| Clone Name | FLbaf71k19 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g18604:12005.t004711:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass, expressed| Length = 33185 Score = 31.8 bits (63), Expect(3) = 0.003 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 / -2 Query: 189 LLAQFPVGALRSLALEPRQRCYRPSRATPRPPAGVA*RGRVVPLAG 326 L P+ A R + R+RC R RA+PR P+ + R P G Sbjct: 21958 LSTPIPIAAARRRSPAARRRCSRRRRASPRVPSALPSRAARRPPLG 21821 Score = 24.0 bits (46), Expect(3) = 0.003 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +1 / -2 Query: 13 TPPPINIGKSPLPIHGREPSTNPEAKSIP 99 T PP+ + SP P + P P + P Sbjct: 22162 TSPPMTLLPSPTPSREKPPPPPPRRRPTP 22076 Score = 22.1 bits (42), Expect(3) = 0.003 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +1 / -3 Query: 88 KSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 KSIPVA S+ S P L P RS P Sbjct: 22026 KSIPVASSSFFPVFPSPPRPLPSSPRRSPSP 21934
>LOC_Os11g04740:12011.t00367:unspliced-genomic L-Galactono-1,4-lactone dehydrogenase, putative, expressed| Length = 4473 Score = 35.4 bits (71), Expect(2) = 0.013 Identities = 21/67 (31%), Positives = 25/67 (37%) Frame = +1 / +1 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 S PPP + + GR P P + STP+ R S P PP R Sbjct: 103 SAAPPPPLPPTTTSTLSGRSPPRPRSRPPTPTSASTPATRSSSSAAAPPPTTPSRFPPTR 282 Query: 187 SCWRSSP 207 S R SP Sbjct: 283 STRRPSP 303 Score = 24.4 bits (47), Expect(2) = 0.013 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 / +2 Query: 258 PSRATPRPPAGVA*RGRVVPLA 323 P+R PRPP R R VP A Sbjct: 386 PARLPPRPPRRARRRPRRVPQA 451
>LOC_Os03g42320:12003.t03639:unspliced-genomic SEC1-family transport protein SLY1, putative, expressed| Length = 2350 Score = 40.9 bits (83), Expect = 0.035 Identities = 19/57 (33%), Positives = 22/57 (38%) Frame = +1 / +1 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 SPTPPP P P P T P A + P ++P G PPP P Sbjct: 430 SPTPPPSTCSAPPPPTSTASPPTPPRASTPPSTSTSPPASRGPSSSASPPPPPPPAP 600
>LOC_Os12g35710:12012.t03259:unspliced-genomic extensin-like protein, putative, expressed| Length = 2620 Score = 40.5 bits (82), Expect = 0.048 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = +1 / +1 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPP 165 PPP+ P P+H P P PV P L+ P ++ PPP Sbjct: 1753 PPPVKPPPPPAPVHSPPPPVKPPPPPAPVHSPPPPLKSPPPPAPVSSPPP 1902 Score = 39.1 bits (79), Expect = 0.12 Identities = 20/67 (29%), Positives = 25/67 (37%) Frame = +1 / +1 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 S PPP+ P P+H P P PV P ++ P + PPP P Sbjct: 1696 SSPPPPVKSPPPPAPVHSPPPPVKPPPPPAPVHSPPPPVKPPPPPAPVHSPPPPLKSPPP 1875 Query: 187 SCWRSSP 207 SSP Sbjct: 1876 PAPVSSP 1896 Score = 38.2 bits (77), Expect = 0.23 Identities = 17/53 (32%), Positives = 21/53 (39%) Frame = +1 / +1 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPP 165 S PPP+ P PIH P PV P +R P ++ PPP Sbjct: 1552 SSPPPPVKSPPPPAPIHSPPPPVKSPPPPAPVYSPPPLVRSPPPPAPVSSPPP 1710 Score = 36.3 bits (73), Expect = 0.84 Identities = 15/55 (27%), Positives = 22/55 (40%) Frame = +1 / +1 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 PPP+ P P++ P PV+ P ++ P + PPP PP Sbjct: 1609 PPPVKSPPPPAPVYSPPPLVRSPPPPAPVSSPPPPVKSPPPPAPVHSPPPPVKPP 1773 Score = 35.4 bits (71), Expect = 1.6 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = +1 / +1 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPP 165 PPP+ P P+H P PV+ P ++ P + PPP Sbjct: 1801 PPPVKPPPPPAPVHSPPPPLKSPPPPAPVSSPPPLIKSPPPPAPVISPPP 1950 Score = 34.1 bits (68), Expect = 4.1 Identities = 17/64 (26%), Positives = 23/64 (35%) Frame = +1 / +1 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSCW 195 PPP+ P P+ P PV+ P + P ++ PPP P Sbjct: 1945 PPPVKFPPPPAPVSSPPPPVKSPPPPAPVSSPPPPMESPPPPAPVSSPPPPVKSPPPPAP 2124 Query: 196 RSSP 207 SSP Sbjct: 2125 VSSP 2136 Score = 33.6 bits (67), Expect = 5.6 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = +1 / +1 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPP 165 S PPP+ P P+ P PV+ P ++ P ++ PPP Sbjct: 1984 SSPPPPVKSPPPPAPVSSPPPPMESPPPPAPVSSPPPPVKSPPPPAPVSSPPP 2142
>LOC_Os01g32120:12001.t02791:unspliced-genomic calmodulin, putative, expressed| Length = 1021 Score = 39.6 bits (80), Expect = 0.090 Identities = 21/67 (31%), Positives = 26/67 (38%) Frame = +1 / +3 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 +PTP P SP PS++ A P S S + + PPP S PW Sbjct: 456 APTPTPTASSSSPSSSPSSRPSSSTTAPPTPRTRSAASSTSSTATATASSPPPSSPTPWP 635 Query: 187 SCWRSSP 207 S SP Sbjct: 636 SSATRSP 656
>LOC_Os07g09470:12007.t00821:unspliced-genomic cell Division Protein AAA ATPase family, putative, expressed| Length = 1891 Score = 39.1 bits (79), Expect(2) = 0.11 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +1 / -1 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRS 171 SP PPP + PLP +PS +P ++ P P L +P L PPP S Sbjct: 1603 SPLPPPRLRLRPPLPWLWPKPSPSPSPRTPPWPSPRPPLSPSPRPPPLPSPPPSS 1439 Score = 23.1 bits (44), Expect(2) = 0.11 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 / -3 Query: 1592 RPRYWTARPDLTRWSTIST 1648 RPR +A L+RW ++T Sbjct: 1217 RPRRMSAGSSLSRWLVVNT 1161
>LOC_Os03g24730:12003.t02165:unspliced-genomic expressed protein| Length = 3609 Score = 31.3 bits (62), Expect(2) = 0.11 Identities = 17/57 (29%), Positives = 23/57 (40%) Frame = +1 / -1 Query: 139 P*ELAEPPPRSVPPWRSCWRSSPLELSDRWRLSHDNGATVHPGRPRGHLRVWHSAAE 309 P L PPP PPW S + L ++ R R + + P P + H A E Sbjct: 567 PPPLPRPPPPPPPPWYSAISTWMLGVASRPRFVEPSSSLDSPATPFLYFMANHLAGE 397 Score = 25.4 bits (49), Expect(2) = 0.11 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 / -1 Query: 1 GGSPTPPPINIGKSPLPIHG 60 GGS PPP+ PLP+ G Sbjct: 666 GGSRPPPPLPELPCPLPLPG 607
>LOC_Os04g31320:12004.t02815:unspliced-genomic SWI/SNF-related matrix-associated actin-dependent regulator of| chromatin subfamily D member 3, putative, expressed Length = 2595 Score = 33.1 bits (66), Expect(2) = 0.11 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +1 / +3 Query: 55 HGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 HG PE + P A P+ G P + A PPP + P Sbjct: 381 HGHRRQPQPELHADPSAAPAPAAAAGRLPGDPARPPPPAFP 503 Score = 23.5 bits (45), Expect(2) = 0.11 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +1 / +2 Query: 157 PPPRSVPPWRSCWRSSPLELSDRWRL 234 P P + P RS W +P + W L Sbjct: 536 PRPSTTRPSRSTWAPTPRRRTRLWPL 613
>LOC_Os09g28180:12009.t02496:unspliced-genomic D-mannose binding lectin family protein, expressed| Length = 3467 Score = 39.1 bits (79), Expect = 0.12 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = -2 / +1 Query: 1445 IHPPPESCPGWPLCPHDTCHRRGQTKLSQTGTPGS 1341 I PP CPG P TC RR +S GT GS Sbjct: 592 ITPPTRCCPGSSCSPEHTCRRRRALPISPRGTTGS 696
>LOC_Os10g33310:12010.t02633:unspliced-genomic cyclin-dependent kinase inhibitor 1, putative, expressed| Length = 3559 Score = 32.7 bits (65), Expect(2) = 0.15 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 / +2 Query: 100 VALSTPSLRLGSQP*ELAEPPPRSVPPWRS 189 +A + P L+ S P LA PP S PPW S Sbjct: 65 LAANAPRLKSLSAPETLAPSPPESRPPWAS 154 Score = 23.5 bits (45), Expect(2) = 0.15 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 / +2 Query: 78 SRSQIHPRSPFH 113 S QIHP SP+H Sbjct: 14 STLQIHPGSPYH 49
