ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf81p10 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os07g30800:12007.t02767:unspliced-genomic FK506 binding protein, putative, expressed| Length = 3805 Score = 94.1 bits (199), Expect(7) = 4e-99 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +1 / +1 Query: 226 SAHSKTKTINPYEERRLLQQNKKIQEANRAPDDFPNFIREGFQ 354 SAH KTK+ NPY+ERRLLQQNKKIQEANRAPDDFPNFIREG Q Sbjct: 595 SAHGKTKSRNPYDERRLLQQNKKIQEANRAPDDFPNFIREGEQ 723 Score = 92.3 bits (195), Expect(7) = 4e-99 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 / +1 Query: 454 QVIFHYVGYNESGRRIDSTYIQGSPAKIRLGNKSLVPG 567 QVIFHYVGYNESGRRIDSTYIQGSPAKIRLGNK+LVPG Sbjct: 1570 QVIFHYVGYNESGRRIDSTYIQGSPAKIRLGNKTLVPG 1683 Score = 92.3 bits (195), Expect(7) = 4e-99 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 / +3 Query: 643 VGPSTFFSAKQFEVFDVELLSVQDCQRRTIAFYSDVVCT*S 765 VGPSTFFSAKQFEVFD+ELL+VQDCQRRTIAFYSDVVC+*+ Sbjct: 3357 VGPSTFFSAKQFEVFDIELLAVQDCQRRTIAFYSDVVCS*A 3479 Score = 84.0 bits (177), Expect(7) = 4e-99 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +1 / +1 Query: 346 GFQVKVVTPDNYITRDSGLIYEDVKVGTGDCPKDGQQVI 462 GF+VKVVT DNYITRDSGL+YED+KVGTG+ PKDGQQV+ Sbjct: 1087 GFEVKVVTSDNYITRDSGLLYEDIKVGTGNSPKDGQQVL 1203 Score = 68.9 bits (144), Expect(7) = 4e-99 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 / +1 Query: 565 GFEEGIRDMKPGGKRRLIIPPELGPPV 645 GFEEGIRDMKPGGKRR+IIPPELGPPV Sbjct: 1858 GFEEGIRDMKPGGKRRIIIPPELGPPV 1938 Score = 33.1 bits (66), Expect(7) = 4e-99 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +3 / +3 Query: 924 CHESHDVGAHWYL 962 CHESHDVG H YL Sbjct: 3723 CHESHDVGGHVYL 3761 Score = 28.6 bits (56), Expect(7) = 4e-99 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +2 / +2 Query: 11 RRWSWCPPPAPSY 49 RRWSW P APS+ Sbjct: 119 RRWSWSPRRAPSF 157 Score = 86.3 bits (182), Expect(7) = 8e-66 Identities = 41/57 (71%), Positives = 46/57 (80%) Frame = -2 / -3 Query: 347 PSLMKFGKSSGARLAS*IFLFC*SKRLSS*GFMVLVLEWAEKASKSVGVAKNRARAA 177 PSLMKFGKSSGARLAS IFLFC*S RLSS*GF++LV AE A+ G A ++ARAA Sbjct: 716 PSLMKFGKSSGARLASWIFLFC*SSRLSS*GFLLLVFP*AENATDIAGEASSKARAA 546 Score = 72.1 bits (151), Expect(7) = 8e-66 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -2 / -3 Query: 458 TC*PSFGQSPVPTLTSSYINPESRVM*LSGVTTLT*KPSL 339 TC*PSFG+ PVPTL SSY +PESRVM*LS VTTLT KP L Sbjct: 1199 TC*PSFGELPVPTLMSSYSSPESRVM*LSDVTTLTSKPEL 1080 Score = 71.6 bits (150), Expect(7) = 8e-66 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 / -3 Query: 566 PGTNDLLPSRILAGEPWM*VLSILRPDSL*PT**NITC 453 PGT+ L P+RILAGEP M*VLSILRPDSL*PT**NITC Sbjct: 1682 PGTSVLFPNRILAGEP*M*VLSILRPDSL*PT**NITC 1569 Score = 49.6 bits (102), Expect(7) = 8e-66 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -1 / -2 Query: 642 RRTKLRRYN*SSLPPWFHVPNPLFKT 565 RRTKL RYN SSL WFHVP P FKT Sbjct: 1935 RRTKLWRYNNSSLTTWFHVPYPFFKT 1858 Score = 48.7 bits (100), Expect(7) = 8e-66 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -1 / -3 Query: 762 SSANNIRVKSYCPPLAVLH*E*LDVEYFKLFRAEERRWPN 643 S+A+ I VK YC PLAVL+ E DVEY +L R EE PN Sbjct: 3476 SAAHYIGVKGYCSPLAVLNSEEFDVEYLELLRTEEC*RPN 3357 Score = 26.7 bits (52), Expect(7) = 8e-66 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 / -1 Query: 46 GRSGRRTPAPSPSPP 2 GRS R PAPSP P Sbjct: 154 GRSATRRPAPSPPSP 110 Score = 24.4 bits (47), Expect(7) = 8e-66 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -3 / -1 Query: 961 RYQCAPTSWDSWQR 920 RY C PTS DS QR Sbjct: 3760 RYTCPPTS*DS*QR 3719 Score = 66.6 bits (139), Expect(6) = 6e-44 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +2 / +2 Query: 452 SRLYFTMWATTNQDEG*IAPTSRVRLPKFG*ATNH*FQ 565 +RLYFTMWAT +Q G*IAPT RV LPKFG* T H FQ Sbjct: 1568 NRLYFTMWATMSQGAG*IAPTFRVHLPKFG*GTKHWFQ 1681 Score = 54.7 bits (113), Expect(6) = 6e-44 Identities = 24/42 (57%), Positives = 27/42 (64%) Frame = +3 / +3 Query: 333 LHQRRFSGQSSDTRQLHNTGFRINI*GCQSWYRRLPEGWSAG 458 L Q RF QSSD QLHN +*G QSWY +L +GWSAG Sbjct: 1074 LMQFRFRSQSSDI*QLHNARLWATV*GHQSWYGQLSKGWSAG 1199 Score = 47.3 bits (97), Expect(6) = 6e-44 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 / +3 Query: 564 RF*RGDSGHETRGEEKTNYTS*AWSSC 644 RF*R D+GHETR EK YTS AWSSC Sbjct: 1857 RF*RRDTGHETRW*EKNYYTSRAWSSC 1937 Score = 46.4 bits (95), Expect(6) = 6e-44 Identities = 20/41 (48%), Positives = 26/41 (63%) Frame = +3 / +2 Query: 639 SCWAIDVLQRETV*SIRRRATLSAGLPAEDNSFLL*CCLHL 761 S WA+++LQ E V IR R +GLP E+NS LL C + L Sbjct: 3353 SGWAVNILQCEAVRGIRHRTPRCSGLPTENNSLLLRCSVQL 3475 Score = 44.1 bits (90), Expect(6) = 6e-44 Identities = 21/42 (50%), Positives = 27/42 (64%) Frame = +3 / +3 Query: 222 LLGPLQDQNHKSL*GKTLASAEQEDSGSQPCT**FPKLHQRR 347 +LG +DQ + L + ASAEQED GSQP +* F + HQ R Sbjct: 591 VLGSREDQKQEPLRREAAASAEQEDPGSQPGS*RFSEFHQGR 716 Score = 26.3 bits (51), Expect(6) = 6e-44 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +3 / +3 Query: 3 GGEGDGAGVLLPLRP 47 G GDGAG+L+ LRP Sbjct: 111 GEGGDGAGLLVALRP 155 Score = 69.3 bits (145), Expect(6) = 6e-43 Identities = 26/37 (70%), Positives = 27/37 (72%) Frame = -3 / -1 Query: 565 LELMICCLAEFWQANPGCRCYLSFVLIRCSPHSEI*P 455 LE + C L EFWQ NP CRCYLS L CSPHSEI*P Sbjct: 1681 LEPVFCSLTEFWQVNPECRCYLSCALTHCSPHSEI*P 1571 Score = 56.1 bits (116), Expect(6) = 6e-43 Identities = 24/38 (63%), Positives = 28/38 (73%) Frame = -1 / -2 Query: 459 NLLTILRAIACTNFDILIY*SGIPCYVVVGCHYFDLKT 346 NLLTIL +A TNFD+LI * + YVVV CHYFD +T Sbjct: 1200 NLLTILWRVARTNFDVLIQ*PRVSRYVVVRCHYFDFET 1087 Score = 46.4 bits (95), Expect(6) = 6e-43 Identities = 19/34 (55%), Positives = 26/34 (76%) Frame = -1 / -2 Query: 354 LKTFSDEVWEIIRCTVGFLNLLVLLKQASFLIRI 253 L TF DE+ +I+R VGFL+LLVLLKQ ++R+ Sbjct: 723 LLTFPDEIRKIVRSPVGFLDLLVLLKQPPLVVRV 622 Score = 43.7 bits (89), Expect(6) = 6e-43 Identities = 21/43 (48%), Positives = 26/43 (60%) Frame = -3 / -2 Query: 766 MIKCKQHQSKKLLSSAGSPALRVARRRILQTVSR*RTSMAQQE 638 ++ C H+SK+LL S GSP R R RI +T S *R AQ E Sbjct: 3480 LLSCTLHRSKRLLFSVGSPEQRGVRCRIPRTASH*RMLTAQPE 3352 Score = 40.5 bits (82), Expect(6) = 6e-43 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = -3 / -1 Query: 643 QEDQAQEV*LVFSSPLVSCPESPLQNLE 560 QEDQA EV* FS LVSCP S LQNL+ Sbjct: 1936 QEDQALEV**FFSYHLVSCPVSLLQNLQ 1853 Score = 25.8 bits (50), Expect(6) = 6e-43 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -2 / -3 Query: 47 RTEREEDTSSIS 12 RTER+E+TSSIS Sbjct: 155 RTERDEETSSIS 120 Score = 68.0 bits (142), Expect(5) = 8e-35 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 / -2 Query: 567 TWN**FVA*PNFGRRTLDVGAIYPSS*FVVAHIVKYNLL 451 +WN FV *PNFGR TL+VGAIYP+ * +VAHIVKYNLL Sbjct: 1683 SWNQCFVP*PNFGR*TLNVGAIYPAP*LIVAHIVKYNLL 1567 Score = 47.8 bits (98), Expect(5) = 8e-35 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = -3 / -1 Query: 457 PADHPSGNRLYQL*HPHILIRNPVLCSCRVSLL*PENL 344 PADHP + YQL* PH + ++ LCSC++SLL* NL Sbjct: 1198 PADHPLESCPYQL*CPHTVAQSLALCSCQMSLL*LRNL 1085 Score = 45.1 bits (92), Expect(5) = 8e-35 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = -3 / -1 Query: 349 NLL**SLGNHQVHGWLPESSCSAEASVFPHKDLWFWSWSGPR 224 +L **+ N Q GWLP SSCSAEA+ K FWS PR Sbjct: 718 HLP**NSENRQEPGWLPGSSCSAEAAASRRKGSCFWSSREPR 593 Score = 40.0 bits (81), Expect(5) = 8e-35 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 / -3 Query: 611 LLFPPGFMSRIPSSKPGTNDL 549 LL PPGFMSRIPSSKP + L Sbjct: 1904 LLLPPGFMSRIPSSKPAVSCL 1842 Score = 34.1 bits (68), Expect(5) = 8e-35 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = -2 / -1 Query: 761 QVQTTSE*KAIVLRWQ 714 Q+ TTSE*KAIVLRWQ Sbjct: 3475 QLHTTSE*KAIVLRWQ 3428 Score = 66.1 bits (138), Expect(5) = 1e-28 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +3 / +3 Query: 456 GYISLCGLQRIRTKDR*HLHPGFACQNSARQQIISSR 566 GYISLCGLQ +R +DR*HLH GF CQNS R+Q SR Sbjct: 1572 GYISLCGLQ*VRAQDR*HLHSGFTCQNSVREQNTGSR 1682 Score = 41.4 bits (84), Expect(5) = 1e-28 Identities = 23/44 (52%), Positives = 30/44 (68%) Frame = +2 / +2 Query: 332 TSSEKVFRSK**HPTTT*HGIPD*YMRMSKLVQAIARRMVSRLY 463 T++ +V +SK**H TTT* MR SKLV+A +RMVSR + Sbjct: 1073 TNAIQVSKSK**HLTTT*RETLGYCMRTSKLVRATLQRMVSRFF 1204 Score = 39.1 bits (79), Expect(5) = 1e-28 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +2 / +1 Query: 647 GHRRSSARNSLKYSTSSYSQCRTASGGQ*LFTLM 748 G + SS R+S +YSTS+ S RTA+G Q* FT M Sbjct: 3361 GRQHSSVRSSSRYSTSNSSLFRTANGEQ*PFTPM 3462 Score = 37.7 bits (76), Expect(5) = 1e-28 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = +2 / +2 Query: 257 LMRKDACFSRTRRFRKPTVHLMISQTSSEKV 349 L + CFSRTRR RKPT L I + SS KV Sbjct: 626 LTTRGGCFSRTRRSRKPTGLLTIFRISSGKV 718 Score = 29.5 bits (58), Expect(5) = 1e-28 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +2 / +2 Query: 563 QVLKRGFGT*NQGGRED 613 QVLK+G+GT*NQ RE+ Sbjct: 1856 QVLKKGYGT*NQVVREE 1906
