ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf78m06 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os12g37390:12012.t03419:unspliced-genomic expressed protein| Length = 2279 Score = 36.3 bits (73), Expect = 0.080 Identities = 18/42 (42%), Positives = 22/42 (52%) Frame = +3 / -2 Query: 45 DESALPGLSPAVDPA*SRARSKPTRQRARDPDADGSVGRGRA 170 + S G + D SR+ S P RARDPD+ G V GRA Sbjct: 211 ESSTSSGRTTFDDDPISRSSSPPPSSRARDPDSRGGVDGGRA 86
>LOC_Os11g35150:12011.t04331:unspliced-genomic expressed protein| Length = 1291 Score = 25.4 bits (49), Expect(2) = 0.63 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 / -2 Query: 215 RLRPFSFSPVQSREESAPPP 156 RLRP S +P R PPP Sbjct: 273 RLRPGSAAPATRRRRLPPPP 214 Score = 25.4 bits (49), Expect(2) = 0.63 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 / -3 Query: 76 AGERPGKALSSTSNERDGARENR 8 AGER +A ++ +ER+G+R R Sbjct: 170 AGERGRRAEAAGGDEREGSRRRR 102
>LOC_Os03g11580:12003.t00959:unspliced-genomic expressed protein| Length = 5042 Score = 33.1 bits (66), Expect = 0.74 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -1 / +3 Query: 236 PGSITPTRLRPFSFSPVQSREESAPPP 156 PGS+ P RP SF+P + S+PPP Sbjct: 924 PGSLPPPPPRPPSFAPENALPPSSPPP 1004
>LOC_Os03g57840:12003.t05045:unspliced-genomic sterol-regulatory element binding protein site 2 protease| containing protein, expressed Length = 5346 Score = 32.2 bits (64), Expect = 1.4 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -1 / +2 Query: 236 PGSITPTRLRPFSFSPVQSREESAPPP 156 P ++P+RLRP + SP + SAPPP Sbjct: 14 PQLVSPSRLRPPTSSPQRPLLHSAPPP 94
>LOC_Os03g08070:12003.t00665:unspliced-genomic copper-transporting ATPase PAA1, putative, expressed| Length = 7119 Score = 32.2 bits (64), Expect = 1.4 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 / -3 Query: 197 FSPVQSREESAPPPH 153 FSP+Q R+E +PPPH Sbjct: 5005 FSPLQRRDEESPPPH 4961
>LOC_Os05g40450:12005.t03584:unspliced-genomic hypothetical protein| Length = 1215 Score = 25.4 bits (49), Expect(2) = 1.5 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +3 / +2 Query: 69 SPAVDPA*SRARSKPTR 119 SPA P S +RS+PTR Sbjct: 206 SPAAPPTPSASRSRPTR 256 Score = 24.0 bits (46), Expect(2) = 1.5 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 / +3 Query: 136 PTPMDPWGGGALSSLLWTGEKEKGRRRVGVMLPG 237 P P+ G G L G++ RRR +LPG Sbjct: 366 PLPLRVLGDGGRDPLFAAGKRGLPRRRHLPLLPG 467
>LOC_Os01g02520:12001.t00147:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2664 Score = 29.5 bits (58), Expect(2) = 1.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 / +2 Query: 242 FYKKESFFLTYFCTVIYFHKAQRL 313 FY K F+LTYF ++ F A + Sbjct: 650 FYPKSKFYLTYFVCLLVFSSASAM 721 Score = 22.1 bits (42), Expect(2) = 1.7 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 / +1 Query: 133 TPTPMDPWGGGA 168 TP P P GGGA Sbjct: 424 TPPPSPPRGGGA 459