>LOC_Os07g28030:12007.t02494:unspliced-genomic hypothetical protein| Length = 2250 Score = 31.3 bits (62), Expect(2) = 0.15 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +1 / -3 Query: 67 PSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 P + PE+ S +LS PS P PPP S PP Sbjct: 352 PLSPPESSSRRRSLSPPSPPSSGPPPSSPRPPPTSAPP 239 Score = 24.9 bits (48), Expect(2) = 0.15 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 / -3 Query: 160 PPRSVPPWRSCWRSSPLELSDRW 228 P R +PP RS + SSP + W Sbjct: 148 PRRRLPPLRSPFPSSPSTRGEPW 80
>LOC_Os05g50290:12005.t04461:unspliced-genomic DNA-3-methyladenine glycosylase 1, putative, expressed| Length = 1481 Score = 29.5 bits (58), Expect(2) = 0.16 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 / +1 Query: 216 LRSLALEPRQRCYRPSRATPRP 281 L L L PR+R RP R PRP Sbjct: 475 LLPLPLPPRRRAQRPPRGRPRP 540 Score = 26.7 bits (52), Expect(2) = 0.16 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +1 / +3 Query: 73 TNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 T P S A STPS S + PPP S P Sbjct: 378 TTPRPSSARTAPSTPSSDPSSTSSSPSRPPPPSTP 482
>LOC_Os04g33540:12004.t03030:unspliced-genomic hypothetical protein| Length = 882 Score = 29.9 bits (59), Expect(3) = 0.17 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 / -2 Query: 93 HPRSPFHSLSSSWKSTLGASGATA 164 HPR+ F LSSS K+T G+S T+ Sbjct: 881 HPRNCFAPLSSSKKTTQGSSAETS 810 Score = 26.3 bits (51), Expect(3) = 0.17 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 / -2 Query: 219 RSLALEPRQRCYRPSRATPRPPAGVA*R 302 R L+ R+RC R A P PPA + R Sbjct: 629 REATLQRRERCSRR*GAPPWPPAAASDR 546 Score = 23.1 bits (44), Expect(3) = 0.17 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 / -1 Query: 1402 GHRGHPGQDSGGG*MPVV 1455 G +G G+D GGG P++ Sbjct: 399 GGKGAAGEDMGGGARPLL 346
>LOC_Os12g23374:12012.t02068:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3808 Score = 38.6 bits (78), Expect = 0.17 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +2 / +1 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HLC NLFE*PRPR W +R Sbjct: 211 HLCSEYNLFE*PRPRLWASR 270
>LOC_Os07g32710:12007.t02953:unspliced-genomic expressed protein| Length = 1402 Score = 38.2 bits (77), Expect = 0.23 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 / +3 Query: 118 REWKGLRGWIWLRDWWRALGHGWE 47 R W+ R W+W R WWRA W+ Sbjct: 492 RAWRWRRWWLWRRRWWRAWWWRWQ 563
>LOC_Os01g23890:12001.t02114:unspliced-genomic hypothetical protein| Length = 1059 Score = 38.2 bits (77), Expect = 0.23 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +1 / -3 Query: 157 PPPRSVPPWRSCWRSSPLELSDRWR 231 P PR +PP R CWR P RWR Sbjct: 565 PRPRRIPPRRGCWRPPPPPPPHRWR 491
>LOC_Os09g34330:12009.t03009:unspliced-genomic transcription factor AtMYC2, putative| Length = 855 Score = 24.4 bits (47), Expect(3) = 0.30 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +1 / +2 Query: 151 AEPPPRSVPPWR 186 A PPP S PWR Sbjct: 584 AAPPPGSTRPWR 619 Score = 24.4 bits (47), Expect(3) = 0.30 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +1 / +3 Query: 268 RPRGHLRVWHSAAESSHSPVGPQVQEVDRQGATQGPLCLCPVVA 399 R G RV H+ H P GP+ + G + P P A Sbjct: 714 RAAGAARVRHARPRRHHRPGGPRRRPRRAPGRRRPPRRAAPAAA 845 Score = 22.1 bits (42), Expect(3) = 0.30 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 / +2 Query: 7 SPTPPPINIGKSP 45 SPTPPP + +P Sbjct: 437 SPTPPPTSPSSAP 475
>LOC_Os08g02900:12008.t00184:unspliced-genomic expressed protein| Length = 2824 Score = 37.7 bits (76), Expect = 0.32 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 / +2 Query: 6 KPNPSSNQHRKVPSSHPWPRALHQSRSQIHPRSPFHSLS 122 + NP+ N R P H PR + R +HP SP +S S Sbjct: 896 RSNPAHNGRRTRPHRHRHPRRRRRRRHHLHPYSPLYSTS 1012
>LOC_Os02g58720:12002.t05442:unspliced-genomic peroxidase 64 precursor, putative, expressed| Length = 1837 Score = 37.7 bits (76), Expect = 0.32 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +1 / -1 Query: 130 GSQP*ELAEPPPRSVPPWRSCWRSSP 207 G P + PPP PPW S WRSSP Sbjct: 691 GLWPWPASPPPPPPPPPWGSSWRSSP 614
>LOC_Os10g18026:12010.t01357:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3848 Score = 28.6 bits (56), Expect(2) = 0.36 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 / -2 Query: 109 STPSLRLGSQP*ELAEPPPRSVPP 180 S PSLRL + P* + PPP S P Sbjct: 700 SWPSLRLCNAP*ASSSPPPASPRP 629 Score = 26.3 bits (51), Expect(2) = 0.36 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 / -2 Query: 163 PRSVPPWRSCWRSSP 207 P S PP CWR P Sbjct: 583 PSSAPPCLPCWRDQP 539
>LOC_Os06g47570:12006.t04443:unspliced-genomic expressed protein| Length = 2976 Score = 31.8 bits (63), Expect(2) = 0.37 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +3 / +2 Query: 45 SSHPWPRALHQSRSQIHPRSPFHSLSSSWKSTLGASGATAALRSA 179 +S PWPR +HP P S SS S+ +G AA SA Sbjct: 8 ASRPWPRPPPPPPPPLHPPPPRTSSRSSAASSPPVAGTRAARTSA 142 Score = 23.1 bits (44), Expect(2) = 0.37 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 / +3 Query: 160 PPRSVPPWRSCWRSSP 207 PPR VPP R R +P Sbjct: 243 PPRWVPPHRRLPRGAP 290
>LOC_Os07g23190:12007.t02020:unspliced-genomic lysine ketoglutarate reductase trans-splicing related 1, putative| Length = 1173 Score = 28.6 bits (56), Expect(3) = 0.37 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -3 / -3 Query: 247 RCRGSSASDRRAPTGNCASKTSMAERSAAVAP 152 R R + +RRAP CA T+ + +AA +P Sbjct: 97 RRRRTGGRERRAPPPTCAEWTASSAAAAATSP 2 Score = 25.8 bits (50), Expect(3) = 0.37 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -2 / -2 Query: 1442 HPPPESCPGWPLC 1404 HPPP G PLC Sbjct: 1037 HPPPPPSEGMPLC 999 Score = 24.4 bits (47), Expect(3) = 0.37 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 / -3 Query: 350 STSCTCGPTGEWDDSAALCHTRRWPRGR 267 S +C+ GPT D SA PRGR Sbjct: 940 SRACSRGPTRGRDRSAPCPRCTATPRGR 857
>LOC_Os02g57850:12002.t05356:unspliced-genomic hypothetical protein| Length = 1024 Score = 30.9 bits (61), Expect(2) = 0.39 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +1 / +1 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 P+PPP + P P+ +P+T + P +T S+ + PP PP Sbjct: 154 PSPPPRSPTAKPCPLPFDQPTTRGSPSAWPSTTATSPSPTTSRRCSTSPTPPTPPPP 324 Score = 24.0 bits (46), Expect(2) = 0.39 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 / +1 Query: 157 PPPRSVPPWRSCWRSSPL 210 PPP S PP R+ SPL Sbjct: 331 PPPPSSPPPRTRMTPSPL 384
>LOC_Os02g45760:12002.t04163:unspliced-genomic chitin-inducible gibberellin-responsive protein 2, putative,| expressed Length = 2177 Score = 37.3 bits (75), Expect = 0.44 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 / +1 Query: 99 RSPFHSLSSSWKSTLGASGATAALRSAMEVLLAQFPVGALRSLALEP 239 R P S SW+S+ A+ + A+ L++Q P+GA RS L P Sbjct: 541 RRPNWSCCKSWRSSCWATTRRRTRQGAVAALVSQAPIGATRSRGLTP 681
>LOC_Os05g16400:12005.t01410:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6320 Score = 37.3 bits (75), Expect = 0.44 Identities = 18/56 (32%), Positives = 22/56 (39%) Frame = +1 / +1 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 P PPP++ P P H P P + S P P + P PPPR P Sbjct: 2749 PAPPPLSPSHPPPPRHPAAPPAPPPSPSYPPRPHHPPMPPTPLPSPSRPPPPRRPP 2916