>LOC_Os08g42850:12008.t04014:unspliced-genomic FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplast| precursor, putative, expressed Length = 2493 Score = 35.9 bits (72), Expect(2) = 2e-04 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +1 / +2 Query: 382 ITRDSGLIYEDVKVGTGDCPKDGQQVI 462 +T +SGL Y+D+KVG G P G QV+ Sbjct: 734 VTTESGLQYKDIKVGEGPSPPIGFQVL 814 Score = 33.6 bits (67), Expect(2) = 2e-04 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 / +3 Query: 544 GNKSLVPGFEEGIRDMKPGGKRRLIIP 624 G ++ G +EGI MK GG RRL IP Sbjct: 1851 GKH*VIKGLDEGILSMKVGGLRRLYIP 1931
>LOC_Os04g28420:12004.t02539:unspliced-genomic peptidyl-prolyl isomerase, putative, expressed| Length = 4126 Score = 31.8 bits (63), Expect(2) = 0.010 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 / +3 Query: 556 LVPGFEEGIRDMKPGGKRRLIIPPEL 633 ++ G++EGI+ MK G + +PPEL Sbjct: 621 VIKGWDEGIKTMKKGEQAVFTVPPEL 698 Score = 27.2 bits (53), Expect(2) = 0.010 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 / +3 Query: 466 HYVGYNESGRRIDSTYIQGSPAKIRLG 546 HY G G + DS+ +G+P K LG Sbjct: 429 HYTGTLLDGTKFDSSRDRGTPFKFSLG 509
>LOC_Os07g04160:12007.t00304:unspliced-genomic FK506 binding protein, putative, expressed| Length = 3133 Score = 33.6 bits (67), Expect(3) = 0.013 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 / +2 Query: 556 LVPGFEEGIRDMKPGGKRR 612 ++P FEE I DM PGG RR Sbjct: 2012 VIPAFEEAISDMAPGGVRR 2068 Score = 26.3 bits (51), Expect(3) = 0.013 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +1 Query: 5 RRRRWSWCPPPAPS 46 RR RW+WC PS Sbjct: 106 RRLRWTWCARSPPS 147 Score = 23.1 bits (44), Expect(3) = 0.013 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 / +1 Query: 610 RLIIPPELGPP 642 R+I+PP+LG P Sbjct: 2176 RIIVPPDLGYP 2208
>LOC_Os02g07220:12002.t00619:unspliced-genomic FK506 binding protein, putative, expressed| Length = 2297 Score = 38.6 bits (78), Expect(2) = 0.023 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 / +3 Query: 556 LVPGFEEGIRDMKPGGKRRLIIPPELG 636 ++PG E ++ M+ GG RR+IIPP G Sbjct: 1419 VIPGIEAAVKSMRVGGLRRVIIPPSQG 1499 Score = 23.5 bits (45), Expect(2) = 0.023 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 17 WSWCPPPAPSYPLATDWLLPP 79 WS CPPP+ P + L P Sbjct: 39 WSVCPPPSLRPPASCRRLKKP 101
>LOC_Os01g64790:12001.t05845:unspliced-genomic AP2 domain containing protein, expressed| Length = 2991 Score = 28.1 bits (55), Expect(3) = 0.036 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -3 / -2 Query: 61 GCKRIGRSGRRTPAPSPSP 5 GC+ G RR PAP P P Sbjct: 1895 GCRGTGARPRRRPAPRPPP 1839 Score = 22.6 bits (43), Expect(3) = 0.036 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -3 / -2 Query: 244 WSWSGPRRRVR 212 WSWS RRR R Sbjct: 2144 WSWSHRRRRRR 2112 Score = 22.1 bits (42), Expect(3) = 0.036 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 / -2 Query: 224 KASKSVGVAKNRARAARFPILNSPFVSPPKTHTRLFPWRLAAADA 90 +AS S G ++ R R+P P P R + WR + A Sbjct: 2057 EASGSAGTRRSGRRRGRWPRKAMPPRPAPGAAPRWWWWRRSGRGA 1923
>LOC_Os06g49150:12006.t04599:unspliced-genomic exostosin-3, putative, expressed| Length = 2393 Score = 39.1 bits (79), Expect = 0.050 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +2 / -1 Query: 2 GRRRRWSWCPPPAPSYPLATDWLLPPHPGRHQQLLGATG 118 GRR R + CPPP P A W P P H G+ G Sbjct: 362 GRRSRTTSCPPPPPPPAAAAAWASSPAPANHSSNGGSGG 246
>LOC_Os01g57520:12001.t05156:unspliced-genomic hypothetical protein| Length = 840 Score = 39.1 bits (79), Expect = 0.050 Identities = 20/39 (51%), Positives = 21/39 (53%) Frame = +2 / -3 Query: 2 GRRRRWSWCPPPAPSYPLATDWLLPPHPGRHQQLLGATG 118 GRRRR PPP PS AT LL P P H Q G +G Sbjct: 508 GRRRRRCPPPPPPPSSSRATAVLLAPPPRHHLQEEGESG 392
>LOC_Os03g50080:12003.t04352:unspliced-genomic FK506 binding protein, putative, expressed| Length = 1358 Score = 38.2 bits (77), Expect = 0.094 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +1 / +2 Query: 550 KSLVPGFEEGIRDMKPGGKRRLIIPPELG 636 + + G E +R M+ GGKRR+++PP LG Sbjct: 887 RGMCEGVEYVLRSMRAGGKRRVVVPPALG 973
>LOC_Os12g09140:12012.t00794:unspliced-genomic hypothetical protein| Length = 1120 Score = 37.3 bits (75), Expect = 0.18 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +2 / -1 Query: 5 RRRRWSWCPPPAPSYPLATDWLLPPHPGRHQQL 103 RRR+WS PPP P+ PLA P GRH +L Sbjct: 247 RRRQWSPPPPPLPATPLAALPPPPALAGRHLRL 149
>LOC_Os05g03120:12005.t00209:unspliced-genomic myosin heavy chain-like protein, putative, expressed| Length = 5055 Score = 37.3 bits (75), Expect = 0.18 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +2 / -2 Query: 8 RRRWSWCPPPAPSYPLA 58 RR WSWC PPAP P A Sbjct: 4583 RRSWSWCTPPAPETPSA 4533
>LOC_Os11g25620:12011.t02178:unspliced-genomic translation initiation factor IF-2, putative| Length = 901 Score = 31.8 bits (63), Expect(2) = 0.26 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 / -2 Query: 17 WSWCPPPAPSYPLATDWLLPPHPGR 91 W PPP P W+ PP PGR Sbjct: 651 WLAPPPPGRPLPPPPPWMTPPPPGR 577 Score = 25.4 bits (49), Expect(2) = 0.26 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +1 / -2 Query: 886 CCMCIAKCLHYTVAMNPMMWGHTG 957 C MC KC + + + + GH G Sbjct: 171 CFMCYMKC*MWVICVEIFLIGHVG 100
>LOC_Os06g08070:12006.t00689:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 7004 Score = 26.7 bits (52), Expect(2) = 0.36 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 / -3 Query: 8 RRRWSWCPPPAP 43 +R+ WCPPP P Sbjct: 6882 QRQGGWCPPPPP 6847 Score = 26.7 bits (52), Expect(2) = 0.36 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / -3 Query: 29 PPPAPSYPLATDWLLPPHP 85 PPPA + + WL PP P Sbjct: 6807 PPPARNPSASRHWLAPPSP 6751
>LOC_Os01g50800:12001.t04514:unspliced-genomic hypothetical protein| Length = 3763 Score = 28.6 bits (56), Expect(2) = 0.37 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / -1 Query: 8 RRRWSWCPPPAP 43 RR+ WCPPP P Sbjct: 3640 RRQGGWCPPPPP 3605 Score = 24.9 bits (48), Expect(2) = 0.37 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 / -3 Query: 29 PPPAPSYPLATDWLLPPHPGR 91 P P P T W PP P R Sbjct: 3524 PQPETLLPRGTGWRRPPQPRR 3462
>LOC_Os04g40330:12004.t03597:unspliced-genomic F-box domain containing protein, expressed| Length = 3457 Score = 35.9 bits (72), Expect = 0.46 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 / +2 Query: 58 CKRIGRSGRRTPAPSPSP 5 C+R+ S RR+PAPSPSP Sbjct: 197 CRRVDSSARRSPAPSPSP 250
>LOC_Os03g27110:12003.t02391:unspliced-genomic catalytic/ hydrolase, putative, expressed| Length = 1943 Score = 35.9 bits (72), Expect = 0.46 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 / -3 Query: 369 CHYFDLKTFSDEVWEIIRCTVGFLNLLVLLKQAS 268 C + DL FS+ VW++++C V + + +KQ S Sbjct: 1254 CMFLDLSKFSNSVWKLVQCFVQKIRVNASIKQTS 1153
>LOC_Os09g28920:12009.t02570:unspliced-genomic hypothetical protein| Length = 1015 Score = 25.4 bits (49), Expect(3) = 0.56 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 / +1 Query: 292 SCSAEASVFPHKDLWFWSWSGPRRRVRA 209 S +AEA+ P + W SG RRR RA Sbjct: 43 STAAEAASRPERWRWRVGLSGVRRRQRA 126 Score = 25.4 bits (49), Expect(3) = 0.56 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -2 / +1 Query: 68 TSRLQEDRTEREED 27 T RLQ ++TEREE+ Sbjct: 940 TDRLQAEKTEREEE 981 Score = 23.1 bits (44), Expect(3) = 0.56 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 / +2 Query: 152 FVSPPKTHTRLFPWRLAAA 96 ++ PP + RL PW AAA Sbjct: 836 YLWPPSSSARLPPWFPAAA 892
>LOC_Os11g42540:12011.t03785:unspliced-genomic aldo-keto reductase, putative, expressed| Length = 2878 Score = 35.4 bits (71), Expect = 0.63 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 / +2 Query: 556 LVPGFEEGIRDMKPGGKRRLIIPPELGPPVGPS 654 ++ G EG+ ++ GG+RR PP PP PS Sbjct: 182 ILHGGGEGLATVRRGGRRRCRCPPSTSPPTSPS 280