>LOC_Os03g43970:12003.t03788:unspliced-genomic AAT1, putative, expressed| Length = 1435 Score = 27.6 bits (54), Expect(2) = 1.8 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -3 / +3 Query: 186 PEQGRERAPAPRIH 145 P QGR R P PR+H Sbjct: 291 PHQGRRRQPHPRLH 332 Score = 23.1 bits (44), Expect(2) = 1.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 / +3 Query: 85 GSTAGERPGKALSS 44 G+ G+RPG+AL S Sbjct: 522 GAVRGDRPGRALLS 563
>LOC_Os09g18159:12009.t01599:unspliced-genomic light repressible receptor protein kinase, putative, expressed| Length = 20467 Score = 31.8 bits (63), Expect = 1.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 / +2 Query: 230 CQGPFYKKESFFLTYFCTVIYFHKAQRLIC 319 C+G YK ++ FC V +FH ++ + C Sbjct: 2795 CKGQNYKNAGGCISEFCGVFFFHSSRTVAC 2884
>LOC_Os05g30030:12005.t02602:unspliced-genomic catalytic/ oxidoreductase, acting on NADH or NADPH, putative,| expressed Length = 3716 Score = 31.8 bits (63), Expect = 1.9 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 / +3 Query: 236 PGSITPTRLRPFSFSPVQSREESAPPPHGSI 144 P + +PT RP + SP S SAPPP S+ Sbjct: 414 PPAPSPTPARPRTSSPT*SSRPSAPPPDPSV 506
>LOC_Os05g04770:12005.t00371:unspliced-genomic F box protein family, putative| Length = 1184 Score = 31.8 bits (63), Expect = 1.9 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 / +2 Query: 51 SALPGLSPAVDPA*SRARSKPTRQRARDPDADG 149 SA PG A P + ARS PTR A P G Sbjct: 119 SASPGAGAASSPTATTARSSPTRSPASSPATTG 217
>LOC_Os08g16350:12008.t01508:unspliced-genomic expressed protein| Length = 3036 Score = 27.6 bits (54), Expect(2) = 2.6 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +1 / -2 Query: 136 PTPMDPWGGGALSSLLWTGEKEKGRRRV 219 P PMDP GG S G+ + RRR+ Sbjct: 248 PPPMDPGGGRPSSPDSSGGQPRRDRRRI 165 Score = 23.5 bits (45), Expect(2) = 2.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 / -3 Query: 114 TRQRARDPDADGSVG 158 TRQ R+PD D S G Sbjct: 2644 TRQHMREPDDDNSDG 2600
>LOC_Os09g20520:12009.t01786:unspliced-genomic carbohydrate transporter/ sugar porter/ transporter, putative| Length = 1582 Score = 28.6 bits (56), Expect(2) = 2.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 / -2 Query: 100 ALL*AGSTAGERPGKALSSTSNERDGARENR 8 A++ G GER + L + ERDGA+ R Sbjct: 258 AVVARGEVRGERVARGLHDGAGERDGAQRRR 166 Score = 21.7 bits (41), Expect(2) = 2.6 Identities = 11/34 (32%), Positives = 13/34 (38%) Frame = -1 / -3 Query: 236 PGSITPTRLRPFSFSPVQSREESAPPPHGSIGVG 135 PGS P R R SP + HG+ G Sbjct: 476 PGSAAPARRRSTPPSPPSASHHEKHVNHGAWHAG 375
>LOC_Os06g49260:12006.t04610:unspliced-genomic OsWAK65 - OsWAK receptor-like protein kinase| Length = 5620 Score = 31.3 bits (62), Expect = 2.6 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 / +1 Query: 133 TPTPMDPWGGGALSSLLWTGEKEKGRRRVGVMLP 234 +P P P A++ L++ G GR+RVG++LP Sbjct: 2311 SPPPPRPSPAVAVAILVYRGRAAGGRQRVGMLLP 2412
>LOC_Os04g06220:12004.t00501:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 5431 Score = 31.3 bits (62), Expect = 2.6 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +1 / -3 Query: 160 GGALSSLLWTGEKEKGRRRVGVMLPG 237 GG+ + +L GE+ +GRRR+G + G Sbjct: 491 GGSTAQILGRGEERRGRRRLGAAVHG 414