>LOC_Os02g24720:12002.t02169:unspliced-genomic nonspecific lipid-transfer protein 5 precursor, putative| Length = 1921 Score = 37.3 bits (75), Expect = 0.44 Identities = 18/47 (38%), Positives = 23/47 (48%) Frame = +1 / -2 Query: 40 SPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 SP P R PS P + VA +TPS R +P + PP + PP Sbjct: 1311 SPPPCADRRPSLAPSLRLAAVAAATPSARAHRRPSLRSLTPPPAAPP 1171
>LOC_Os05g19750:12005.t01741:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6295 Score = 31.3 bits (62), Expect(3) = 0.51 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 / -2 Query: 1574 NLFE*PRPRYWTAR 1615 NLFE*PRPR W +R Sbjct: 3306 NLFE*PRPRLWASR 3265 Score = 26.7 bits (52), Expect(3) = 0.51 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 / -2 Query: 109 STPSLRLGSQP*ELAEPPPRSVPP 180 S+PS R +P PPP +PP Sbjct: 5355 SSPSSRRSRRPARALAPPPPRIPP 5284 Score = 24.9 bits (48), Expect(3) = 0.51 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 / -3 Query: 160 PPRSVPPWRSCWRSSPLELSDRW 228 P R +PP RS + SSP + W Sbjct: 4829 PRRRLPPLRSPFPSSPSTRGEPW 4761
>LOC_Os06g16060:12006.t01479:unspliced-genomic RING-H2 finger protein ATL5G, putative, expressed| Length = 622 Score = 29.9 bits (59), Expect(2) = 0.55 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 / -3 Query: 219 RSLALEPRQRCYRPSRATPRPPAG 290 R+ A R+RC RP+ A RPP G Sbjct: 176 RAAAPRRRRRCGRPASARRRPPGG 105 Score = 24.4 bits (47), Expect(2) = 0.55 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 / -2 Query: 157 PPPRSVPPWRSCWRSSPLELSDR 225 PPPR+ PP+ S R S R Sbjct: 258 PPPRAPPPFPSAARPGAASSSPR 190
>LOC_Os07g41750:12007.t03830:unspliced-genomic 40S ribosomal protein S3-A, putative, expressed| Length = 2275 Score = 36.3 bits (73), Expect(2) = 0.57 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -2 / +1 Query: 1463 SHRTTGIHPPPESCPGWPLCPHDTCHRRGQTKLSQTGTPG 1344 SH + G HPPP P P P T H G + Q G Sbjct: 1 SHPSLGFHPPPPPPPPPPSSPTSTLHSNGDSHADQQEAQG 120 Score = 23.5 bits (45), Expect(2) = 0.57 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -2 / +2 Query: 1319 GYCRLPG*GSACA*PSVSGGI 1257 GYC *GSAC V G I Sbjct: 1580 GYCEWEA*GSAC*IHEVQGRI 1642
>LOC_Os01g27440:12001.t02447:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6304 Score = 32.2 bits (64), Expect(2) = 0.57 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 / +1 Query: 60 PRALHQSRSQIHPRSPFHSLSSSWK 134 P+ LH SR ++ PRSP H + + K Sbjct: 784 PKPLHHSRQRLRPRSPLHKSTPTSK 858 Score = 29.0 bits (57), Expect(2) = 0.57 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +1 / +1 Query: 190 CWRSSPLELSDRWRLSHDNGATVH 261 C+ +SPL +WR+ + G+ H Sbjct: 5218 CFAASPLPKEKKWRIKYTRGSAAH 5289
>LOC_Os07g41410:12007.t03796:unspliced-genomic EGG APPARATUS-1 protein, putative, expressed| Length = 719 Score = 36.8 bits (74), Expect = 0.61 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = -2 / +1 Query: 371 PWVAPWRSTSCTCGPTGEWDDSAALCHTRRWPRGRPGW 258 PW PWR P G + +RRWP P W Sbjct: 148 PWPPPWRRRPSRASPRGSAS*RSRAWGSRRWPSAGPPW 261
>LOC_Os01g02930:12001.t00185:unspliced-genomic glycosyltransferase, putative, expressed| Length = 3192 Score = 36.8 bits (74), Expect = 0.61 Identities = 19/58 (32%), Positives = 22/58 (37%) Frame = +1 / -2 Query: 4 GSPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 GSP PPP +S R PS + S P S P PPPR+ P Sbjct: 2636 GSPPPPPAGTPRSSARRRARPPSRRTRSPSSPPPPPARRTAATSPPPRTPPPPPRAPP 2463
>LOC_Os04g47270:12004.t04254:unspliced-genomic flowering locus D, putative, expressed| Length = 3244 Score = 33.1 bits (66), Expect(2) = 0.78 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +1 / +1 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPP 165 PPP++ P P P++ + P +PSLRL A PPP Sbjct: 157 PPPLSSPTPPSPTSASAPASAASSPPAPPPRPSPSLRLLPPSRRPAPPPP 306 Score = 26.7 bits (52), Expect(2) = 0.78 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +1 / +2 Query: 1405 HRGHPGQDSGGG 1440 HR PG DSGGG Sbjct: 314 HRDQPGADSGGG 349
>LOC_Os08g08060:12008.t00692:unspliced-genomic vacuolar protein sorting 18, putative, expressed| Length = 9742 Score = 36.3 bits (73), Expect = 0.83 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = +3 / -3 Query: 30 HRKVPSSHPWPRALHQSRSQIHPRSPFHSLSSSWKSTLGASGATAALRSAMEVLLAQFPV 209 H P S PW H++ Q+H + HS + T+ + + + S+ V++ +F Sbjct: 713 HPLSPGSPPWSTLQHRNHKQLHNQEQIHSTDCRNRDTIRSRNSICSSISSPSVMVWRFHA 534 Query: 210 GAL 218 AL Sbjct: 533 TAL 525
>LOC_Os12g09600:12012.t00839:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2433 Score = 36.3 bits (73), Expect = 0.84 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +1 / -1 Query: 157 PPPRSVPPWRSCWRSSPLELSDRWRLSHDNGATVHPGRPR 276 PP R+ PPWR+ R +P + R L D T R R Sbjct: 1071 PPARARPPWRAVARPTPSDRCRRTNLDDDKAGTTSAARNR 952
>LOC_Os06g20200:12006.t01837:unspliced-genomic gibberellin receptor GID1L2, putative, expressed| Length = 1737 Score = 36.3 bits (73), Expect = 0.84 Identities = 18/67 (26%), Positives = 26/67 (38%) Frame = +1 / +3 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 S PP + + G PS++P + P + +P +P PPP S Sbjct: 426 SRRPPARSTPTAARSAPGSAPSSSPSTTASPPSTGSPPRTTTGRPSSATSPPPASATSTA 605 Query: 187 SCWRSSP 207 S W S P Sbjct: 606 SPWTSPP 626
>LOC_Os06g13230:12006.t01198:unspliced-genomic expressed protein| Length = 2073 Score = 36.3 bits (73), Expect = 0.84 Identities = 20/63 (31%), Positives = 27/63 (42%) Frame = +1 / -2 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSCW 195 PPP I + PS A + P A + PS + S+ +L PPP + R W Sbjct: 869 PPPSQIVATANAAAASSPSAAKAASNRPDAAAMPSAAVTSRHCQLPRPPPPATLQIRPRW 690 Query: 196 RSS 204 R S Sbjct: 689 RGS 681
>LOC_Os05g07440:12005.t00628:unspliced-genomic expressed protein| Length = 713 Score = 36.3 bits (73), Expect = 0.84 Identities = 22/67 (32%), Positives = 26/67 (38%) Frame = +1 / -3 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 +P PPP+ P P R P + P P PS S PP R+ PP Sbjct: 630 APPPPPLPSRAPPSPPPLRAPPSPPPPYRTPPPPLPPSPTAASPRPSPPPPPSRAPPPPA 451 Query: 187 SCWRSSP 207 S R SP Sbjct: 450 SSTRPSP 430
>LOC_Os04g04030:12004.t00291:unspliced-genomic conserved hypothetical protein| Length = 3318 Score = 36.3 bits (73), Expect = 0.84 Identities = 22/56 (39%), Positives = 23/56 (41%) Frame = +1 / +2 Query: 157 PPPRSVPPWRSCWRSSPLELSDRWRLSHDNGATVHPGRPRGHLRVWHSAAESSHSP 324 PPPR P S SSPL S R R A RG R W S A S +P Sbjct: 20 PPPRPPLPSSSAAASSPLSHSPRRRRRRPTRARGSGSVARGRSRFWGSPAPSPPAP 187
>LOC_Os03g06080:12003.t00479:unspliced-genomic farnesylated protein 1, putative, expressed| Length = 1053 Score = 36.3 bits (73), Expect = 0.84 Identities = 19/52 (36%), Positives = 21/52 (40%) Frame = +1 / -3 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPP 162 +P PPP SP P P S P LS PS R P E + PP Sbjct: 547 APPPPPAPRNPSPSPCSASRPPPRCSRPSSPPLLSGPSSRTLRSPSEPSPPP 392
>LOC_Os08g07730:12008.t00662:unspliced-genomic transferase family protein, expressed| Length = 3882 Score = 31.3 bits (62), Expect(2) = 0.91 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -3 / +2 Query: 265 RDGR*HRCRGSSASDRRAPTGNCASKTSMAERSAAVA 155 R R CR S AS RRAP+ TS + +AA A Sbjct: 3344 RSRRWRGCRSSGASTRRAPSPPATRCTSSSSSTAAAA 3454 Score = 28.6 bits (56), Expect(2) = 0.91 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -2 / +3 Query: 350 STSCTCGPTGEWDDSAALCHTRRWPRGRPGWTVA 249 +T+ C + + RRWPR PGW A Sbjct: 510 TTTWRCWSSSRRCSTPTRSRRRRWPRR*PGWAAA 611