>LOC_Os02g51570:12002.t04740:unspliced-genomic FKBP-type peptidyl-prolyl cis-trans isomerase 4, chloroplast| precursor, putative, expressed Length = 1928 Score = 28.6 bits (56), Expect(2) = 0.71 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 / +3 Query: 394 SGLIYEDVKVGTGDCPKDGQQV 459 SGL Y DV+VGTG P GQ + Sbjct: 393 SGLGYCDVEVGTGAQPPRGQLI 458 Score = 28.1 bits (55), Expect(2) = 0.71 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 / +3 Query: 466 HYVGYNESGRRIDSTYIQGSPAKIRLG 546 HY G DSTY +G P +RLG Sbjct: 699 HYTARFTDGIVFDSTYKRGRPLTMRLG 779
>LOC_Os01g57500:12001.t05154:unspliced-genomic hypothetical protein| Length = 2124 Score = 31.8 bits (63), Expect(2) = 0.77 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 / +1 Query: 8 RRRWSWCPPPAPSYPLATDWLLPPHP 85 RR S PPP+P++P AT PP P Sbjct: 1366 RRSPSSSPPPSPAWPTATSPRSPPTP 1443 Score = 24.9 bits (48), Expect(2) = 0.77 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 / +2 Query: 604 KRRLIIPPELGPPVGPST 657 +RRL++P + PP ST Sbjct: 1913 RRRLVVPRQCRPPAAAST 1966
>LOC_Os04g28980:12004.t02592:unspliced-genomic conserved hypothetical protein| Length = 1200 Score = 35.0 bits (70), Expect = 0.87 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 / -2 Query: 5 RRRRWSWCPPPAPSYPLATDWLLPP 79 RR R W PPP P P A LLPP Sbjct: 143 RRLRRPWSPPPQPLLPNAPSCLLPP 69
>LOC_Os02g38660:12002.t03504:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5790 Score = 35.0 bits (70), Expect = 0.87 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 / +1 Query: 79 WREQPVGCKRIGRSGRRTPAPSPSP 5 W P+ +R+GR GRR P+PS P Sbjct: 1372 WPRPPLMRRRVGRGGRRLPSPSTRP 1446
>LOC_Os02g38520:12002.t03490:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5407 Score = 35.0 bits (70), Expect = 0.87 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -3 / +1 Query: 79 WREQPVGCKRIGRSGRRTPAPSPSP 5 W P+ +R+GR GRR P+PS P Sbjct: 1723 WPRPPLMRRRVGRGGRRLPSPSTRP 1797
>LOC_Os01g18470:12001.t01640:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 6922 Score = 28.6 bits (56), Expect(2) = 0.87 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / -1 Query: 8 RRRWSWCPPPAP 43 RR+ WCPPP P Sbjct: 6871 RRQGGWCPPPPP 6836 Score = 23.5 bits (45), Expect(2) = 0.87 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 / -2 Query: 32 PPAPSYPLATDWLLPPHP 85 PPA + + WL PP P Sbjct: 6756 PPARNPSASRHWLAPPSP 6703
>LOC_Os07g43130:12007.t03960:unspliced-genomic conserved hypothetical protein| Length = 702 Score = 28.1 bits (55), Expect(2) = 0.92 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 / +3 Query: 5 RRRRWSWCP 31 RRRRW WCP Sbjct: 180 RRRRWWWCP 206 Score = 26.7 bits (52), Expect(2) = 0.92 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 / +2 Query: 17 WSWCPPPAPSYPLATDW 67 WSW PP PS+ A W Sbjct: 344 WSWGPPWRPSWWAAPRW 394
>LOC_Os06g45340:12006.t04221:unspliced-genomic FKBP-type peptidyl-prolyl cis-trans isomerase 4, chloroplast| precursor, putative, expressed Length = 1385 Score = 31.3 bits (62), Expect(2) = 0.96 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 / +3 Query: 466 HYVGYNESGRRIDSTYIQGSPAKIRLG 546 HY G E G DS+Y +G P R+G Sbjct: 540 HYTGRLEDGTVFDSSYKRGKPLTFRVG 620 Score = 24.4 bits (47), Expect(2) = 0.96 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 / +3 Query: 598 GGKRRLIIPPEL 633 GGKR L +PPEL Sbjct: 984 GGKRSLRLPPEL 1019
>LOC_Os03g18060:12003.t01580:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 8941 Score = 28.6 bits (56), Expect(2) = 1.2 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / -1 Query: 8 RRRWSWCPPPAP 43 RR+ WCPPP P Sbjct: 6931 RRQGGWCPPPPP 6896 Score = 23.1 bits (44), Expect(2) = 1.2 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 / -3 Query: 29 PPPAPSYPLATDWLLPPHPGR 91 P P P T W PP P R Sbjct: 6815 PQPETLLPRGTGWRRPP*PRR 6753
>LOC_Os03g45970:12003.t03967:unspliced-genomic expressed protein| Length = 11776 Score = 29.0 bits (57), Expect(3) = 1.2 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = -3 / -1 Query: 604 SPLVSCPESPLQNLELMICCLAEFWQANPGCRC 506 S + S E P +N C A WQ GC C Sbjct: 11731 SAIPSPDEIPTENSHKDRCKTARMWQGTNGCNC 11633 Score = 26.3 bits (51), Expect(3) = 1.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 / -2 Query: 76 REQPVGCKRIGRSGRRTPAPSPSPP 2 R + G + S RR PAPSP PP Sbjct: 7146 RSRREGKRSRSPSWRR*PAPSPRPP 7072 Score = 24.0 bits (46), Expect(3) = 1.2 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -2 / -3 Query: 350 KPSLMKFGKSSGARL 306 KPS + FG+ SG+R+ Sbjct: 7709 KPSCLGFGRPSGSRI 7665
>LOC_Os04g51990:12004.t04675:unspliced-genomic transferase, putative, expressed| Length = 2078 Score = 30.4 bits (60), Expect(2) = 1.4 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 / -2 Query: 43 RSGRRTPAPSPSPP 2 R+GR PAPSP+PP Sbjct: 232 RAGRTAPAPSPAPP 191 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -3 / -1 Query: 805 RRRMLHRSALTDQMIKCKQHQSKKLLSSAGSPALRVARRRI 683 RRR L D +H +++ +++AG+ +R RRR+ Sbjct: 1901 RRRARPEVGLADGEPHPGRHDARRRVAAAGAAQVRPRRRRL 1779
>LOC_Os12g41500:12012.t03826:unspliced-genomic thiosulfate sulfurtransferase, putative, expressed| Length = 5669 Score = 26.3 bits (51), Expect(2) = 1.6 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 / +3 Query: 74 PPHPGRHQQLLGATGR 121 PPHP RH L GR Sbjct: 231 PPHPPRHHHRLAPRGR 278 Score = 24.9 bits (48), Expect(2) = 1.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 / +2 Query: 14 RWSWCPPPAPSYP 52 R ++CPPP+P P Sbjct: 179 RTTYCPPPSPRKP 217
>LOC_Os08g29150:12008.t02670:unspliced-genomic phospholipid-transporting ATPase 8, putative, expressed| Length = 6728 Score = 34.1 bits (68), Expect = 1.6 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -3 / -3 Query: 907 IWLYTYNNSLSFPRARFLMLACTTIANIFSLQGCRRRMLHRSALTDQMIKCKQHQSK 737 IW+ T N SL L+ A + + +FSLQ C +H +T ++ ++ Q+K Sbjct: 1209 IWILTLNESLEGVERMILIQARSHVQ*LFSLQVCLSIKIHCLNITYSILIARRKQNK 1039
>LOC_Os05g35470:12005.t03140:unspliced-genomic hydrolase, putative, expressed| Length = 1448 Score = 34.1 bits (68), Expect = 1.6 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -3 / -2 Query: 115 RGA*QLLMPSWMWREQPVGCKRIGRSGRRTPAPSPS 8 R A PSW R +P C+R R RR PA P+ Sbjct: 973 RAAAPATRPSWTRRSRPPRCRRRRRRRRRAPASPPA 866
>LOC_Os03g35340:12003.t03024:unspliced-genomic expressed protein| Length = 19193 Score = 34.1 bits (68), Expect = 1.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 / +2 Query: 979 FFFCGERYQCAPTSWDSWQRYNASIWLY 896 F+F G RY+ SW+ Q Y+ ++W Y Sbjct: 4034 FYFAGYRYKSFSASWNLSQPYSCNLWEY 4117
>LOC_Os03g05830:12003.t00454:unspliced-genomic splicing factor, putative, expressed| Length = 8716 Score = 34.1 bits (68), Expect = 1.6 Identities = 16/31 (51%), Positives = 18/31 (58%) Frame = -2 / -3 Query: 188 ARAARFPILNSPFVSPPKTHTRLFPWRLAAA 96 AR R+ SP S P + TR PWRLAAA Sbjct: 191 ARRRRWTAPRSPPPSSPSSRTRRNPWRLAAA 99
>LOC_Os02g19100:12002.t01703:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3511 Score = 34.1 bits (68), Expect = 1.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -3 / -2 Query: 88 SWMWREQPVGCKRIGRSGRRTPAPSPSPP 2 SW+ P+GC S R PA PSPP Sbjct: 2931 SWLTNSAPLGCPPATSSFSRPPARKPSPP 2845
>LOC_Os01g71220:12001.t06418:unspliced-genomic RING zinc finger protein, putative, expressed| Length = 4866 Score = 34.1 bits (68), Expect = 1.6 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +2 / +2 Query: 5 RRRRWSWCPPPAPSYPLATDWLLPPHPGRHQQLLGATG 118 +RRR S PPP P P +T+ + PP P Q G G Sbjct: 86 QRRRSSGGPPPPPPSPSSTNRIAPPPPSNGVQGGGGGG 199
>LOC_Os01g59940:12001.t05381:unspliced-genomic conserved hypothetical protein| Length = 642 Score = 34.1 bits (68), Expect = 1.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 / +3 Query: 5 RRRRWSWCPPPAPSYP 52 RRRRW+W P P+PS P Sbjct: 309 RRRRWAWEPTPSPSGP 356
>LOC_Os03g20230:12003.t01782:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative| Length = 1155 Score = 28.6 bits (56), Expect(3) = 1.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 / +2 Query: 839 CTCQHKKTCARKREGV 886 CTC + TC+R+R GV Sbjct: 971 CTCPGRTTCSRQRTGV 1018 Score = 22.1 bits (42), Expect(3) = 1.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 35 PAPSYPLATDWLLPPHPGRHQQLLGATG 118 P+ P +++LLP G H+++ A G Sbjct: 648 PSNQEPCPSNFLLPLAEGHHRRVDEAAG 731 Score = 21.7 bits (41), Expect(3) = 1.7 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = +2 / +2 Query: 5 RRRRWSWCPPPAPSYP 52 R +W+ P +P YP Sbjct: 524 RSSKWATSPTASPQYP 571