>LOC_Os03g63420:12003.t05559:unspliced-genomic OsGrx_S14 - glutaredoxin subgroup II, expressed| Length = 2212 Score = 31.3 bits (62), Expect = 2.6 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +3 / -2 Query: 84 PA*SRARSKPTRQRARDPDADGSVGRG 164 PA R R P R RAR DA+ GRG Sbjct: 258 PATPRRRKAPRRPRARRADAEAPCGRG 178
>LOC_Os07g48820:12007.t04510:unspliced-genomic transcription factor HBP-1b, putative, expressed| Length = 3985 Score = 27.6 bits (54), Expect(2) = 3.2 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 / -2 Query: 154 WGGGALSSLLWTGEKEKGRRRVGVMLPG 237 WGGG+ + W E G R G + G Sbjct: 93 WGGGSFEKVSWWWESGGGGEREGAKVGG 10 Score = 23.5 bits (45), Expect(2) = 3.2 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 / -1 Query: 19 SLHLSHCLLTRVLYPASPRP 78 SLHL CLL++V+ +P Sbjct: 3229 SLHLMQCLLSQVVRLTKMKP 3170
>LOC_Os01g32730:12001.t02845:unspliced-genomic FLU, putative, expressed| Length = 3912 Score = 30.9 bits (61), Expect = 3.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 / +1 Query: 224 *CCQGPFYKKESFFLTYFCTVIYFHKAQRLI 316 *CC+ P Y FFL +C + F +Q L+ Sbjct: 1183 *CCKIPLYSFALFFLK*YCIISIFSTSQSLL 1275
>LOC_Os11g47530:12011.t04249:unspliced-genomic xylanase inhibitor protein 2 precursor, putative, expressed| Length = 1161 Score = 30.4 bits (60), Expect = 5.0 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 / -2 Query: 13 FLSLHLSHCLLTRVLYPASPRP 78 + + HLSH L RV+ PASP P Sbjct: 803 YAAAHLSHDALWRVVQPASPPP 738
>LOC_Os09g02140:12009.t00115:unspliced-genomic expressed protein| Length = 5203 Score = 30.4 bits (60), Expect = 5.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 / -1 Query: 154 WGGGALSSLLWTGEKEKGRRR 216 WGGGA W G +++ RRR Sbjct: 367 WGGGAWGGSWWGGARQRERRR 305
>LOC_Os05g04750:12005.t00369:unspliced-genomic F-box domain containing protein, expressed| Length = 1799 Score = 30.4 bits (60), Expect = 5.0 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 / +2 Query: 51 SALPGLSPAVDPA*SRARSKPTRQRARDP 137 SA PG A P + ARS PTR A P Sbjct: 317 SASPGAGAASSPTATTARSSPTRSPASSP 403
>LOC_Os03g40720:12003.t03495:unspliced-genomic UDP-glucose 6-dehydrogenase, putative, expressed| Length = 15801 Score = 30.4 bits (60), Expect = 5.0 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 / -2 Query: 227 ITPTRLRPFSFSPVQSREESAPPPHGSIGVG 135 + PT R + VQSR E PP+G G G Sbjct: 13799 VAPTPARSHGGATVQSRGEQRRPPYGGAGGG 13707
>LOC_Os01g16200:12001.t01470:unspliced-genomic protein Z, putative| Length = 1272 Score = 30.4 bits (60), Expect = 5.0 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +3 / -3 Query: 84 PA*SRARSKPTRQRARDPDADGSVGRGRA 170 PA*+R R PTR+R R A G R A Sbjct: 400 PA*ARGRGPPTRRRRRTCSAGGGASRRAA 314
>LOC_Os10g30250:12010.t02359:unspliced-genomic transposon protein, putative, unclassified| Length = 3235 Score = 25.8 bits (50), Expect(2) = 6.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 / +3 Query: 242 FYKKESFFLTYFCTVIYFHKAQRL 313 F K SFFLT+F ++ F A + Sbjct: 1287 FLPKVSFFLTHFVRLLVFSSASAM 1358 Score = 24.0 bits (46), Expect(2) = 6.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 / +3 Query: 187 TGEKEKGRRRVGVMLPGS 240 +G+ + GRR G LPG+ Sbjct: 111 SGDSDAGRRAPGTRLPGA 164