>LOC_Os02g38290:12002.t03467:unspliced-genomic cytochrome P450 94A2, putative, expressed| Length = 2191 Score = 27.6 bits (54), Expect(2) = 0.91 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 / +1 Query: 247 RCRGSSASDRRAPTGNCASKTSMAERS 167 R RG++ R P+G CA+ S A R+ Sbjct: 1318 RRRGATTRPRSGPSGGCAAARSPAARA 1398 Score = 25.8 bits (50), Expect(2) = 0.91 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 / +2 Query: 360 ALAIDLLHLRSDRRVGRLGR 301 A A DLLHLR R G +GR Sbjct: 1274 AAARDLLHLRDRARPGVVGR 1333
>LOC_Os02g02340:12002.t00133:unspliced-genomic glycerol-3-phosphate acyltransferase 8, putative, expressed| Length = 2863 Score = 29.9 bits (59), Expect(2) = 0.93 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -1 / +3 Query: 1503 TSVAPTKPASPMTLSSYHRHSSSPGVLPWVAPVSS*HLPP 1384 TS +P P SP + SS +S PW AP PP Sbjct: 309 TSASPRPPPSPCSCSSRSPGCASATSRPWRAPCCRATTPP 428 Score = 29.5 bits (58), Expect(2) = 0.93 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -2 / +3 Query: 371 PWVAPWRSTSCT 336 PW +PWRS++C+ Sbjct: 1872 PWASPWRSSACS 1907
>LOC_Os07g46910:12007.t04327:unspliced-genomic sex determination protein tasselseed-2, putative, expressed| Length = 1419 Score = 29.0 bits (57), Expect(2) = 0.94 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 / -3 Query: 395 TTGQRQRGPWVAPWRS 348 +TGQ PW PWRS Sbjct: 1006 STGQLPSAPWTPPWRS 959 Score = 24.4 bits (47), Expect(2) = 0.94 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -2 / -3 Query: 326 TGEWDDSAALCHTRRWPRGRPGWTVAPLSWLKRQRSESSNG 204 T W A +R P+G WT A R+RS + G Sbjct: 976 TPPWRS*APRSSSRGRPQGPAPWTAASRRRTARRRSPARRG 854
>LOC_Os04g06470:12004.t00521:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4462 Score = 32.7 bits (65), Expect(2) = 1.0 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 / -1 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR W +R Sbjct: 2599 HL*SEYNLFE*PRPRLWASR 2540 Score = 27.2 bits (53), Expect(2) = 1.0 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 / -3 Query: 152 RSHRRAPFRHGGLAGAVPRWSSPIAGA 232 R RRAPFR +G +P +SP + + Sbjct: 4301 RRRRRAPFRRRRRSGPLPDSASPFSAS 4221
>LOC_Os11g12000:12011.t01087:unspliced-genomic NBS-LRR disease resistance protein, putative, expressed| Length = 12653 Score = 35.4 bits (71), Expect(2) = 1.0 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = -3 / -1 Query: 559 HPKLCPSTLSKLESVI*KYASTNPSQRADWSTPT 458 HP S+ +++ +VI + AST+P+ +W TPT Sbjct: 917 HPSQAASSTARVHAVIGRRASTSPTVVGEWCTPT 816 Score = 25.8 bits (50), Expect(2) = 1.0 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -2 / -1 Query: 1847 NY*SKYDKINHIK*IIYTPNILMIESESDPNPIQLMWSSDHSSHSHPMANISSS 1686 N+*+KY K*+ + L I S+ P+ S+H HP SS+ Sbjct: 1052 NF*TKYGATCQAK*VAKSFTWLAISSKLKPHAYHGSHHPTFSTHLHPSQAASST 891
>LOC_Os11g29400:12011.t02545:unspliced-genomic 6-phosphogluconate dehydrogenase, decarboxylating, putative,| expressed Length = 1892 Score = 31.3 bits (62), Expect(3) = 1.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 / +1 Query: 1437 RMNAGGTMRESWVRQVLLEQRWSTRM 1514 R GG R SW+R + + RW TR+ Sbjct: 790 RSGTGGNWRVSWLRLLPIYSRWPTRL 867 Score = 24.0 bits (46), Expect(3) = 1.1 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 / +1 Query: 118 SLRLGSQP*ELAEPPPRSVPP 180 S R S+ PPPRS PP Sbjct: 190 SPRRASRSPSTTAPPPRSTPP 252 Score = 23.1 bits (44), Expect(3) = 1.1 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +1 / +3 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLG 132 P PP P P P+ P A S A S P R+G Sbjct: 24 PPPPSPPPPPPPPPNPMASPAPAPPAASSSAAGSAPPPRIG 146
>LOC_Os07g39700:12007.t03631:unspliced-genomic expressed protein| Length = 1032 Score = 35.9 bits (72), Expect = 1.1 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = -1 / -3 Query: 1533 APSLMIPFVWTSVAPTKPASPMTLSSYHRHSSSPGVLPWVAPVSS 1399 APS P T AP P +P SS+ + +P L W AP S+ Sbjct: 322 APSSPWPPPRTGAAPRGPGTPAPSSSWPPPAGTPAALRWAAPASA 188
>LOC_Os05g05346:12005.t004747:unspliced-genomic expressed protein| Length = 2900 Score = 35.9 bits (72), Expect = 1.1 Identities = 21/62 (33%), Positives = 26/62 (41%) Frame = +1 / +2 Query: 22 PINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSCWRS 201 PI PLP S P + +TP L + S+P LA PP PP R+ Sbjct: 164 PIPSHPLPLPSPPSASSAPPTISASTTGSTTPFLTIPSRPPRLASPPISPRPPPRNHHHQ 343 Query: 202 SP 207 SP Sbjct: 344 SP 349
>LOC_Os11g42989:12011.t03829:unspliced-genomic protein binding protein, putative, expressed| Length = 2012 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 / -2 Query: 85 AKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 ++S P A STP R + PPP+ PP R Sbjct: 1606 SRSRPPASSTPPCRAAGRAPGTPAPPPQPPPPSR 1505 Score = 24.9 bits (48), Expect(2) = 1.2 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 / -1 Query: 175 PPWRSCWRSSPLELSDRWRLSHDNGATVHPGRP 273 PP S R + + WRL AT HP P Sbjct: 1421 PPTTSTSRHAACTNASTWRLVSALCATAHPSPP 1323
>LOC_Os08g44270:12008.t04151:unspliced-genomic vignain precursor, putative, expressed| Length = 1458 Score = 29.9 bits (59), Expect(2) = 1.2 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +1 / -1 Query: 22 PINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 P + P P HGR PS P + S S P PPP S P Sbjct: 1002 PPSCRSPPPPRHGRAPSRISRRTPPPSRTGSASPPPRSPPTPAGSPPPSSAP 847 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 / -1 Query: 255 RPSRATPRPPAG 290 RPSRA+P PPAG Sbjct: 516 RPSRASPPPPAG 481
>LOC_Os11g43049:12011.t03835:unspliced-genomic protein binding protein, putative| Length = 1740 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 / -3 Query: 85 AKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 ++S P A STP R + PPP+ PP R Sbjct: 1606 SRSRPPASSTPPCRAAGRAPGTPAPPPQPPPPSR 1505 Score = 24.9 bits (48), Expect(2) = 1.2 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 / -2 Query: 175 PPWRSCWRSSPLELSDRWRLSHDNGATVHPGRP 273 PP S R + + WRL AT HP P Sbjct: 1421 PPTTSTSRHAACTNASTWRLVSALCATAHPSPP 1323
>LOC_Os03g27850:12003.t02458:unspliced-genomic expressed protein| Length = 1176 Score = 31.3 bits (62), Expect(2) = 1.4 Identities = 19/57 (33%), Positives = 23/57 (40%) Frame = +1 / +2 Query: 67 PSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSCWRSSPLELSDRWRLS 237 P T P + + P A P R P L PPP +PP +SP S R S Sbjct: 53 PPTPPASAASPPAPPPPPPRAPRPPRRLPPPPPPPLPPLPPSSPTSPPPASPSSRAS 223 Score = 26.3 bits (51), Expect(2) = 1.4 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 / +2 Query: 240 RQRCYRPSRATPRPPAGVA*RGRVVPLAGRT 332 R R S TPRPPA + R P RT Sbjct: 713 RPRAGSSSGPTPRPPATASWRSARAPAPART 805
>LOC_Os12g19040:12012.t01752:unspliced-genomic expressed protein| Length = 12759 Score = 30.4 bits (60), Expect(2) = 1.5 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 / -2 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIP 99 P PPP+++ PLP PS P + P Sbjct: 8372 PPPPPLSLSPPPLPAAPTPPSPPPPPPAAP 8283 Score = 22.1 bits (42), Expect(2) = 1.5 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +1 / -2 Query: 157 PPPRSVPPWRSCWRSSPLELSDRWRLSHDNG 249 P P WR+ W PL L R ++ + G Sbjct: 8276 PSPTRSCRWRTPWLPRPLSLHLRPGMAVEKG 8184