>LOC_Os03g06440:12003.t00512:unspliced-genomic RNA helicase SDE3, putative, expressed| Length = 4709 Score = 27.2 bits (53), Expect(2) = 2.2 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 / +3 Query: 88 SWMWREQPVGCKRIGRSGRRTPAP 17 SW W + VGC R+ R+ + P Sbjct: 315 SWFWFDCAVGCSRV*RASEQEIPP 386 Score = 23.5 bits (45), Expect(2) = 2.2 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 / +2 Query: 241 SWSGPRRRVRAWV*QRTEQELPASRS 164 S S PRR + W Q +LP S S Sbjct: 179 SASNPRRSIGGWASQDELGDLPPSSS 256
>LOC_Os03g20460:12003.t01804:unspliced-genomic guanylate kinase, putative, expressed| Length = 3604 Score = 26.3 bits (51), Expect(2) = 2.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 / +2 Query: 29 PPPAPSYPLATDWLLPPHPGRH 94 PPPA + PLA PP P R+ Sbjct: 236 PPPAGTTPLARPRRPPPAPTRY 301 Score = 24.4 bits (47), Expect(2) = 2.2 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 / +2 Query: 8 RRRWSWCPPPAPS 46 RRR + CPPP P+ Sbjct: 209 RRRAASCPPPPPA 247
>LOC_Os08g16780:12008.t01550:unspliced-genomic sin-like protein conserved region containing protein, expressed| Length = 11216 Score = 33.6 bits (67), Expect = 2.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 / -3 Query: 79 WREQPVGCKRIGRSGRRTPAPSPSPP 2 WR +P C+R GR R +P P PP Sbjct: 156 WRGRPCRCRRRGRGACRRRSPWPPPP 79
>LOC_Os07g47010:12007.t04337:unspliced-genomic SWIM zinc finger family protein| Length = 3995 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 / -3 Query: 11 RRWSWCPPPAPSYPLATDWLLPPHPGR 91 R W PPP P AT W PP P R Sbjct: 3618 RGWRRPPPPETLLPRATGWRRPPQPQR 3538
>LOC_Os05g45350:12005.t04023:unspliced-genomic electron transporter/ heat shock protein binding protein, putative,| expressed Length = 3312 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 / +1 Query: 29 PPPAPSYPLATDWLLPPHPGRHQQLLGATGRV 124 PPP PS + W PP P L A GR+ Sbjct: 13 PPPPPSIRFRSSWRRPPLPNGSATLATAAGRI 108
>LOC_Os04g49770:12004.t04491:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 1622 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 / -3 Query: 14 RWSWCPPPAPSYPLATDWLLPPHPGRHQQL 103 +W+ P P P Y L+ +LPP P H+QL Sbjct: 120 QWALLPLP*PLYSLSHPLVLPPSPRLHRQL 31
>LOC_Os04g20180:12004.t01756:unspliced-genomic expressed protein| Length = 7520 Score = 33.6 bits (67), Expect = 2.2 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 / -1 Query: 11 RRWSWCPPPAPSYPLATDWLLPPHPGRH 94 RR PP P+ P W PPHP RH Sbjct: 698 RRGHPLPPSIPNPPAIPSWQPPPHP*RH 615
>LOC_Os03g48480:12003.t04206:unspliced-genomic acyl-CoA thioesterase/ catalytic/ hydrolase, acting on ester bonds,| putative, expressed Length = 2961 Score = 33.6 bits (67), Expect = 2.2 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 / +3 Query: 88 SWMWREQPVGCKRIGRSGRRTPAPSPSPP 2 SW R P G + G RR+PA S SPP Sbjct: 279 SWTRRSTPWGSRSSGSPPRRSPAASSSPP 365
>LOC_Os03g37790:12003.t03232:unspliced-genomic protein dimerization, putative| Length = 3810 Score = 33.6 bits (67), Expect = 2.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +2 / -2 Query: 8 RRRWSWCPPPAPSYPLATDWLLPPHPGRHQQLL 106 RRR+ + PPP +Y T + LPP+ R Q L Sbjct: 1043 RRRFLFYPPPLAAYKRKTKFPLPPYTNRAAQAL 945
>LOC_Os01g63690:12001.t05737:unspliced-genomic nematode-resistance protein, putative, expressed| Length = 1998 Score = 33.6 bits (67), Expect = 2.2 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +2 / -2 Query: 2 GRRRRWSWCPPPAPSYPLATDWLLPPHPGR 91 G RRR S PPP P P A PP P R Sbjct: 1340 GTRRRTSSPPPPRPGTPAAAPPCRPPRPRR 1251
>LOC_Os10g07340:12010.t00593:unspliced-genomic expressed protein| Length = 3050 Score = 28.1 bits (55), Expect(2) = 2.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 / -3 Query: 68 LLPPHPGRHQQLLGATGRV 124 LLPP PGRH+++ GR+ Sbjct: 459 LLPPPPGRHRRIRVEDGRL 403 Score = 22.6 bits (43), Expect(2) = 2.2 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / -3 Query: 5 RRRRWSWCPPP 37 R RRW+ PPP Sbjct: 477 RLRRWALLPPP 445
>LOC_Os04g36000:12004.t03270:unspliced-genomic F-box domain containing protein| Length = 3035 Score = 26.3 bits (51), Expect(2) = 2.2 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -2 / -1 Query: 215 KSVGVAKNRARAARFPILNSPFVSPPKTHTRLFPWRLAAADAVL 84 +S+G + P L +P +P TH L PW +A + L Sbjct: 1499 RSLGPPLRTPPPSILPPLRTPPSTPSSTHHALSPWSTPSATSRL 1368 Score = 24.4 bits (47), Expect(2) = 2.2 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 / -1 Query: 46 GRSGRRTPAPSPS 8 GR R+ PAPSPS Sbjct: 1268 GRRERKPPAPSPS 1230
>LOC_Os03g27640:12003.t02438:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1927 Score = 33.6 bits (67), Expect = 2.3 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -1 / -1 Query: 456 LLTILRAIACTNFDILIY*SGIPCYVVVGCHYFDLKTFSDEVWEIIRCT 310 ++ ILR N DI + +G PCY+V +F W+I+ T Sbjct: 1687 MVAILRIDQLLNVDIAKFSNGDPCYLVTSMCISSSSSFKHHRWDILTIT 1541
>LOC_Os12g02030:12012.t00100:unspliced-genomic TD and POZ domain-containing protein 2, putative, expressed| Length = 1877 Score = 27.2 bits (53), Expect(2) = 2.3 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 / +1 Query: 5 RRRRWSWCPPPAP 43 RR+ W+W P P+P Sbjct: 1135 RRQAWNWAPNPSP 1173 Score = 23.5 bits (45), Expect(2) = 2.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 / +3 Query: 71 LPPHPGRHQQLLGATGRV 124 +PPHP R ++L G R+ Sbjct: 1299 VPPHPRRRRRLQGPRRRL 1352
>LOC_Os02g37160:12002.t03354:unspliced-genomic expressed protein| Length = 1601 Score = 27.2 bits (53), Expect(2) = 2.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 / -1 Query: 197 KNRARAARFPILNSPFVSPPKTHTRLFPWRLAAADAVLDVEGATS 63 ++R+R R P ++ + T T PWR AAA A G T+ Sbjct: 1055 RSRSRRRRRPSPSATGGTGTGTRTGWAPWRTAAATAAAGGTGRTA 921 Score = 23.5 bits (45), Expect(2) = 2.4 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 / -1 Query: 40 SGRRTPAPSPSP 5 SG TPA SPSP Sbjct: 911 SGTATPASSPSP 876
>LOC_Os05g01350:12005.t00037:unspliced-genomic AFH1, putative, expressed| Length = 4124 Score = 29.9 bits (59), Expect(2) = 2.5 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 / -3 Query: 85 WMWREQPVGCKRIGRSGRR 29 W WR+ V +R GR GRR Sbjct: 582 WRWRDAMVAARRPGRRGRR 526 Score = 25.8 bits (50), Expect(2) = 2.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 / -1 Query: 250 WFWSWSGPRRRVRAWV*QRTEQ 185 W W W RRR + W +R E+ Sbjct: 1007 WEWEWWRWRRRRKRWRERRAER 942
>LOC_Os11g43740:12011.t03904:unspliced-genomic DNA binding protein, putative, expressed| Length = 4049 Score = 33.1 bits (66), Expect = 3.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 / -3 Query: 46 GRSGRRTPAPSPSPP 2 GRSGRR+P+P P PP Sbjct: 2664 GRSGRRSPSPPPPPP 2620
>LOC_Os08g37270:12008.t03464:unspliced-genomic AHM1, putative, expressed| Length = 1552 Score = 33.1 bits (66), Expect = 3.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / -1 Query: 61 GCKRIGRSGRRTPAPSPSPP 2 GC R GR R +P P P PP Sbjct: 700 GCSRTGRPSRTSPPPPPPPP 641
>LOC_Os08g07510:12008.t00640:unspliced-genomic hypothetical protein| Length = 435 Score = 33.1 bits (66), Expect = 3.1 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 / +2 Query: 295 SSCSAEASVFPHKDLWFWSWSGPRRRVRAWV*QR 194 S+ S A+ P W W+ RRR RAWV R Sbjct: 170 SAASTAAAAAPAARSWSGRWASARRRSRAWVGMR 271
>LOC_Os04g01970:12004.t00094:unspliced-genomic SWI/SNF-related matrix-associated actin-dependent regulator of| chromatin subfamily C member, putative, expressed Length = 6580 Score = 33.1 bits (66), Expect = 3.1 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -3 / +2 Query: 955 QCAPTSWDSWQRYNASIWLYTYNNSLSFPRARFLMLAC 842 Q P +WD+W++ +W + + ++ P + LM C Sbjct: 6212 QTKPPTWDAWEQIAGRVWCESASEAILRPTSHVLMT*C 6325
>LOC_Os03g63074:12003.t05528:unspliced-genomic Ser/Thr protein phosphatase family protein, expressed| Length = 7153 Score = 33.1 bits (66), Expect = 3.1 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 / +2 Query: 85 WMWREQPVGCKRIGRSGRRTPAPSPSPP 2 W R + GC R GRR+ +PS SPP Sbjct: 134 WTCRTRTRGCSGGSRGGRRSRSPSRSPP 217
>LOC_Os02g16790:12002.t01472:unspliced-genomic protein Kinase-like protein TMKL1 precursor, putative| Length = 654 Score = 33.1 bits (66), Expect = 3.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 / -3 Query: 58 CKRIGRSGRRTPAPSPSP 5 C+R R GRR PAP P+P Sbjct: 574 CRRTRRGGRRAPAPRPAP 521