>LOC_Os11g10160:12011.t00908:unspliced-genomic hypothetical protein| Length = 13171 Score = 29.9 bits (59), Expect = 6.8 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 / +1 Query: 154 WGGGALSSLLWTGEKEKGRRRVG 222 WGGG S W E+ + RRR G Sbjct: 11848 WGGGRGSGAAWAREERRRRRRGG 11916
>LOC_Os10g12354:12010.t01017:unspliced-genomic NUMOD3 motif family protein, expressed| Length = 9821 Score = 29.9 bits (59), Expect = 6.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 / +2 Query: 184 WTGEKEKGRRRVGVMLPGSFL*KRIIFSYLF 276 W + +GRR G++L + L K++ F+Y F Sbjct: 4940 WADQPRRGRRWDGMVLSRASLKKQVYFTYFF 5032
>LOC_Os09g29510:12009.t02629:unspliced-genomic OsWAK80 - OsWAK receptor-like protein kinase, expressed| Length = 4100 Score = 29.9 bits (59), Expect = 6.8 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 / +2 Query: 51 SALPGLSPAVDPA*SRARSKPTRQRARDPDADGSVGRGRA 170 SALP PA R R +P+R RA P A R R+ Sbjct: 50 SALPSRRRRPQPATCRRRWRPSRSRAARPSAAPWTSRSRS 169
>LOC_Os05g30280:12005.t02627:unspliced-genomic cyanogenic beta-glucosidase precursor, putative, expressed| Length = 5075 Score = 29.9 bits (59), Expect = 6.8 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +2 / +1 Query: 242 FYKKESFFLTYFCTVIYFH 298 FYKK+S+F+ Y + YFH Sbjct: 1609 FYKKKSWFVFYLSMLSYFH 1665
>LOC_Os05g14360:12005.t01210:unspliced-genomic expressed protein| Length = 1667 Score = 29.9 bits (59), Expect = 6.8 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 / -1 Query: 230 SITPTRLRPFSFSPVQSREESAPPPHG 150 +IT + PFS+SP+ + + +APP G Sbjct: 173 AITGPKSAPFSWSPLSTAQPAAPPSPG 93
>LOC_Os03g43330:12003.t03729:unspliced-genomic keratin, type I cytoskeletal 9, putative| Length = 2469 Score = 29.9 bits (59), Expect = 6.8 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 / -1 Query: 245 KKDPGSITPTRLRPFSFSPVQSREESAPPP 156 KK+P P+ P + +PV R S PPP Sbjct: 519 KKNPSPRRPSSPPPLATTPVPPRPSSPPPP 430
>LOC_Os03g27870:12003.t02460:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6486 Score = 29.9 bits (59), Expect = 6.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 / +3 Query: 230 SITPTRLRPFSFSPVQSREESAPPPH 153 ++TPT+ P S +P +APPPH Sbjct: 2568 NLTPTQPLPHSRTPTLPYTRTAPPPH 2645
>LOC_Os02g13170:12002.t01114:unspliced-genomic mitochondrial carrier protein, expressed| Length = 7536 Score = 29.9 bits (59), Expect = 6.8 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 / +3 Query: 227 CCQGPFYKKESFFLTYFCTVIYFHKAQRLI 316 C GPF KK + + FC YF RL+ Sbjct: 1863 CSAGPFRKKPTPIVRPFCAA*YFADISRLV 1952
>LOC_Os01g14690:12001.t01324:unspliced-genomic negatively light-regulated protein, putative, expressed| Length = 2734 Score = 29.9 bits (59), Expect = 6.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 / +3 Query: 242 KDPGSITPTRLRPFSFSPVQSREESAPPP 156 +DP ++P+ LR S + SR + PPP Sbjct: 30 RDPSPVSPSSLRQVSTPLLSSRVRAPPPP 116
