| Clone Name | FLbaf78m06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q92075:SCNNA_CHICK Amiloride-sensitive sodium channel subunit al... | 28 | 9.7 | 2 | Q86W56:PARG_HUMAN Poly(ADP-ribose) glycohydrolase - Homo sapiens... | 28 | 9.7 |
|---|
>Q92075:SCNNA_CHICK Amiloride-sensitive sodium channel subunit alpha - Gallus gallus| (Chicken) Length = 637 Score = 28.1 bits (61), Expect = 9.7 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 242 FYKKESFFLTYFCTVIYFHKAQRLICKKKKKI 337 FY +FC+ H A RL+C KK K+ Sbjct: 43 FYGSYQDVFQFFCSNTTIHGAIRLVCSKKNKM 74
>Q86W56:PARG_HUMAN Poly(ADP-ribose) glycohydrolase - Homo sapiens (Human)| Length = 976 Score = 28.1 bits (61), Expect = 9.7 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 45 DESALPGLSPAVDPA*SRARSKPTRQRARDPDAD 146 DE PG D + S+ +KP+R +ARD D + Sbjct: 319 DEETSPGFDEQEDGSSSQTANKPSRFQARDADIE 352 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 46,891,128 Number of extensions: 817803 Number of successful extensions: 1876 Number of sequences better than 10.0: 2 Number of HSP's gapped: 1875 Number of HSP's successfully gapped: 2 Length of query: 112 Length of database: 100,686,439 Length adjustment: 80 Effective length of query: 32 Effective length of database: 78,742,839 Effective search space: 2519770848 Effective search space used: 2519770848 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)