>LOC_Os01g52050:12001.t04632:unspliced-genomic systemin receptor SR160 precursor, putative, expressed| Length = 3945 Score = 28.1 bits (55), Expect(2) = 3.2 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -3 / -1 Query: 394 NPVLCSCRVSLL*PENLL**SLGNHQVHGWLPESSCSAEASVFPHK 257 NP+L R S+L P + S H H ++SC+ + PH+ Sbjct: 2907 NPLLLQQRFSVLPPNSAFYRSFCGHATHPPSCQTSCNHTPTTAPHQ 2770 Score = 27.2 bits (53), Expect(2) = 3.2 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 / -1 Query: 40 SGRRTPAPSPSPP 2 +GRR P P PSPP Sbjct: 243 AGRRRPPPPPSPP 205
>LOC_Os09g32550:12009.t02869:unspliced-genomic glucan endo-1,3-beta-glucosidase A6 precursor, putative, expressed| Length = 4007 Score = 32.7 bits (65), Expect(2) = 3.3 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 / +1 Query: 684 IRRRATLSAGLPAEDNSFLL*CCLHLIIWSVSADRCSILLLQPCR 818 +RR LPAE + L L++ + DRC +LL QP R Sbjct: 1378 VRRHPARRGVLPAEHHGGARQLRLQLVLAAAEEDRCDVLLQQPRR 1512 Score = 22.6 bits (43), Expect(2) = 3.3 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +3 / +3 Query: 138 GWRHEW*VQDREAGSSCS 191 GWR W R GSS S Sbjct: 441 GWRRIWCPTTRRRGSSTS 494
>LOC_Os05g25340:12005.t02190:unspliced-genomic hypothetical protein| Length = 768 Score = 29.0 bits (57), Expect(2) = 3.3 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 / -2 Query: 637 PPVGPSTFFSAKQFEVFDVELLSV 708 PP PST+ S Q VF+ ELL+V Sbjct: 641 PPTSPSTWASLFQNAVFEDELLAV 570 Score = 24.0 bits (46), Expect(2) = 3.3 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 / -1 Query: 38 APSYPLATDWLLPPHPGRHQ 97 AP +PL + +LL P P + + Sbjct: 765 APLFPLVSPFLLSPSPSQRR 706
>LOC_Os05g49320:12005.t04365:unspliced-genomic 50S ribosomal protein L12-1, chloroplast precursor, putative,| expressed Length = 745 Score = 25.4 bits (49), Expect(2) = 3.3 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 / +1 Query: 17 WSWCPPPAP 43 W W PPP+P Sbjct: 40 WPWLPPPSP 66 Score = 24.9 bits (48), Expect(2) = 3.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +1 Query: 29 PPPAPSYPLATDWLLPPHPGR 91 PP P YP +T PP P R Sbjct: 55 PPSPPPYPSSTSAPPPPLPRR 117
>LOC_Os01g61540:12001.t05533:unspliced-genomic hypothetical protein| Length = 831 Score = 28.6 bits (56), Expect(2) = 3.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 / +2 Query: 49 IGRSGRRTPAPSPSPP 2 +G G +PAP+PSPP Sbjct: 641 LGDDGESSPAPTPSPP 688 Score = 24.4 bits (47), Expect(2) = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -3 / +1 Query: 262 HKDLWFWSWSGPRRRVR 212 H D SW GPRRR R Sbjct: 607 HTDAATRSWLGPRRRRR 657
>LOC_Os01g29750:12001.t02659:unspliced-genomic SWIM zinc finger family protein| Length = 6980 Score = 27.6 bits (54), Expect(2) = 3.8 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 / -3 Query: 29 PPPAPSYPLATDWLLPPHPGR 91 P P PL T W PP P R Sbjct: 6780 PQPKTLLPLGTGWRRPPQPRR 6718 Score = 22.1 bits (42), Expect(2) = 3.8 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +2 / -3 Query: 8 RRRWSWCPPPAP 43 R + WCPP +P Sbjct: 6897 RCQGGWCPPSSP 6862
>LOC_Os07g35680:12007.t03243:unspliced-genomic receptor-like serine-threonine protein kinase, putative, expressed| Length = 6726 Score = 25.4 bits (49), Expect(2) = 3.8 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 / +3 Query: 146 SPPKTHTRLFPWRLAAADAVLDVEGAT 66 +PP+ + PW+L A A EG+T Sbjct: 159 APPRAGAQPLPWQLCNATAGNYTEGST 239 Score = 24.4 bits (47), Expect(2) = 3.8 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 / +1 Query: 43 RSGRRTPAPSPSPP 2 RS TP P P+PP Sbjct: 355 RSAAATPTPPPAPP 396
>LOC_Os06g49240:12006.t04608:unspliced-genomic peptide transporter PTR2, putative| Length = 1650 Score = 25.8 bits (50), Expect(3) = 4.0 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 / -3 Query: 91 PSWMWREQPVGCKRIGRSGRRTPAPS 14 P WR +P +R +GR P+PS Sbjct: 1252 PRRPWRARPW*ARRRSSAGRECPSPS 1175 Score = 24.0 bits (46), Expect(3) = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 / -3 Query: 547 CLAEFWQANPGCR 509 C W+A PGCR Sbjct: 1423 CTPSSWRAAPGCR 1385 Score = 22.1 bits (42), Expect(3) = 4.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 / -2 Query: 298 ESSCSAEASVFP 263 +SSC AEAS+ P Sbjct: 1382 KSSCPAEASISP 1347
>LOC_Os08g16540:12008.t01527:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3073 Score = 25.8 bits (50), Expect(2) = 4.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 / -1 Query: 757 CKQHQSKKLLSSAGSPALRVARRR 686 CK H+ LLS SP+ ++RRR Sbjct: 259 CKPHRRP*LLSRRRSPSSSLSRRR 188 Score = 24.0 bits (46), Expect(2) = 4.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 / -1 Query: 811 GCRRRMLHRSALTD 770 GCRR HR L+D Sbjct: 382 GCRRSYAHRGCLSD 341
>LOC_Os11g36610:12011.t03207:unspliced-genomic F-box domain containing protein, expressed| Length = 1509 Score = 32.7 bits (65), Expect = 4.2 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 / +2 Query: 532 WQANPGCRCYLSFVLIRCSPHSEI 461 W++ P R SFVL RC+PH + Sbjct: 101 WRSLPSWRSLTSFVLARCAPHGAL 172
>LOC_Os07g39220:12007.t03583:unspliced-genomic BES1/BZR1 homolog protein 1, putative, expressed| Length = 1536 Score = 32.7 bits (65), Expect = 4.2 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +2 / -2 Query: 29 PPPAPSYPLATDWLLPPHPGRHQQLLGATGRV*YVSW 139 PPP SYP A PP P LL G + ++ W Sbjct: 116 PPPRTSYPPAPSLTSPPLPSSPPPLLSPLGELKFL*W 6
>LOC_Os07g32570:12007.t02939:unspliced-genomic OsAPRL1 - Oryza sativa adenosine 5'-phosphosulfate reductase-like,| expressed Length = 3296 Score = 32.7 bits (65), Expect = 4.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 / +1 Query: 11 RRWSWCPPPAPSYPLATDWLLPPHP 85 R W PPP PS PL W P P Sbjct: 577 RPWRRTPPPPPSTPLLRPWTTRPWP 651
>LOC_Os04g53660:12004.t04840:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3923 Score = 32.7 bits (65), Expect = 4.2 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 / +1 Query: 32 PPAPSYPLATDWLLPPHPGRH 94 P PS P A+ LLPPHPG H Sbjct: 169 PIPPSIPRASILLLPPHPG*H 231
>LOC_Os04g51970:12004.t04673:unspliced-genomic transporter-like protein, putative, expressed| Length = 3763 Score = 32.7 bits (65), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 / +1 Query: 41 PSYPLATDWLLPPHPGRH 94 PS P A LLPPHPG H Sbjct: 325 PSIPRAPPSLLPPHPGEH 378
>LOC_Os01g62300:12001.t05605:unspliced-genomic SLT1 protein, putative, expressed| Length = 2483 Score = 32.7 bits (65), Expect = 4.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 / +3 Query: 2 GRRRRWSWCPPPAPSYPLATDWLLPPHPGRHQ 97 G RRRW W PP P +P PP R + Sbjct: 588 GERRRWRWRWPPQPLHPSLHGSRRPPRRPRRR 683
>LOC_Os01g36390:12001.t03187:unspliced-genomic DNA replication licensing factor mcm4, putative, expressed| Length = 4954 Score = 32.7 bits (65), Expect = 4.2 Identities = 18/50 (36%), Positives = 20/50 (40%) Frame = +2 / +2 Query: 2 GRRRRWSWCPPPAPSYPLATDWLLPPHPGRHQQLLGATGRV*YVSWVETR 151 G RR P PS P + PPHPGR GA R +W R Sbjct: 209 GGGRRRRGSASPYPSSPSLGGFETPPHPGRRTPSGGAAARQQRQNWTGGR 358
>LOC_Os01g08340:12001.t00712:unspliced-genomic protein binding protein, putative, expressed| Length = 3792 Score = 32.7 bits (65), Expect = 4.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 / -2 Query: 747 CCLHLIIWSVSADRCSILLLQPCRE 821 CC H WS S + S L QPC+E Sbjct: 3146 CCCHGCSWSSSPEHSSSRLSQPCKE 3072
>LOC_Os06g43670:12006.t04057:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 12542 Score = 32.7 bits (65), Expect = 4.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 / -2 Query: 984 FFFFFVEKGTSVPPHHGIHGN 922 FFFFF+ + + PP H HG+ Sbjct: 2554 FFFFFITRAHTTPPAHHTHGH 2492
>LOC_Os02g49690:12002.t04553:unspliced-genomic amino acid binding protein, putative, expressed| Length = 1415 Score = 27.2 bits (53), Expect(2) = 4.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 / +1 Query: 35 PAPSYPLATDWLLPPHPGR 91 P S LA WLLPP P R Sbjct: 484 PPGSRGLAAQWLLPPPPPR 540 Score = 22.6 bits (43), Expect(2) = 4.3 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / +3 Query: 5 RRRRWSWCPPPAP 43 R RRW W P P Sbjct: 426 RGRRWPWSPSVPP 464