>LOC_Os11g43680:12011.t03898:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3309 Score = 27.2 bits (53), Expect(2) = 8.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 / +2 Query: 242 FYKKESFFLTYFCTVIYFHKAQRL 313 FY K F+LT+F ++ F A + Sbjct: 1295 FYPKSKFYLTHFVCLLVFSSASAM 1366 Score = 22.1 bits (42), Expect(2) = 8.9 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 / +1 Query: 133 TPTPMDPWGGGA 168 TP P P GGGA Sbjct: 1069 TPPPSPPRGGGA 1104
>LOC_Os12g40290:12012.t03708:unspliced-genomic hypothetical protein| Length = 1107 Score = 29.5 bits (58), Expect = 9.4 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +3 / -3 Query: 51 SALPGLSPAVDPA*SRARSKPTRQRARDP 137 +A P LSPA A SR S TR+ AR+P Sbjct: 1054 AAPPSLSPAAAAARSRRSSCRTRRTARNP 968
>LOC_Os11g44030:12011.t03932:unspliced-genomic expressed protein| Length = 4183 Score = 29.5 bits (58), Expect = 9.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 / -1 Query: 242 FYKKESFFLTYFCTVIYFHKAQRLICKKKK 331 F KK FFL +FC ++ + KKKK Sbjct: 2086 FLKKMFFFLPFFCEKLFAS*TSNPVSKKKK 1997
>LOC_Os11g07500:12011.t00641:unspliced-genomic helicase C6F12.16c, putative, expressed| Length = 7124 Score = 29.5 bits (58), Expect = 9.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 / -3 Query: 96 RARSKPTRQRARDPDADGS 152 R S PTR RARDP GS Sbjct: 822 RLYSPPTRPRARDPSCSGS 766
>LOC_Os09g18010:12009.t01586:unspliced-genomic receptor-like protein kinase, putative| Length = 6685 Score = 29.5 bits (58), Expect = 9.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 / +1 Query: 259 IFSYLFLYCDLFP*STKTYL 318 +F YL +Y DLFP*S Y+ Sbjct: 1789 LFIYLAMYWDLFP*SLSVYI 1848
>LOC_Os07g08934:12007.t004672:unspliced-genomic expressed protein| Length = 857 Score = 29.5 bits (58), Expect = 9.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 / +2 Query: 157 GGGALSSLLWTGEKEKGRRRVGVMLP 234 GGGAL W G GR+R+ +LP Sbjct: 98 GGGALRRGRWKGRTRGGRQRLPSLLP 175
>LOC_Os06g42130:12006.t03904:unspliced-genomic leucoanthocyanidin dioxygenase, putative, expressed| Length = 1326 Score = 29.5 bits (58), Expect = 9.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 / +3 Query: 81 QRPGRGRVKHSRQQAMREMEREK 13 QRPG G RQQA R+ +RE+ Sbjct: 348 QRPGGGAAAGVRQQARRQRQREE 416
>LOC_Os06g37430:12006.t03438:unspliced-genomic expressed protein| Length = 4171 Score = 29.5 bits (58), Expect = 9.4 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +3 / -3 Query: 66 LSPAVDPA*SRARSKPTRQRARDPDADGSVGRGRALFP 179 +SP +A SKP+ A + DG GRGR P Sbjct: 881 ISPIASMVLPKATSKPSSIWATEQQTDGEYGRGRRRKP 768
>LOC_Os06g23290:12006.t02141:unspliced-genomic phosphatidylinositol 3- and 4-kinase family protein, expressed| Length = 2967 Score = 29.5 bits (58), Expect = 9.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 / -1 Query: 224 TPTRLRPFSFSPVQSREESAPPPH 153 TPT +P F+ +QS S PP H Sbjct: 354 TPTEPQPHRFTSLQSNPASTPPHH 283
>LOC_Os06g03220:12006.t00215:unspliced-genomic expressed protein| Length = 1499 Score = 29.5 bits (58), Expect = 9.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +1 / -3 Query: 259 IFSYLFLYCDLFP*STK 309 I+ Y+++YCDLF STK Sbjct: 453 IYIYIYIYCDLFLSSTK 403