>LOC_Os11g34420:12011.t02995:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3224 Score = 25.8 bits (50), Expect(4) = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 / +2 Query: 1402 GHRGHPGQDSGG 1437 GHR HPG ++GG Sbjct: 2342 GHRRHPGGNTGG 2377 Score = 25.4 bits (49), Expect(4) = 1.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 / +2 Query: 223 RWRLSHDNGATVHPGR 270 RWR G T++PGR Sbjct: 938 RWRGREPQGGTIYPGR 985 Score = 24.0 bits (46), Expect(4) = 1.5 Identities = 11/44 (25%), Positives = 18/44 (40%) Frame = +3 / +2 Query: 3 GKPNPSSNQHRKVPSSHPWPRALHQSRSQIHPRSPFHSLSSSWK 134 G+P ++ R +P + W R +R P S S W+ Sbjct: 65 GRPGCRADSCRNLPPAGRWSRWARDARRHTTWGGPSSSSLSQWQ 196 Score = 23.5 bits (45), Expect(4) = 1.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / +3 Query: 797 FHYVVTY*K*PFFHCLQSAPSR 862 FH V++ FF CL PSR Sbjct: 1317 FHSPVSFCLLVFFFCLSEIPSR 1382
>LOC_Os11g24170:12011.t02038:unspliced-genomic NBS-LRR disease resistance protein, putative| Length = 5637 Score = 26.7 bits (52), Expect(2) = 1.5 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +1 / +2 Query: 88 KSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSCWRSSPLELSDRWRLS 237 ++ P A ++ + S+ + P P+S PW + LS WR S Sbjct: 107 RAAPTAATSAASAPASRASTPSSPRPKSTRPWHAGAARPSFALSVAWRAS 256 Score = 25.8 bits (50), Expect(2) = 1.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 / +3 Query: 234 EPRQRCYRPSRATPRPP 284 EPR RC +P+R PP Sbjct: 249 EPRHRC*QPARRNAVPP 299
>LOC_Os08g03670:12008.t00262:unspliced-genomic galactosyltransferase family, putative, expressed| Length = 4499 Score = 29.5 bits (58), Expect(2) = 1.6 Identities = 18/46 (39%), Positives = 20/46 (43%) Frame = +1 / +2 Query: 70 STNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSCWRSSP 207 S P S P+ T S R S P PPP + R C RSSP Sbjct: 110 SPPPTPPSPPLPPPTTSPRSRSPPPPPPPPPPGTGTATRRCSRSSP 247 Score = 23.1 bits (44), Expect(2) = 1.6 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 / +2 Query: 219 RSLALEPRQRCYRPSRAT 272 R + PR R RPSRAT Sbjct: 329 RGRSASPRGRTPRPSRAT 382
>LOC_Os11g04930:12011.t00386:unspliced-genomic SPRY domain containing protein, expressed| Length = 3358 Score = 35.4 bits (71), Expect = 1.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 / +3 Query: 1439 PPPESCPGWPLCPHDTCHRRGQTK 1368 PP CP PL PH CHRR + Sbjct: 78 PPTMRCPRLPLHPHPRCHRRSSPR 149
>LOC_Os06g21210:12006.t01938:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 1089 Score = 35.4 bits (71), Expect = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = -3 / +3 Query: 112 WKGLRGWIWLRDWWRALGHGW 50 W LR WIW WWR GW Sbjct: 627 WWWLRRWIWTWVWWRVRWFGW 689
>LOC_Os05g43860:12005.t03875:unspliced-genomic expressed protein| Length = 2865 Score = 35.4 bits (71), Expect = 1.6 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -2 / -2 Query: 386 QRQRGPWVAPWRSTSCTCGPTGEWDDSAALCHTRRWPRGR 267 +R R P +PWR+ S G WDD AA + PR R Sbjct: 1136 RRARAPRPSPWRAPSSRAGCGRSWDDRAACHPSASPPRRR 1017
>LOC_Os04g33370:12004.t03014:unspliced-genomic cytochrome P450 77A2, putative, expressed| Length = 1977 Score = 35.4 bits (71), Expect = 1.6 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 / -3 Query: 250 HRCRGSSASDRRAPTGNCASKTSMAERSAAVAPLAPR 140 H C G +AS R P G C + + A R+A P A R Sbjct: 271 HGCSG*TASRRTPPAGGCRRRANPAARAATGGPCASR 161
>LOC_Os02g49160:12002.t04500:unspliced-genomic OsIAA8 - Auxin-responsive Aux/IAA gene family member, expressed| Length = 1677 Score = 35.4 bits (71), Expect = 1.6 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 / +1 Query: 21 SNQHRKVPSSHPWPRALHQSRSQIHPRSPFHSL 119 S+QHR P +HP R H+ + +P++ F SL Sbjct: 256 SDQHRSSPRAHPLLRRPHRRQQPFYPKARFRSL 354
>LOC_Os01g03330:12001.t00225:unspliced-genomic Bowman-Birk type bran trypsin inhibitor precursor, putative,| expressed Length = 1659 Score = 35.4 bits (71), Expect = 1.6 Identities = 23/75 (30%), Positives = 32/75 (42%) Frame = -3 / +2 Query: 340 APAVRPASGTTRPRYATPAGGLGVARDGR*HRCRGSSASDRRAPTGNCASKTSMAERSAA 161 AP A+GT R A+ A G R GR R RGS+A+ ++ A S++ Sbjct: 467 APPSSAATGTRRRTPASRARRSGNGRSGRRRRGRGSAATTSGGCRRGSTRRSGAATTSSS 646 Query: 160 VAPLAPRVDFQDEER 116 A +PR R Sbjct: 647 PASASPRARLAGRRR 691
>LOC_Os11g47610:12011.t04256:unspliced-genomic xylanase inhibitor protein 1 precursor, putative, expressed| Length = 1193 Score = 35.4 bits (71), Expect = 1.6 Identities = 20/49 (40%), Positives = 23/49 (46%) Frame = -1 / +3 Query: 1503 TSVAPTKPASPMTLSSYHRHSSSPGVLPWVAPVSS*HLPPSWTN*TVPN 1357 TS A PAS T S+ R +SP P AP +S PP T PN Sbjct: 291 TSPATRSPASAPTSSTAKRPRTSPSSSPSAAPATSTRCPPPSRRRTWPN 437
>LOC_Os11g43630:12011.t03893:unspliced-genomic loricrin, putative| Length = 926 Score = 35.4 bits (71), Expect = 1.6 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +1 / -2 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPP 165 PPP+ P P+ P + PV LS P+++ P ++ PPP Sbjct: 532 PPPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPP 383 Score = 34.1 bits (68), Expect = 4.1 Identities = 15/55 (27%), Positives = 20/55 (36%) Frame = +1 / -2 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 PPP+ P P+ P PV L P ++ P + PPP P Sbjct: 628 PPPVKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSP 464 Score = 33.6 bits (67), Expect = 5.6 Identities = 15/50 (30%), Positives = 19/50 (38%) Frame = +1 / -2 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPP 165 PPPI P P+ P PV L P ++ P + PPP Sbjct: 724 PPPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPP 575
>LOC_Os07g48750:12007.t04504:unspliced-genomic alpha-N-arabinofuranosidase 1 precursor, putative, expressed| Length = 5724 Score = 35.4 bits (71), Expect = 1.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +1 / +3 Query: 145 ELAEPPPRSVPPWRSCWRSSPLE 213 + A PP R PPWRSC R+ P E Sbjct: 108 DAAWPPTRRPPPWRSCPRTRPRE 176
>LOC_Os06g02960:12006.t00189:unspliced-genomic expressed protein| Length = 2553 Score = 35.4 bits (71), Expect = 1.6 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 / +3 Query: 109 STPSLRLGSQP*ELAEPPPRSVPPWRSC 192 ++PS R GS P +A P S P WRSC Sbjct: 603 ASPSPRSGSAPSPMARTPASSPPTWRSC 686
>LOC_Os05g01750:12005.t00075:unspliced-genomic pseudouridylate synthase/ transporter, putative, expressed| Length = 4479 Score = 35.4 bits (71), Expect = 1.6 Identities = 20/63 (31%), Positives = 24/63 (38%) Frame = +1 / +3 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 S T PP I +P P P + P A ++ S S P PP PP R Sbjct: 195 SSTAPPTPIRPNPPPPMTATPGPPTTTSTAPSAGTSGSAAAASSPTPTPPPPSPPPPPRR 374 Query: 187 SCW 195 S W Sbjct: 375 SSW 383
>LOC_Os10g04610:12010.t00345:unspliced-genomic F-box domain containing protein, expressed| Length = 2409 Score = 27.2 bits (53), Expect(2) = 1.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 / +1 Query: 258 PSRATPRPPAGVA*RGRVVP 317 PSR TP PP RGR +P Sbjct: 349 PSRPTPPPPPPPPSRGRSIP 408 Score = 25.4 bits (49), Expect(2) = 1.6 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +1 / +1 Query: 67 PSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 PS+ +S P S S + P + PP R PP Sbjct: 256 PSSAASTRSTPAPSSASSTWNTTAPAAASSPPSRPTPP 369