>LOC_Os11g19480:12011.t01718:unspliced-genomic ATP binding protein, putative, expressed| Length = 1725 Score = 24.9 bits (48), Expect(3) = 4.3 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 / +2 Query: 970 CGERYQCAPTSWDSWQ 923 C R +C PT W W+ Sbjct: 92 CPWRRRCRPTGWRCWR 139 Score = 24.9 bits (48), Expect(3) = 4.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 / +1 Query: 37 GRRTPAPSPSP 5 G TP+PSPSP Sbjct: 1594 GEHTPSPSPSP 1626 Score = 22.1 bits (42), Expect(3) = 4.3 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -2 / +3 Query: 224 KASKSVGVAKNRARAARFPILNSPFVSPPKTH 129 + + V V RAR AR P P PP H Sbjct: 276 RREEPVRVRAVRARLARAPPPPQPARQPPLRH 371
>LOC_Os05g36920:12005.t03236:unspliced-genomic histone deacetylase-like amidohydrolase, putative, expressed| Length = 2948 Score = 29.0 bits (57), Expect(2) = 4.5 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 / +1 Query: 5 RRRRWSWCPPPAPSY 49 RRRRWS PPP P + Sbjct: 91 RRRRWSRPPPPRPRW 135 Score = 25.4 bits (49), Expect(2) = 4.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 / +2 Query: 29 PPPAPSYPLATDWLLPPHPGRHQQLL 106 PPP P L L PP P R LL Sbjct: 308 PPPRPHRALHLLALRPPRPRRRAPLL 385
>LOC_Os07g48229:12007.t04455:unspliced-genomic vacuolar sorting receptor 1 precursor, putative, expressed| Length = 10235 Score = 24.9 bits (48), Expect(2) = 4.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 / -2 Query: 2 GRRRRWSWCPPPAPS 46 GRRR +WCP A S Sbjct: 391 GRRRPRAWCPRTAAS 347 Score = 24.4 bits (47), Expect(2) = 4.9 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 / -2 Query: 32 PPAPSYPLATDWLLPPHPGRH 94 PP S P W PP RH Sbjct: 274 PPRTSPPPPPPWTPPPRAARH 212
>LOC_Os04g18400:12004.t01582:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5447 Score = 25.8 bits (50), Expect(2) = 5.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = -3 / -3 Query: 94 MPSWMWREQPVGCKRIGRSGRRTPAPSPSPP 2 M W W R R RR +PSP PP Sbjct: 444 MYRWCWCPHHDASPRRLRRRRRRVSPSPPPP 352 Score = 23.5 bits (45), Expect(2) = 5.2 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 / -3 Query: 178 PASRS*THHSCLHPRHI 128 P RS* H C+H R I Sbjct: 597 PLHRS*VSHECMHLRGI 547
>LOC_Os01g43460:12001.t03861:unspliced-genomic C4-dicarboxylate transporter/malic acid transport protein, expressed| Length = 2690 Score = 26.3 bits (51), Expect(2) = 5.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 / -1 Query: 29 PPPAPSYPLATDWLLPPHPGRHQQL 103 PP A +PL D L GRH+++ Sbjct: 1562 PPLAAGHPLPVDLELQAEDGRHERV 1488 Score = 23.1 bits (44), Expect(2) = 5.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / -3 Query: 2 GRRRRWSWCPPPAPSY 49 GRRR W P APS+ Sbjct: 1680 GRRRSRRWGPRGAPSW 1633
>LOC_Os05g48350:12005.t04269:unspliced-genomic hypothetical protein| Length = 246 Score = 25.4 bits (49), Expect(2) = 5.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 / +2 Query: 11 RRWSWCPPPAPSYPLATDWLLPP 79 R WS PP PS P + PP Sbjct: 17 RHWSQLRPPPPSSPSQSQLRPPP 85 Score = 24.0 bits (46), Expect(2) = 5.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +3 / +1 Query: 852 IRKRARGKERE 884 +RKR RG+ERE Sbjct: 184 VRKRGRGRERE 216
>LOC_Os06g06910:12006.t00576:unspliced-genomic expressed protein| Length = 1320 Score = 25.8 bits (50), Expect(2) = 5.8 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = -3 / -1 Query: 982 FFFFCGERYQCAPTSWDSWQRYNASIWLYTYN 887 +F R Q T WD W S YT N Sbjct: 1308 YFSILFSRQQTKRTQWDQWNNQEFSS*QYTNN 1213 Score = 23.5 bits (45), Expect(2) = 5.8 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = -3 / -1 Query: 805 RRRMLHRSALTDQMIKCKQHQSKKLLSSAGSPA 707 + + LHRS + + HQ + +S SPA Sbjct: 1203 KNQQLHRSVVANAKQSSVHHQRARQFNSPMSPA 1105
>LOC_Os12g15130:12012.t01370:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 1398 Score = 32.2 bits (64), Expect = 5.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 / -3 Query: 924 CHESHDVGAHWYL 962 CHE+H G HWYL Sbjct: 1102 CHEAHATGPHWYL 1064
>LOC_Os11g47870:12011.t04279:unspliced-genomic chitin-inducible gibberellin-responsive protein 2, putative,| expressed Length = 2449 Score = 32.2 bits (64), Expect = 5.8 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 / +3 Query: 8 RRRWSWCPPPAPSYPLAT 61 RR SWCPP PS P +T Sbjct: 567 RRPTSWCPPTTPSSPAST 620
>LOC_Os09g01480:12009.t00050:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 9779 Score = 32.2 bits (64), Expect = 5.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 / +2 Query: 250 WFWSWSGPRRRVRAW 206 W WSW P+++VR+W Sbjct: 2081 WRWSWKVPKQKVRSW 2125
>LOC_Os08g45030:12008.t04224:unspliced-genomic multidrug resistance protein 1, putative, expressed| Length = 5864 Score = 32.2 bits (64), Expect = 5.8 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -3 / -3 Query: 76 REQPVGCKRIGRSGRRTPAPSPSPP 2 R +PV C RSG R+ AP P+PP Sbjct: 1284 RCRPVRCPWRSRSGSRSAAPRPAPP 1210
>LOC_Os08g27824:12008.t02541:unspliced-genomic RNA binding protein, putative, expressed| Length = 13509 Score = 32.2 bits (64), Expect = 5.8 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 / +1 Query: 598 LVSCPESPLQNLELMICCLAEFWQANPGCRCYLSFVLI 485 L C S L + L++CC++ + N G L F+L+ Sbjct: 3013 LRGCTSSHLSMVHLLLCCISWLFVCNTGTNTLLYFILL 3126
>LOC_Os08g22080:12008.t01993:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 4747 Score = 32.2 bits (64), Expect = 5.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / -1 Query: 921 RCHESHDVGAHWYL 962 RCHE+H G HW+L Sbjct: 4624 RCHEAHATGPHWHL 4583
>LOC_Os07g12100:12007.t01082:unspliced-genomic expressed protein| Length = 6907 Score = 32.2 bits (64), Expect = 5.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / +2 Query: 5 RRRRWSWCPPPAPSYPLATDW 67 RRR W PPP+P AT W Sbjct: 2411 RRRSTMWSPPPSPPLTAATAW 2473
>LOC_Os07g08510:12007.t00726:unspliced-genomic hypothetical protein| Length = 1398 Score = 32.2 bits (64), Expect = 5.8 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 / +2 Query: 88 SWMWREQPVGCKRIGRSGRRTPAPSPSPP 2 +W WR P + +P+PSP PP Sbjct: 26 TWRWRSPPATTTSTSTAAPASPSPSPPPP 112
>LOC_Os04g31610:12004.t02842:unspliced-genomic MYND finger family protein, expressed| Length = 1702 Score = 32.2 bits (64), Expect = 5.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / +1 Query: 20 SWCPPPAPSYPLATDWLLPPH 82 S PPPAP P+ W PPH Sbjct: 1369 STTPPPAPPTPMPPPWPRPPH 1431
>LOC_Os03g60400:12003.t05279:unspliced-genomic 40S ribosomal protein S23, putative, expressed| Length = 2241 Score = 32.2 bits (64), Expect = 5.8 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 / +1 Query: 64 VGCKRIGRSGRRTPAPSPSPP 2 V C +GR TPAP PSPP Sbjct: 91 VACSSALAAGRPTPAPGPSPP 153
>LOC_Os02g44990:12002.t04089:unspliced-genomic F-box domain containing protein, expressed| Length = 2774 Score = 32.2 bits (64), Expect = 5.8 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = +2 / +2 Query: 5 RRRRWSWCPPPAPSYP 52 RRRRW PPPAPS P Sbjct: 806 RRRRW*STPPPAPSSP 853
>LOC_Os02g42320:12002.t03817:unspliced-genomic proteasome subunit alpha type 2, putative, expressed| Length = 4398 Score = 32.2 bits (64), Expect = 5.8 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +2 / +1 Query: 5 RRRRWSWCPPPAPSYPLATDWLLPPHPG 88 RRR W P+PS P L PP PG Sbjct: 145 RRRPWETASTPSPSPPSGMCCLAPPSPG 228
>LOC_Os02g31280:12002.t02820:unspliced-genomic hypothetical protein| Length = 1111 Score = 32.2 bits (64), Expect = 5.8 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 / -3 Query: 2 GRRRRWSWCPPPAPSYPLATDWLLPPHP 85 G RR W PPP P P + PP P Sbjct: 179 GERRSREWPPPPPPLSPSSASLAPPPRP 96
>LOC_Os02g24880:12002.t02185:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 2232 Score = 32.2 bits (64), Expect = 5.8 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / -3 Query: 921 RCHESHDVGAHWYL 962 RCHE+H G HW+L Sbjct: 1864 RCHEAHATGPHWHL 1823
>LOC_Os02g10770:12002.t00925:unspliced-genomic pre-mRNA-processing ATP-dependent RNA helicase PRP5, putative,| expressed Length = 12369 Score = 32.2 bits (64), Expect = 5.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 / +3 Query: 174 AGSSCSVLCYTHALTRLLGPLQ 239 AG SCS++CYT L GP Q Sbjct: 11823 AGVSCSLVCYTRCLMNWCGPRQ 11888
>LOC_Os02g02040:12002.t00104:unspliced-genomic protein kinase, putative, expressed| Length = 6696 Score = 32.2 bits (64), Expect = 5.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 / -2 Query: 268 FPHKDLWFWSWSGPRRR 218 F + D WFW W G RRR Sbjct: 5120 FKYTDPWFWLWLGKRRR 5070
