| Clone Name | FLbaf77d24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q4WMU5:PTPA1_ASPFU Serine/threonine-protein phosphatase 2A activ... | 32 | 6.6 | 2 | P0C0F6:RPFC_XANCP Sensory/regulatory protein rpfC - Xanthomonas ... | 32 | 6.6 | 3 | P0C0F7:RPFC_XANC8 Sensory/regulatory protein rpfC - Xanthomonas ... | 32 | 6.6 |
|---|
>Q4WMU5:PTPA1_ASPFU Serine/threonine-protein phosphatase 2A activator 1 - Aspergillus| fumigatus (Sartorya fumigata) Length = 473 Score = 32.3 bits (72), Expect = 6.6 Identities = 16/53 (30%), Positives = 22/53 (41%) Frame = +3 Query: 357 GAVPCLPPENCPNGWATPPGDTFMVRGPEYFATKAKIPGGEYLLKPLGVDWIK 515 G P PP + P+ PPG R P ++ + PGG+ P W K Sbjct: 421 GCTPGKPPTSLPDTSRLPPGPMAPTRAPWAASSTGQAPGGDPTHVPTKAPWAK 473
>P0C0F6:RPFC_XANCP Sensory/regulatory protein rpfC - Xanthomonas campestris pv.| campestris Length = 677 Score = 32.3 bits (72), Expect = 6.6 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = -1 Query: 1162 GSIELPGFCSSWEKLR---HSLEG---RIGATSCCSSDGTSYTPADPGLNSE 1025 G IE G CS WE+LR H+L G +G SS G AD L +E Sbjct: 589 GDIERDGTCSDWEQLRESAHALRGVASNLGLAQVASSGGELMRMADWQLQAE 640
>P0C0F7:RPFC_XANC8 Sensory/regulatory protein rpfC - Xanthomonas campestris pv.| campestris (strain 8004) Length = 677 Score = 32.3 bits (72), Expect = 6.6 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 6/52 (11%) Frame = -1 Query: 1162 GSIELPGFCSSWEKLR---HSLEG---RIGATSCCSSDGTSYTPADPGLNSE 1025 G IE G CS WE+LR H+L G +G SS G AD L +E Sbjct: 589 GDIERDGTCSDWEQLRESAHALRGVASNLGLAQVASSGGELMRMADWQLQAE 640 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 337,197,503 Number of extensions: 7847452 Number of successful extensions: 18846 Number of sequences better than 10.0: 3 Number of HSP's gapped: 18843 Number of HSP's successfully gapped: 3 Length of query: 598 Length of database: 100,686,439 Length adjustment: 119 Effective length of query: 479 Effective length of database: 68,045,334 Effective search space: 32593714986 Effective search space used: 32593714986 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)