>LOC_Os08g39130:12008.t03646:unspliced-genomic CRR4, putative, expressed| Length = 1998 Score = 33.1 bits (66), Expect(2) = 1.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 / +3 Query: 58 HGWEEGTFRC*LEEGLGF 5 HGW EG RC EG GF Sbjct: 816 HGWREGVVRCHAREGCGF 869 Score = 24.9 bits (48), Expect(2) = 1.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 / +2 Query: 1508 CGPALLQQNLPHP*LSHRTTGIHPPPESCP 1419 C P++ + + P P S T+ PPP P Sbjct: 134 CAPSISRSSPPPPPPSSTTSSSAPPPPPRP 223
>LOC_Os06g21240:12006.t01941:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 1443 Score = 32.7 bits (65), Expect(2) = 1.7 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -3 / +3 Query: 112 WKGLRGWIWLRDWWRALGHGW 50 W +R W WLR WWR W Sbjct: 1152 WWRIRWWGWLRWWWRLWRRTW 1214 Score = 24.9 bits (48), Expect(2) = 1.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 / +2 Query: 1461 SSYHRHSSSPGVLPWVAPVS 1402 SS+HR +SS L W+A +S Sbjct: 8 SSHHRLASSTDHLKWLARIS 67
>LOC_Os07g38220:12007.t03488:unspliced-genomic expressed protein| Length = 1481 Score = 28.1 bits (55), Expect(2) = 1.7 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +1 / +3 Query: 43 PLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRS 171 P P R +T+ +S P++ S PSL S PPP S Sbjct: 147 PPPHQTRSSTTSTSPRSRPLSPSAPSLPSASPSSSGHRPPPSS 275 Score = 24.4 bits (47), Expect(2) = 1.7 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +1 / +1 Query: 229 RLSHDNGATVHPGRPRGHLR 288 RL+ A HPG P GH R Sbjct: 286 RLAAPPLARAHPGEPAGHPR 345
>LOC_Os01g03760:12001.t00266:unspliced-genomic expressed protein| Length = 5330 Score = 23.1 bits (44), Expect(3) = 1.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 / +1 Query: 160 PPRSVPPWRSC 192 PPR +P W SC Sbjct: 355 PPRLLPIWGSC 387 Score = 22.6 bits (43), Expect(3) = 1.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 / +1 Query: 240 RQRCYRPSRATPR 278 R C RPS TPR Sbjct: 403 RSTCSRPSTGTPR 441 Score = 22.1 bits (42), Expect(3) = 1.7 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 / +1 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEA 87 P PPP SP P G S P A Sbjct: 250 PPPPPRWTPWSPTPRTGGRRSPTPSA 327
>LOC_Os01g61630:12001.t05541:unspliced-genomic expressed protein| Length = 2294 Score = 29.0 bits (57), Expect(3) = 2.1 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = -2 / -3 Query: 398 ATTGQRQRGPWVAPWRSTSCTCGPTGEWDDSAALCHTRRWPRGRP 264 A G P A R +C G G + C TRRW R RP Sbjct: 888 ARRGWGSTTPRRARRRRRACRGGGAGWRPGAGRTCSTRRWRRCRP 754 Score = 24.9 bits (48), Expect(3) = 2.1 Identities = 14/56 (25%), Positives = 18/56 (32%) Frame = -3 / -2 Query: 241 RGSSASDRRAPTGNCASKTSMAERSAAVAPLAPRVDFQDEEREWKGLRGWIWLRDW 74 R S RR TG C + + A A R + W+ G R W Sbjct: 361 RERSVPRRRGETGRCGETAAARSEAVRAAERAARSAGRSGTWSWRWCWGSAGFRRW 194 Score = 24.0 bits (46), Expect(3) = 2.1 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -1 / -3 Query: 1533 APSLMIPFVWTSVAPTKPASPMTLSSYHRHSS 1438 AP L + S T P T S+YH HSS Sbjct: 1833 APCLRRRILPPSSPGTAPPPCRTPSAYHEHSS 1738
>LOC_Os10g33230:12010.t02625:unspliced-genomic heterogeneous nuclear ribonucleoprotein 27C, putative, expressed| Length = 5337 Score = 29.5 bits (58), Expect(2) = 2.1 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -3 / +3 Query: 322 ASGTTRPRYATPAGGLGVARDGR*HRCRGSSASDRRAPTGNCASKTSM 179 + T+RP ++P R GSS S RR P C ++ SM Sbjct: 639 SGSTSRPTGSSPTSSSCTTRTRSGRGGSGSSPSTRRTPLTACCTRPSM 782 Score = 22.6 bits (43), Expect(2) = 2.1 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = -3 / +1 Query: 97 GWIWLRDWW 71 G WLR WW Sbjct: 829 GQPWLRQWW 855
>LOC_Os03g36670:12003.t03136:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3232 Score = 27.2 bits (53), Expect(3) = 2.1 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = +3 / +2 Query: 3 GKPNPSSNQHRKVPSSHPWPRALHQSRSQIHPRSPFHSLSSSWKSTLGAS 152 G+P ++ R +P + W R +R P S S W+ G S Sbjct: 65 GRPGCRADSCRNLPPAGRWSRWARDARRHTTRGGPSSSSLSQWRGWSGHS 214 Score = 25.8 bits (50), Expect(3) = 2.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 / +3 Query: 223 RWRLSHDNGATVHPGR 270 RWR G T++PGR Sbjct: 939 RWRGQEPQGGTIYPGR 986 Score = 25.8 bits (50), Expect(3) = 2.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 / +1 Query: 1402 GHRGHPGQDSGG 1437 GHR HPG ++GG Sbjct: 2350 GHRRHPGGNTGG 2385
>LOC_Os05g36080:12005.t03201:unspliced-genomic transposon protein, putative, unclassified| Length = 4787 Score = 28.1 bits (55), Expect(2) = 2.1 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -3 / +2 Query: 1606 PIPWTRLFE*I*HSAQVRTLHTPWST*PHDPIRVDQ 1499 P PW RLFE + + TL+ T P P R DQ Sbjct: 4064 P*PWARLFEQFVNLCRGGTLYPHDITNPDHPARGDQ 4171 Score = 24.0 bits (46), Expect(2) = 2.1 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 / +2 Query: 1455 YHRHSSSPGVLPWVAPVS 1402 YH SPGVLP P + Sbjct: 4280 YHTVPGSPGVLPDTTPAN 4333
>LOC_Os10g41550:12010.t03390:unspliced-genomic beta-amylase, putative, expressed| Length = 3420 Score = 35.0 bits (70), Expect = 2.2 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -2 / -1 Query: 377 RGPWVAPWRSTSCTCGPTGEWDDSAALCHTRRWPRGR 267 R P PWR+ +C P W + R W GR Sbjct: 282 RAPPAPPWRAAACRRSPAPAWGRRSTAARPRAWRTGR 172
>LOC_Os10g09210:12010.t00738:unspliced-genomic transposon protein, putative, unclassified| Length = 681 Score = 35.0 bits (70), Expect = 2.2 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = +2 / +1 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR WT+R Sbjct: 211 HL*SEYNLFE*PRPRLWTSR 270
>LOC_Os06g04560:12006.t00346:unspliced-genomic PAK, putative, expressed| Length = 9635 Score = 35.0 bits (70), Expect = 2.2 Identities = 12/45 (26%), Positives = 26/45 (57%) Frame = +3 / -1 Query: 1740 HELDWIWIRFRLDHENIRSINNLLNMVYLIVFTLVVILLDNRVIP 1874 H ++ + + F+ H+NI S+ L + YLI + + I ++++P Sbjct: 3932 HAIELLLLFFQFHHQNISSVFRFLQLTYLIQYQVFYISFCSQILP 3798
>LOC_Os01g03030:12001.t00195:unspliced-genomic alanyl-tRNA synthetase, putative, expressed| Length = 3235 Score = 35.0 bits (70), Expect = 2.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -2 / +2 Query: 386 QRQRGPWVAPWRSTSCTCGPT 324 Q +RGPW P TS TCGP+ Sbjct: 107 QLRRGPWAPPSSRTSMTCGPS 169
>LOC_Os04g34140:12004.t03089:unspliced-genomic photoperiod responsive protein, putative, expressed| Length = 1769 Score = 35.0 bits (70), Expect = 2.2 Identities = 17/56 (30%), Positives = 25/56 (44%) Frame = +1 / -1 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 P+PP ++ S P P A+ P + S P L +P PPPR++P Sbjct: 776 PSPPARSLRASRAPGTPPTPRRPRRARRRPASCSRPRLHPSRRPRRAPAPPPRTLP 609
>LOC_Os03g50210:12003.t04363:unspliced-genomic expressed protein| Length = 1735 Score = 35.0 bits (70), Expect = 2.2 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = -1 / +3 Query: 1500 SVAPTKPASPMTLSSYHRHSSSPGVLPWVAPVSS*HLPPSWT 1375 S PT P S + SS R S+P +SS PPSWT Sbjct: 312 SATPTAPCSAPSRSSASRTRSTPSSCSSPTAISSPSAPPSWT 437
>LOC_Os03g38210:12003.t03270:unspliced-genomic myb-like DNA-binding domain containing protein, expressed| Length = 2953 Score = 35.0 bits (70), Expect = 2.2 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 / +2 Query: 1509 VWTSVAPTKPASPMTLSSYHRHSSSPGVLPWVA 1411 +WT P P P T + R S+SP LPW A Sbjct: 713 LWTQPMPPAPPRPGTPARARRRSTSPASLPWGA 811