>LOC_Os05g48390:12005.t04273:unspliced-genomic ubiquitin conjugating enzyme, putative, expressed| Length = 7946 Score = 29.5 bits (58), Expect = 9.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 / +2 Query: 266 LTYFCTVIYFHKAQRLICKKKKKI 337 L +FCTV+ KA +L KKK+ Sbjct: 1085 LRFFCTVVSIKKAPKLAIPSKKKL 1156
>LOC_Os05g15850:12005.t01356:unspliced-genomic xylanase inhibitor protein 2 precursor, putative, expressed| Length = 1149 Score = 29.5 bits (58), Expect = 9.4 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = -2 / +3 Query: 139 SGSLARWRVGFERALL*AGSTAGERPGKALSSTSNERDGAR 17 SGS RWR G A *+ ST G PG S + R R Sbjct: 648 SGSRRRWRRGSSAAST*SCSTTGGAPGAGESRWRSGRRRTR 770
>LOC_Os05g02890:12005.t00187:unspliced-genomic stigma/style ABC transporter, putative, expressed| Length = 2316 Score = 29.5 bits (58), Expect = 9.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 / +3 Query: 184 WTGEKEKGRRRVGVMLPGSFL 246 W E G R VGV+LPGS L Sbjct: 1998 WQVEVPAGHRGVGVLLPGSLL 2060
>LOC_Os02g33944:12002.t03035:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 8091 Score = 29.5 bits (58), Expect = 9.4 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 / -1 Query: 45 DESALPGLSPAVDPA*SRARSKPTRQRARDPDADGSVGRG 164 +E PG A++ A RSK R AR+ +G GRG Sbjct: 1773 EEGNRPGGPAAINGAGEICRSKSARLNARERGENGGKGRG 1654
>LOC_Os02g01250:12002.t00025:unspliced-genomic small nuclear ribonucleoprotein Sm D3, putative, expressed| Length = 2797 Score = 29.5 bits (58), Expect = 9.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 / +2 Query: 337 YFFFFFTNKSLCFMEINH 284 +FFFFF +KS C + NH Sbjct: 1292 FFFFFFFSKSRCRLMANH 1345
>LOC_Os01g70180:12001.t06319:unspliced-genomic secondary cell wall-related glycosyltransferase family 47, putative,| expressed Length = 3931 Score = 29.5 bits (58), Expect = 9.4 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -3 / +1 Query: 336 IFFFFLQISLCALWK*ITVQ 277 +FFF LQI C +WK ++++ Sbjct: 1378 LFFFNLQIRACEIWKFVSIK 1437
>LOC_Os01g27490:12001.t02452:unspliced-genomic leucoanthocyanidin dioxygenase, putative, expressed| Length = 1590 Score = 29.5 bits (58), Expect = 9.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 / +1 Query: 81 QRPGRGRVKHSRQQAMREMEREK 13 QRPG G RQQA R+ +RE+ Sbjct: 406 QRPGGGAAAGVRQQARRQRQREE 474
>LOC_Os01g18100:12001.t01605:unspliced-genomic rhomboid domain containing 1, putative, expressed| Length = 2763 Score = 29.5 bits (58), Expect = 9.4 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -2 / +3 Query: 145 SASGSLARWRVGFERALL*AGSTAGERPGKALSSTSNERDGAR 17 S G RW VGF + L +G G P + + R+ R Sbjct: 1815 SGIGKAVRWPVGFVQKLFRSGRPQGYTPSRGRVGRGSARENGR 1943 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 106,985,965 Number of extensions: 1402559 Number of successful extensions: 10336 Number of sequences better than 10.0: 51 Length of query: 112 Length of database: 55,613,886 Length adjustment: 46 Effective length of query: 66 Effective length of database: 53,025,098 Effective search space: 3499656468 Effective search space used: 3499656468 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
