| Clone Name | FLbaf75d18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q4R657:TAF1B_MACFA TATA box-binding protein-associated factor RN... | 34 | 2.1 | 2 | Q53T94:TAF1B_HUMAN TATA box-binding protein-associated factor RN... | 33 | 3.5 |
|---|
>Q4R657:TAF1B_MACFA TATA box-binding protein-associated factor RNA polymerase I subunit| B - Macaca fascicularis (Crab eating macaque) (Cynomolgus monkey) Length = 588 Score = 34.3 bits (77), Expect = 2.1 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +1 Query: 772 LPVYSTLSVCFLACHIAREAILPTDIYRWAMEGRLPYVAAF 894 + V TL+ C+L+ REAI +D+ R+ E +PY+ AF Sbjct: 209 MTVPQTLAFCYLSLLWQREAITLSDLLRFVEEDHIPYINAF 249
>Q53T94:TAF1B_HUMAN TATA box-binding protein-associated factor RNA polymerase I subunit| B - Homo sapiens (Human) Length = 588 Score = 33.5 bits (75), Expect = 3.5 Identities = 15/36 (41%), Positives = 23/36 (63%) Frame = +1 Query: 787 TLSVCFLACHIAREAILPTDIYRWAMEGRLPYVAAF 894 TL+ C+L+ REAI +D+ R+ E +PY+ AF Sbjct: 214 TLAFCYLSLLWQREAITLSDLLRFVEEDHIPYINAF 249 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 370,342,254 Number of extensions: 8403973 Number of successful extensions: 23044 Number of sequences better than 10.0: 2 Number of HSP's gapped: 22996 Number of HSP's successfully gapped: 2 Length of query: 688 Length of database: 100,686,439 Length adjustment: 120 Effective length of query: 568 Effective length of database: 67,771,039 Effective search space: 38493950152 Effective search space used: 38493950152 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)