>LOC_Os02g04720:12002.t00370:unspliced-genomic hypothetical protein| Length = 638 Score = 35.0 bits (70), Expect = 2.2 Identities = 16/59 (27%), Positives = 20/59 (33%) Frame = +1 / +2 Query: 154 EPPPRSVPPWRSCWRSSPLELSDRWRLSHDNGATVHPGRPRGHLRVWHSAAESSHSPVG 330 EP + WRS S+ + WR HP P + W S SP G Sbjct: 86 EPGSKKSSAWRSLRNSTAATTTGAWRRCRFRPRVRHPSPPHADRKTWSSTTPPRASPPG 262
>LOC_Os01g39290:12001.t03460:unspliced-genomic harpin-induced protein, putative, expressed| Length = 1129 Score = 35.0 bits (70), Expect = 2.2 Identities = 19/66 (28%), Positives = 26/66 (39%) Frame = +1 / +1 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 SP+PP +SP P + A + A S S + P PP PPW Sbjct: 517 SPSPPATPTTRSPSRTATSRPRSPRTAPTSATARSRGSSTPPATPPSSRATPPPPPPPWT 696 Query: 187 SCWRSS 204 WR++ Sbjct: 697 RWWRTA 714
>LOC_Os04g57250:12004.t05191:unspliced-genomic retinitis pigmentosa GTPase regulator, putative| Length = 627 Score = 23.1 bits (44), Expect(3) = 2.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 / -3 Query: 27 QHRKVPSSHPWPRALHQ 77 QHR++P H R LH+ Sbjct: 496 QHRRLPRPHRLLRPLHR 446 Score = 22.6 bits (43), Expect(3) = 2.2 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +1 / -3 Query: 133 SQP*ELAEPPPRSVPPWRSCWRS 201 S P PPP S PP W S Sbjct: 370 SGPLRRRPPPPPSPPPSTPFWAS 302 Score = 22.1 bits (42), Expect(3) = 2.2 Identities = 12/39 (30%), Positives = 13/39 (33%) Frame = +1 / -2 Query: 217 SDRWRLSHDNGATVHPGRPRGHLRVWHSAAESSHSPVGP 333 SD WRL A R L VW S + P Sbjct: 197 SDLWRLRRTCSAPRQGRRIHDVLLVWQSGGGEADDATSP 81
>LOC_Os01g10160:12001.t00891:unspliced-genomic retinitis pigmentosa GTPase regulator, putative| Length = 627 Score = 23.1 bits (44), Expect(3) = 2.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 / -3 Query: 27 QHRKVPSSHPWPRALHQ 77 QHR++P H R LH+ Sbjct: 496 QHRRLPRPHRLLRPLHR 446 Score = 22.6 bits (43), Expect(3) = 2.2 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +1 / -3 Query: 157 PPPRSVPPWRSCWRS 201 PPP S PP W S Sbjct: 346 PPPPSPPPLTPFWAS 302 Score = 22.1 bits (42), Expect(3) = 2.2 Identities = 12/39 (30%), Positives = 13/39 (33%) Frame = +1 / -2 Query: 217 SDRWRLSHDNGATVHPGRPRGHLRVWHSAAESSHSPVGP 333 SD WRL A R L VW S + P Sbjct: 197 SDLWRLRRTCSAPRQGRRIHDVLLVWQSGGGEADDATSP 81
>LOC_Os02g42380:12002.t03823:unspliced-genomic TCP-domain protein, putative, expressed| Length = 1105 Score = 32.7 bits (65), Expect(2) = 2.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 / +2 Query: 73 TNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSV 174 +NP P L+ P + L P* A PPPRS+ Sbjct: 17 SNPTGTGPPPPLAPPRITLSRSP*APATPPPRSM 118 Score = 24.0 bits (46), Expect(2) = 2.4 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +1 / +3 Query: 148 LAEPPPRSVPPWRSCWRSSPLELSDRWRLSHDNGATVHPGR 270 +A PP R+V P R R P L R H A HP R Sbjct: 369 VAAPPGRAVHPRRHGDRHHPGRLRLLLRAVHLLLAPAHPPR 491
>LOC_Os01g25580:12001.t02274:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5970 Score = 30.4 bits (60), Expect(2) = 2.4 Identities = 14/54 (25%), Positives = 24/54 (44%) Frame = -3 / +2 Query: 331 VRPASGTTRPRYATPAGGLGVARDGR*HRCRGSSASDRRAPTGNCASKTSMAER 170 +R +S +PR +T + + RC G + + G C S +SMA + Sbjct: 5429 MRKSSEALKPRPSTSSRNTAIRGSRSCQRCSGRTEPHQAEQPGKCFSSSSMARK 5590 Score = 28.6 bits (56), Expect(2) = 2.4 Identities = 11/46 (23%), Positives = 17/46 (36%) Frame = -2 / +2 Query: 452 TWGPTWXXXXXXLTVVFLATTGQRQRGPWVAPWRSTSCTCGPTGEW 315 T TW +++ +T G + W W S + C T W Sbjct: 4268 TSSDTWFVSTFGRPIIWQSTRGSLRDSGWQLDWGSAASWC*ATPSW 4405
>LOC_Os10g36500:12010.t02932:unspliced-genomic ripening-related protein-like, putative, expressed| Length = 2165 Score = 29.5 bits (58), Expect(2) = 2.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 / +2 Query: 296 CHTRRWPRGRPGWTVAPLSWLKRQ 225 C TRRW R R W A SW R+ Sbjct: 209 CATRRWRRTRRRWGRARRSWRGRR 280 Score = 28.1 bits (55), Expect(2) = 2.4 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 / +2 Query: 220 RRAPTGNCASKTSMAERSAAVAPLAP 143 RR+PT CA K S AA AP P Sbjct: 545 RRSPTTTCAWKGSRGRPPAAAAPGRP 622
>LOC_Os07g16380:12007.t01498:unspliced-genomic hypothetical protein| Length = 420 Score = 29.0 bits (57), Expect(2) = 2.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 / +2 Query: 96 PRSPFHSLSSSWKSTLGASGATAALRS 176 PR P S+S+ ST SGATAA S Sbjct: 269 PRPPLPSISAMASSTATLSGATAAASS 349 Score = 23.1 bits (44), Expect(2) = 2.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 / +2 Query: 7 SPTPPPINIGKSPLP 51 SPT PP G SP+P Sbjct: 104 SPTTPPSPRGCSPVP 148
>LOC_Os10g06300:12010.t00499:unspliced-genomic hypothetical protein| Length = 4626 Score = 32.7 bits (65), Expect(2) = 2.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 / -2 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR W +R Sbjct: 1550 HL*SEYNLFE*PRPRLWASR 1491 Score = 25.8 bits (50), Expect(2) = 2.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 / -1 Query: 160 PPRSVPPWRSCWRSSPLELSDRW 228 P R +PP RS + SSP + W Sbjct: 3069 PRRRLPPLRSLFPSSPSTRGEPW 3001
>LOC_Os02g09480:12002.t00795:unspliced-genomic MYB transcription factor TaMYB1, putative, expressed| Length = 1707 Score = 32.2 bits (64), Expect(2) = 2.6 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 / +2 Query: 79 PEAKSIPVALSTPSLRLGSQP*ELAEPPPRS 171 P S P A +TPS G+ P + PPPR+ Sbjct: 326 PSRASSPAAPTTPSRTTGTPPSSASSPPPRT 418 Score = 24.9 bits (48), Expect(2) = 2.6 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +1 / +2 Query: 415 REERERSHVGPHVIQSALTSP 477 R R R H+ PH + ++SP Sbjct: 746 RRRRRRQHLHPHTRSTPISSP 808
>LOC_Os10g16880:12010.t01250:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 4865 Score = 30.4 bits (60), Expect(2) = 2.7 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -2 / -1 Query: 323 GEWDDSAALCHTRRWPRGRPGWTVAPLSW 237 GEW +LC R P W A +SW Sbjct: 3398 GEWKSRRSLCRVRCTPSCPSVWIAAKISW 3312 Score = 28.1 bits (55), Expect(2) = 2.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 / -2 Query: 1361 QTGTPGSNNQLGSQGYCRLPG 1299 + G PG+N Q G CR PG Sbjct: 3490 EAGRPGANAQTCCAGMCRTPG 3428
>LOC_Os06g07090:12006.t00593:unspliced-genomic AP-1 complex subunit gamma-1, expressed| Length = 9984 Score = 31.3 bits (62), Expect(2) = 2.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 / -3 Query: 1727 HSSHSHPMANISSSDVCTRRV 1665 H H H +NIS S VCT R+ Sbjct: 3985 HGLHKHVQSNISESTVCTLRI 3923 Score = 28.1 bits (55), Expect(2) = 2.8 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -2 / -2 Query: 386 QRQRGPWVAPWRSTSCTCGPTGEWDDSAALCHTR 285 +R+RG W PWRS + W D + R Sbjct: 230 RRRRG*WRGPWRSPRRSSRRNPGWGDGGGISPPR 129
>LOC_Os09g26580:12009.t02337:unspliced-genomic expressed protein| Length = 5357 Score = 28.1 bits (55), Expect(2) = 2.8 Identities = 16/61 (26%), Positives = 20/61 (32%) Frame = +1 / +1 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRS 189 P PPP+ P+P S P R P L PP S+ R+ Sbjct: 100 PRPPPLQYTPLPMPASSAPTGPKASQPSPAAHRLAPMARSPGSPLPLLLPPGWSLGGGRT 279 Query: 190 C 192 C Sbjct: 280 C 282 Score = 23.5 bits (45), Expect(2) = 2.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 / +2 Query: 256 VHPGRPRGHLRV 291 +H RPRGHL+V Sbjct: 362 LHRRRPRGHLQV 397