>LOC_Os06g23260:12006.t02138:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 9154 Score = 32.2 bits (64), Expect = 5.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 / -1 Query: 595 PGGKRRLIIPPELGPPVGPS 654 PG R+L +PPE PP PS Sbjct: 109 PGANRKLWLPPEASPPAQPS 50
>LOC_Os05g37730:12005.t03315:unspliced-genomic MYB-like transcription factor DIVARICATA, putative, expressed| Length = 2124 Score = 28.1 bits (55), Expect(2) = 6.1 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 / -1 Query: 241 SWSGPRRRVRAWV*QRTEQELPASRS*THHSCLHP 137 SWSGPR R+ +*Q PA S S ++P Sbjct: 831 SWSGPRARLPPTM*QERLNPRPAGSSPPSQSRVNP 727 Score = 25.4 bits (49), Expect(2) = 6.1 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 / -2 Query: 46 GRSGRRTPAPSPSP 5 GRSGR PAP+ +P Sbjct: 572 GRSGRAPPAPARTP 531
>LOC_Os04g52540:12004.t04728:unspliced-genomic eukaryotic translation initiation factor 2C 2, putative, expressed| Length = 4249 Score = 29.5 bits (58), Expect(2) = 6.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 / +3 Query: 250 WFWSWSGPRRRVRAWV 203 W+W W+ R R RAWV Sbjct: 246 WWWWWTRVRARRRAWV 293 Score = 24.9 bits (48), Expect(2) = 6.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 / +1 Query: 46 GRSGRRTPAPSPSP 5 GR G PAP+P+P Sbjct: 499 GRGGAPAPAPAPAP 540
>LOC_Os06g28070:12006.t02511:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4277 Score = 27.6 bits (54), Expect(2) = 6.2 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 / +3 Query: 55 KRIGRSGRRTPAPSPS 8 K++G+ +TPAPSPS Sbjct: 2079 KKVGKEKPKTPAPSPS 2126 Score = 26.7 bits (52), Expect(2) = 6.2 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -3 / +1 Query: 250 WFWSWSGPRRRVRAW 206 W W+W+ RRR +W Sbjct: 1696 WCWTWTRGRRRRSSW 1740
>LOC_Os02g38900:12002.t03528:unspliced-genomic nucleotide-binding protein 1, putative, expressed| Length = 3050 Score = 27.6 bits (54), Expect(2) = 6.2 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 / -2 Query: 304 LPESSCSAEASVFPHKDLWFWSW 236 LP+S+ E PH W W W Sbjct: 1336 LPDSTLDLENQ*GPHISSWVWDW 1268 Score = 26.3 bits (51), Expect(2) = 6.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 / -3 Query: 58 CKRIGRSGRRTPAPSPSP 5 C+ R RR+P+PSP P Sbjct: 192 CRHRRRRRRRSPSPSPPP 139
>LOC_Os01g03180:12001.t00210:unspliced-genomic pr5, putative, expressed| Length = 1568 Score = 29.5 bits (58), Expect(2) = 6.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 / -1 Query: 88 SWMWREQPVGCKRIGRSGRRTP 23 +W WREQ C G + RRTP Sbjct: 1316 AWQWREQLDRCGC*GSASRRTP 1251 Score = 23.5 bits (45), Expect(2) = 6.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -1 / -3 Query: 753 NNIRVKSYCPPLAVLH*E*LDVEY 682 NNIRVK Y P V+ * L Y Sbjct: 1518 NNIRVKPYKIPTQVMS*TILHYSY 1447
>LOC_Os02g32320:12002.t02875:unspliced-genomic hypothetical protein| Length = 612 Score = 29.9 bits (59), Expect(2) = 6.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 / +2 Query: 970 CGERYQCAPTSWDSWQRYNAS 908 CG R C+P SW SW +S Sbjct: 98 CGPRRPCSPPSWWSWPSAGSS 160 Score = 21.7 bits (41), Expect(2) = 6.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 / +2 Query: 79 WREQPVGCKRIGRSGRR 29 WR + G +R R+GRR Sbjct: 533 WRMRSGGGRRSARAGRR 583
>LOC_Os11g26130:12011.t02229:unspliced-genomic receptor protein kinase TMK1 precursor, putative, expressed| Length = 7449 Score = 25.8 bits (50), Expect(2) = 6.8 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -2 / -2 Query: 242 VLEWAEKASKSVGVAKNRARAARFPILNSPFVSP 141 V W + + V +RAR AR PIL +P Sbjct: 407 VRPWRKSGGREVKALPSRARRAREPILAREGTAP 306 Score = 23.1 bits (44), Expect(2) = 6.8 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 / -3 Query: 34 RRTPAPSPSPP 2 RR APSPSPP Sbjct: 220 RRG*APSPSPP 188
>LOC_Os02g41500:12002.t03736:unspliced-genomic OsWAK13 - OsWAK receptor-like protein kinase, expressed| Length = 2466 Score = 29.5 bits (58), Expect(2) = 6.9 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 / +2 Query: 14 RWSWCPPPAPSYPLATDWLLPPHP 85 R S PPPAPS AT W P P Sbjct: 581 RRSSTPPPAPSAGAATPWWSRPPP 652 Score = 24.0 bits (46), Expect(2) = 6.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 / +3 Query: 342 RRFSGQSSDTRQLHNTGFRI 401 RR Q + R+LH+ GFR+ Sbjct: 1860 RREIAQHAHRRELHSEGFRL 1919
>LOC_Os12g28720:12012.t02582:unspliced-genomic expressed protein| Length = 4349 Score = 26.7 bits (52), Expect(2) = 7.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 / +2 Query: 2 GRRRRWSWCPPPAPS 46 G RR+W+WC AP+ Sbjct: 4175 GGRRQWAWCRFAAPA 4219 Score = 22.1 bits (42), Expect(2) = 7.1 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +2 / +1 Query: 50 PLATDWLLPPHP 85 P+ T W+ PHP Sbjct: 4246 PVVTGWIRLPHP 4281
>LOC_Os03g53720:12003.t04691:unspliced-genomic ATP binding protein, putative, expressed| Length = 4104 Score = 25.4 bits (49), Expect(2) = 7.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 / -2 Query: 29 PPPAPSYPLATDWLLPPHPG 88 PP P P A+ L PP PG Sbjct: 230 PPSPPPPPAASSPLPPPSPG 171 Score = 23.5 bits (45), Expect(2) = 7.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 / -2 Query: 5 RRRRWSWCPPPAPSYP 52 RRRR PPP PS P Sbjct: 263 RRRRPPPSPPPPPSPP 216
>LOC_Os01g46370:12001.t04088:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 3600 Score = 27.2 bits (53), Expect(2) = 7.2 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 / +1 Query: 59 TDWLLPPHPGRHQQLLGATGRV 124 T W PP P H+++ ++GR+ Sbjct: 2206 TPWCSPPEPPHHRRVPSSSGRL 2271 Score = 26.7 bits (52), Expect(2) = 7.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 / +3 Query: 786 RCSILLLQPCREKMLAIVVHANIRKRARGKER 881 RCS LLQP + ++ AN ++R + +E+ Sbjct: 2481 RCSACLLQPLAAARIHTMLCANEKRRKKREEK 2576
>LOC_Os01g50090:12001.t04446:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 3114 Score = 26.7 bits (52), Expect(2) = 7.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 / -3 Query: 26 CPPPAPSYPLATDWLLPPHP 85 C P P PLAT +P HP Sbjct: 2596 CLPTPPHLPLATSAPVPDHP 2537 Score = 22.1 bits (42), Expect(2) = 7.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 / -1 Query: 71 LPPHPGRHQQLL 106 LPP GRH LL Sbjct: 2499 LPPEDGRHPPLL 2464
>LOC_Os04g10870:12004.t00917:unspliced-genomic conserved hypothetical protein| Length = 1688 Score = 25.8 bits (50), Expect(2) = 7.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / -3 Query: 32 PPAPSYPLATDWLLPPHPG 88 PPA + W PPHPG Sbjct: 1641 PPASPFSHTRWWPPPPHPG 1585 Score = 23.1 bits (44), Expect(2) = 7.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 / -3 Query: 132 CLGWRHEW*VQDR 170 C W H W* +DR Sbjct: 1563 CWHWCHVW*AEDR 1525
>LOC_Os12g13530:12012.t01220:unspliced-genomic hypothetical protein| Length = 2222 Score = 31.8 bits (63), Expect = 8.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 / -2 Query: 29 PPPAPSYPLATDWLLPP 79 P P S+P+A DW LPP Sbjct: 52 PSPTSSHPIAMDWQLPP 2
>LOC_Os10g36966:12010.t02970:unspliced-genomic hypothetical protein| Length = 1547 Score = 31.8 bits (63), Expect = 8.0 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 / +3 Query: 5 RRRRWSWCPPPAPSYPLATDWLLPPHP 85 RR R PPP P+ P AT + PP P Sbjct: 651 RRHRAHLPPPPLPASPTATAFAYPPPP 731
>LOC_Os10g17190:12010.t01279:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 790 Score = 31.8 bits (63), Expect = 8.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +3 / -3 Query: 924 CHESHDVGAHWYLS 965 CHE+H G HW+LS Sbjct: 494 CHEAHATGPHWHLS 453
>LOC_Os10g04290:12010.t00317:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 13431 Score = 31.8 bits (63), Expect = 8.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 / -3 Query: 215 KSVGVAKNRARAARFPILNSPFVSPPKTHTRLFPWR 108 + V VA N+ + I N PF++ HTR+ P R Sbjct: 7576 RKVNVASNQTDTSTHKISN*PFIATTNQHTRIIPNR 7469
>LOC_Os09g30502:12009.t02739:unspliced-genomic transposon protein, putative, unclassified| Length = 1435 Score = 31.8 bits (63), Expect = 8.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 / +3 Query: 91 PSWMWREQPVGCKRIGRSGRRTPAPSP 11 P+W R G +R GR GRRT A SP Sbjct: 999 PTWQPRGPAGGGRRGGRDGRRTAAVSP 1079
>LOC_Os09g16490:12009.t01436:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1404 Score = 31.8 bits (63), Expect = 8.0 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +3 / -2 Query: 924 CHESHDVGAHWYL 962 CHE+H VG HW+L Sbjct: 1103 CHEAHAVGPHWHL 1065
