRSPSPLSASSCPW 515 +P+ ++ SS P+ +P PFS++ P+ S CPW Sbjct: 844 SPISSQVSSNPSPHPTSSPLPFSSSTPEFPVPLSQCPW 881
>P34110:VPS35_YEAST Vacuolar protein sorting-associated protein 35 - Saccharomyces| cerevisiae (Baker's yeast) Length = 944 Score = 30.4 bits (67), Expect = 9.6 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = -3 Query: 453 WWAYCSALLREGPSVSLVTFLPLPRPFCFLGGHLKPNNLSHLD 325 +W Y + L E P +SL F+PL L PNN +L+ Sbjct: 316 FWDYLTVLNHERPDLSLQQFIPLVESVIVLSLKWYPNNFDNLN 358
>P51386:FTRC_PORPU Ferredoxin-thioredoxin reductase, catalytic chain - Porphyra| purpurea Length = 118 Score = 30.4 bits (67), Expect = 9.6 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 260 AEQYAHRSGTFLCYDECVTAV 322 +E YA R+GTF C D VTAV Sbjct: 20 SETYAKRTGTFFCADNSVTAV 40 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 157,761,704 Number of extensions: 3589860 Number of successful extensions: 11487 Number of sequences better than 10.0: 15 Number of HSP's gapped: 11473 Number of HSP's successfully gapped: 18 Length of query: 289 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 177 Effective length of database: 69,965,399 Effective search space: 12383875623 Effective search space used: 12383875623 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
