| Clone Name | FLbaf72a01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P28955:TEGU_EHV1B Large tegument protein - Equine herpesvirus 1 ... | 33 | 4.8 | 2 | P05432:ERRFI_RAT ERBB receptor feedback inhibitor 1 - Rattus nor... | 33 | 8.1 | 3 | Q99JZ7:ERRFI_MOUSE ERBB receptor feedback inhibitor 1 - Mus musc... | 33 | 8.1 |
|---|
>P28955:TEGU_EHV1B Large tegument protein - Equine herpesvirus 1 (strain Ab4p) (EHV-1)| (Equine abortion virus) Length = 3421 Score = 33.5 bits (75), Expect = 4.8 Identities = 20/46 (43%), Positives = 24/46 (52%) Frame = +3 Query: 3 TLPSIPISLPKISMCRRPTPPLTTTAWPRCPAATTYAASHPPPFLP 140 TLP P LP+ + PP T P P +T+ AAS PPP LP Sbjct: 2548 TLPPAP-PLPQSTSKAASGPPPTLPPAPPLPQSTSKAASGPPPTLP 2592 Score = 33.5 bits (75), Expect = 4.8 Identities = 20/46 (43%), Positives = 24/46 (52%) Frame = +3 Query: 3 TLPSIPISLPKISMCRRPTPPLTTTAWPRCPAATTYAASHPPPFLP 140 TLP P LP+ + PP T P P +T+ AAS PPP LP Sbjct: 2569 TLPPAP-PLPQSTSKAASGPPPTLPPAPPLPQSTSKAASGPPPTLP 2613
>P05432:ERRFI_RAT ERBB receptor feedback inhibitor 1 - Rattus norvegicus (Rat)| Length = 459 Score = 32.7 bits (73), Expect = 8.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 1529 AEQNRPVHVEPKPPTSRSNQRQPTPHEL 1446 ++++RP V P+ P SRSN R P+P L Sbjct: 309 SDEDRPPKVPPREPLSRSNSRTPSPKSL 336
>Q99JZ7:ERRFI_MOUSE ERBB receptor feedback inhibitor 1 - Mus musculus (Mouse)| Length = 461 Score = 32.7 bits (73), Expect = 8.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -2 Query: 1529 AEQNRPVHVEPKPPTSRSNQRQPTPHEL 1446 ++++RP V P+ P SRSN R P+P L Sbjct: 310 SDEDRPPKVPPREPLSRSNSRTPSPKSL 337 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 420,545,738 Number of extensions: 8612729 Number of successful extensions: 20272 Number of sequences better than 10.0: 3 Number of HSP's gapped: 20247 Number of HSP's successfully gapped: 4 Length of query: 896 Length of database: 100,686,439 Length adjustment: 122 Effective length of query: 774 Effective length of database: 67,222,449 Effective search space: 52030175526 Effective search space used: 52030175526 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)