>LOC_Os09g11580:12009.t00947:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 9462 Score = 31.8 bits (63), Expect = 8.0 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -3 / +2 Query: 940 SWDSWQRYNASIWLYTYNNSLSFPRARFLMLACTTIANIFSLQGCRRR 797 S D ++ W+Y Y+N L F ++ L L + F QG RR Sbjct: 1349 STDMYEHLPRFSWIYPYSNPLFFSKSSLLSLLLFLQVSYF*TQGTTRR 1492
>LOC_Os07g14740:12007.t01337:unspliced-genomic harpin-induced protein, putative, expressed| Length = 1036 Score = 31.8 bits (63), Expect = 8.0 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 / +3 Query: 2 GRRRRWSWCPPPAPSYPLATDWLLPPHPGRHQQ 100 G RRRW PPA + P W P P ++ Sbjct: 405 GPRRRWCTGSPPAATLPRRPAWATPASPSSRRR 503
>LOC_Os06g05284:12006.t00417:unspliced-genomic transferase family protein, expressed| Length = 2343 Score = 31.8 bits (63), Expect = 8.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 / -1 Query: 23 WCPPPAPSYPLATDWLLP 76 W PPP P+ P AT W P Sbjct: 669 WPPPPPPAIPPATPWTTP 616
>LOC_Os06g04240:12006.t00313:unspliced-genomic Q-rich domain protein, putative, expressed| Length = 731 Score = 31.8 bits (63), Expect = 8.0 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 / -2 Query: 58 CKRIGRSGRRTPAPSPSPP 2 C RSG R PAP PSPP Sbjct: 160 CPPATRSGSRMPAPCPSPP 104
>LOC_Os04g03290:12004.t00219:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1882 Score = 31.8 bits (63), Expect = 8.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 / -1 Query: 79 WREQPVGCKRIGRSGRRTPAPSPSPP 2 WR C R G + RR PSP PP Sbjct: 589 WRRSAPTCCRFGIASRRRRRPSPPPP 512
>LOC_Os03g36890:12003.t03153:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3401 Score = 31.8 bits (63), Expect = 8.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 / -3 Query: 23 WCPPPAPSYPLATDWLLPPHPGR 91 W PP P A DWL P +P R Sbjct: 1320 WAPPRGCENPAALDWLGPDYPDR 1252
>LOC_Os03g29850:12003.t02597:unspliced-genomic zinc transporter 2 precursor, putative, expressed| Length = 3309 Score = 31.8 bits (63), Expect = 8.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 / +2 Query: 79 WREQPVGCKRIGRSGRRTPAPSPSP 5 W + GC R GRS + PSPSP Sbjct: 2702 WASRCSGCCRTGRSSPASATPSPSP 2776
>LOC_Os02g18490:12002.t01642:unspliced-genomic hypothetical protein| Length = 2894 Score = 31.8 bits (63), Expect = 8.0 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 / +1 Query: 836 CCTCQHKKTCARKREG 883 CCTC +++C R+R+G Sbjct: 433 CCTCSGRRSCRRRRQG 480
>LOC_Os02g06270:12002.t00525:unspliced-genomic phytosulfokine receptor precursor, putative, expressed| Length = 2211 Score = 31.8 bits (63), Expect = 8.0 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 / +3 Query: 26 CPPPAPSYPLATDWLLPPHPGRHQQL 103 CPPP P +PL W L RH+ L Sbjct: 69 CPPPVPCWPLRRRWPLRIMAERHKLL 146
>LOC_Os02g06210:12002.t00519:unspliced-genomic phytosulfokine receptor precursor, putative, expressed| Length = 2517 Score = 31.8 bits (63), Expect = 8.0 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 / +3 Query: 26 CPPPAPSYPLATDWLLPPHPGRHQQL 103 CPPP P +PL W L RH+ L Sbjct: 69 CPPPVPCWPLRRRWPLRIMAERHKLL 146
>LOC_Os02g02730:12002.t00172:unspliced-genomic expressed protein| Length = 4318 Score = 31.8 bits (63), Expect = 8.0 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 / -3 Query: 76 REQPVGCKRIGRSGRRTPAPSPSP 5 R P G GRS RRT A +PSP Sbjct: 3902 RTAPAGTSTSGRSARRTAAAAPSP 3831
>LOC_Os01g51634:12001.t006911:unspliced-genomic myosin-2 heavy chain, non muscle, putative, expressed| Length = 5379 Score = 31.8 bits (63), Expect = 8.0 Identities = 16/76 (21%), Positives = 34/76 (44%) Frame = -3 / -1 Query: 922 RYNASIWLYTYNNSLSFPRARFLMLACTTIANIFSLQGCRRRMLHRSALTDQMIKCKQHQ 743 R+N + + + S S P A+ + C+T A ++ C+R+ + + I+ + Sbjct: 4494 RWNLDLSSFITDESTSLPFAKLIFPRCSTAATTRNIASCKRKCRLIKCIPSKTIQYFKGA 4315 Query: 742 SKKLLSSAGSPALRVA 695 K S + P + +A Sbjct: 4314 DFKTCSCSMMPTVSIA 4267
>LOC_Os01g34040:12001.t02969:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6035 Score = 31.8 bits (63), Expect = 8.0 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 / +1 Query: 8 RRRWSWCPPPAPSYPLATDW 67 +RR+SWC P SYP + W Sbjct: 5488 KRRFSWCTAPKRSYPPSFPW 5547
>LOC_Os01g19580:12001.t01748:unspliced-genomic hypothetical protein| Length = 2373 Score = 31.8 bits (63), Expect = 8.0 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 / -2 Query: 8 RRRWSWCPPPAPSYPLA 58 R RWSW PP+ S PLA Sbjct: 101 RPRWSWIRPPSTSQPLA 51
>LOC_Os01g64750:12001.t05842:unspliced-genomic sterol 3-beta-glucosyltransferase, putative, expressed| Length = 9942 Score = 25.4 bits (49), Expect(2) = 8.9 Identities = 17/45 (37%), Positives = 20/45 (44%) Frame = +1 / +2 Query: 499 IDSTYIQGSPAKIRLGNKSLVPGFEEGIRDMKPGGKRRLIIPPEL 633 I S Y SPA I N ++ PG E I M LI+ P L Sbjct: 3800 IGSVYDLLSPAFIDCINTAMPPGMENFIHHMFFFSYSELILSPAL 3934 Score = 23.1 bits (44), Expect(2) = 8.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 / +2 Query: 420 SWYRRLPEGWSAGYI 464 SWY LP GW + +I Sbjct: 3758 SWY*FLPVGW*SSHI 3802
>LOC_Os08g28930:12008.t02648:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6483 Score = 25.4 bits (49), Expect(2) = 9.2 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +3 / +1 Query: 747 CCLHLIIWSVSADRCSILLLQPCREKMLAIVVHANIRKRARGKERE 884 C I + S D C L L R AI+++ N+ R +ERE Sbjct: 1699 CYTQWIRSATSDDECFFLRLNSRRGSYCAILINNNMYISERIQERE 1836 Score = 23.1 bits (44), Expect(2) = 9.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 / +1 Query: 885 LLYVYSQMLALYRCHESHD 941 LL V+ L + CH HD Sbjct: 1948 LLEVFILALVFFPCHSQHD 2004
>LOC_Os01g03620:12001.t00253:unspliced-genomic copper ion binding protein, putative, expressed| Length = 2498 Score = 30.4 bits (60), Expect(2) = 9.4 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +3 / -2 Query: 420 SWYRRLPEGWSAG 458 SWY+RLP GW+ G Sbjct: 1309 SWYQRLPGGWTLG 1271 Score = 22.6 bits (43), Expect(2) = 9.4 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +3 / -2 Query: 921 RCHESHDVGAHWYLSPQKKKK 983 R H HD + + S KKKK Sbjct: 703 RHHRRHDQSTNLFSSVSKKKK 641
>LOC_Os04g37690:12004.t03339:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 4660 Score = 24.4 bits (47), Expect(2) = 9.4 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 / +2 Query: 5 RRRRWSWCPPPAPSYP 52 RRRR W PP P P Sbjct: 68 RRRRCRWRRPPPPPTP 115 Score = 24.0 bits (46), Expect(2) = 9.4 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / +2 Query: 29 PPPAPSYPLATDWLLPPHPGR 91 PPP P+ P PP P R Sbjct: 95 PPPPPTPPRRARAASPPSPSR 157
>LOC_Os03g25480:12003.t02246:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 3790 Score = 25.8 bits (50), Expect(2) = 9.6 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 / -1 Query: 2 GRRRRWSWCPPPAP 43 GRRR W PPP P Sbjct: 304 GRRRPWPRRPPPPP 263 Score = 22.6 bits (43), Expect(2) = 9.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / -1 Query: 29 PPPAPSYPLATDWLLPPHP 85 PPPAP+ A PP P Sbjct: 175 PPPAPATRTAPTTPTPPPP 119
>LOC_Os05g08480:12005.t00727:unspliced-genomic cytokinin-O-glucosyltransferase 1, putative, expressed| Length = 1876 Score = 29.0 bits (57), Expect(2) = 9.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 / +2 Query: 142 HPRHILDSSRGA*QLLMPSWMWREQP 65 HPR + +RG+ + L +W WR +P Sbjct: 149 HPRLLRP*NRGSQRALRTAWPWRRRP 226 Score = 23.5 bits (45), Expect(2) = 9.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -3 / +2 Query: 31 RTPAPSPSPP 2 RTP P+P PP Sbjct: 1181 RTPTPTPPPP 1210
>LOC_Os08g43500:12008.t04075:unspliced-genomic armadillo/beta-catenin-like repeat family protein, expressed| Length = 2540 Score = 24.4 bits (47), Expect(2) = 9.9 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +2 / +2 Query: 8 RRRWSWCPPPAPSYPLATDWLLPP 79 R RWS PP + P T PP Sbjct: 314 RPRWSASPPSSARPPAPTSTSAPP 385 Score = 24.0 bits (46), Expect(2) = 9.9 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 / +3 Query: 74 PPHPGRHQQ 100 PPHP RH+Q Sbjct: 384 PPHPRRHRQ 410 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 441,345,529 Number of extensions: 8464997 Number of successful extensions: 57754 Number of sequences better than 10.0: 143 Length of query: 328 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 278 Effective length of database: 52,799,986 Effective search space: 14678396108 Effective search space used: 14678396108 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