>LOC_Os01g23680:12001.t02094:unspliced-genomic cysteine sulfinate desulfinase/cysteine desulfurase and related| enzymes, putative, expressed Length = 4653 Score = 29.5 bits (58), Expect(2) = 2.8 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -3 / +2 Query: 112 WKGLRGWIWLRDWW 71 W GW+WLR WW Sbjct: 344 WWWWIGWLWLRWWW 385 Score = 22.1 bits (42), Expect(2) = 2.8 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 / +2 Query: 76 WWRALGHGWEEG 41 WW G G EEG Sbjct: 419 WWGRRGRGVEEG 454
>LOC_Os05g27210:12005.t02373:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1359 Score = 32.7 bits (65), Expect(2) = 2.9 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 / +1 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR W +R Sbjct: 211 HL*SEYNLFE*PRPRLWASR 270 Score = 24.0 bits (46), Expect(2) = 2.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 / +1 Query: 2132 APRPCCLR*SFSAAITLV 2185 APR CC+R A +T V Sbjct: 1018 APRWCCVRAPVEATVTFV 1071
>LOC_Os03g60670:12003.t05305:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3444 Score = 28.1 bits (55), Expect(2) = 2.9 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 / +1 Query: 1472 P*LSHRTTGIHPPPESCPGWPLC 1404 P S +T PPP S GW C Sbjct: 1132 PRFSRTSTSKRPPPRSSSGWRCC 1200 Score = 23.5 bits (45), Expect(2) = 2.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 / +2 Query: 1365 VPNGYSRVKQSTWLTRLLPPTGLGQR 1288 +P SR ++S W R PP G R Sbjct: 1322 LPAAGSRRRRSHWSERQRPPAAAGGR 1399
>LOC_Os03g48560:12003.t04213:unspliced-genomic BGGP Beta-1-3-galactosyl-O-glycosyl-glycoprotein, putative,| expressed Length = 3277 Score = 27.2 bits (53), Expect(2) = 2.9 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 / +3 Query: 82 EAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 + ++ A+ P LRLG A PPR++PP Sbjct: 216 DTATLAAAVRLPHLRLGRGRAHDAALPPRALPP 314 Score = 24.4 bits (47), Expect(2) = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 / +2 Query: 9 PNPSSNQHRKVPSSHPWPRALHQSRSQIHP 98 P P ++ PSS P PRA RS P Sbjct: 101 PPPRPSRSAPPPSSPPPPRAARCRRSSSSP 190
>LOC_Os08g40270:12008.t03758:unspliced-genomic lectin-like protein kinase, putative| Length = 2855 Score = 27.6 bits (54), Expect(2) = 2.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 / +1 Query: 151 AEPPPRSVPPWRSCWRSSP 207 A P P + PP R C RS P Sbjct: 2536 ATPTPATAPPCRRCCRSCP 2592 Score = 24.0 bits (46), Expect(2) = 2.9 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 / +1 Query: 258 PSRATPRPPAGVA 296 PSRA PPAG A Sbjct: 2692 PSRAAASPPAGAA 2730
>LOC_Os05g30580:12005.t02657:unspliced-genomic cucumisin precursor, putative, expressed| Length = 2456 Score = 28.6 bits (56), Expect(2) = 3.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 / -1 Query: 33 RKVPSSHPWPRALHQSRSQIHPRSP 107 R + P+P A H RS + PR+P Sbjct: 503 RPTTTPSPYPAAFHTPRSGVSPRNP 429 Score = 23.1 bits (44), Expect(2) = 3.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 / -3 Query: 152 RSHRRAPFRHGG 187 R+H AP RHGG Sbjct: 387 RAHEPAPPRHGG 352
>LOC_Os10g20770:12010.t01570:unspliced-genomic expressed protein| Length = 2628 Score = 34.5 bits (69), Expect = 3.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 / +2 Query: 368 WVAPWRSTSCTCGPTGEWDDSAA 300 W + W TSC+ PTG W S A Sbjct: 1160 WRSTWPGTSCSSPPTGRWHSSTA 1228
>LOC_Os07g08040:12007.t00681:unspliced-genomic expressed protein| Length = 5329 Score = 34.5 bits (69), Expect = 3.0 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = +3 / +3 Query: 150 SGATAALRSAMEVLLAQFPVGALRSLALEPRQRCYRPSRATPRPPA 287 +G AA R A L+ P+ RS + R+R RPS A PRP A Sbjct: 4797 TGRAAANRRAAANLVLSSPMKPRRSCYVRGRRRRPRPSPAAPRPAA 4934
>LOC_Os06g02400:12006.t00133:unspliced-genomic F-box domain containing protein, expressed| Length = 3543 Score = 34.5 bits (69), Expect = 3.0 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +3 / +2 Query: 9 PNPSSNQHRKVPSSHPWPRALHQSRSQIHPRSPFHSLSSSWKSTLGASGATAALRSA 179 P P + SS PWPR+ + R P P + +++ S G+S +T+ S+ Sbjct: 2147 PAPLTTPEASGLSSRPWPRSTARPRRPCTPTRPSSASTAAAPSVTGSSSSTSLAASS 2317
>LOC_Os11g02490:12011.t00143:unspliced-genomic transposon protein, putative, unclassified| Length = 2316 Score = 26.7 bits (52), Expect(2) = 3.0 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 / -1 Query: 165 ALRSAMEVLLAQFPVGALRSLALEPRQRCYRPSRATPRP 281 A S + L + P+ L R+RC R +R +PRP Sbjct: 189 AAASRLAPPLPRCPIAVPLPHRLPSRRRCRRAARPSPRP 73 Score = 24.9 bits (48), Expect(2) = 3.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 / -3 Query: 9 PNPSSNQHRKVPSSHPWPRALHQSRSQIHPRSPFHSLS 122 P+P R+ P++ P P + SR PR+P L+ Sbjct: 289 PSPRVAASRRSPAAPPSPLSPSASRPVPPPRAPCRCLA 176
>LOC_Os11g12420:12011.t01129:unspliced-genomic protein Z, putative, expressed| Length = 1945 Score = 34.5 bits (69), Expect = 3.0 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 / +2 Query: 67 PSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSC 192 PS P ++ A ++ S R S P PP R PPW SC Sbjct: 572 PSVCPWRRTASAAATSCSRRCPSTPRSPWSPPARGGPPWPSC 697
>LOC_Os10g07970:12010.t00612:unspliced-genomic anthocyanidin 5,3-O-glucosyltransferase, putative, expressed| Length = 1685 Score = 34.5 bits (69), Expect = 3.0 Identities = 20/62 (32%), Positives = 27/62 (43%) Frame = +1 / -1 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 S +PPP + SP P S+ S P + ST S +P +A PPP + W Sbjct: 1199 SSSPPP*SPCSSPAPRTAASISSAAPT*SPPASSSTRSA*RTRRPPRVAPPPPVAPSSWP 1020 Query: 187 SC 192 C Sbjct: 1019 PC 1014
>LOC_Os01g50310:12001.t04465:unspliced-genomic VIP1 protein, putative, expressed| Length = 1562 Score = 25.8 bits (50), Expect(3) = 3.3 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 / +1 Query: 67 PSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 P P + + P +L P+ S+ PPPR+ P Sbjct: 292 PPRTPPSPTPPSSLRRPAPTAASRRTRSPSPPPRTAP 402 Score = 25.4 bits (49), Expect(3) = 3.3 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 / +2 Query: 1385 GGRCHEDTGATQGR 1426 GG CHE G QGR Sbjct: 932 GGDCHEGEGQGQGR 973 Score = 24.9 bits (48), Expect(3) = 3.3 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +1 / +1 Query: 7 SPTPPPINIGKSPLPIHGREPSTNP 81 SPTPPP + P P +T P Sbjct: 118 SPTPPPPPAARRPRPSDASPATTLP 192
>LOC_Os08g31910:12008.t02936:unspliced-genomic expressed protein| Length = 6319 Score = 29.9 bits (59), Expect(2) = 3.4 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -1 / -1 Query: 324 RRVGRLGRAMPHPQVASGSPGMDG 253 RR GR G+ HP ASGS G G Sbjct: 5158 RRRGRRGQCRLHPHQASGSEGRGG 5087 Score = 28.6 bits (56), Expect(2) = 3.4 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = -3 / -3 Query: 250 HRCRGSSASDRRAPTGNCASKTSMAERSAAVAPLAPRVDFQDEEREWKGLRG 95 H R S +++R T+MA+ +A PL R+ DEE + LRG Sbjct: 3791 HPPRISGSAERGGRARVSVCATAMAQPTADGRPLEGRLVLHDEEPGARALRG 3636
>LOC_Os01g41060:12001.t03628:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3176 Score = 27.6 bits (54), Expect(3) = 3.5 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +3 / +2 Query: 3 GKPNPSSNQHRKVPSSHPWPRALHQSRSQIHPRSPFHSLSSSWK 134 G+P ++ R +P + W R +R +I P S S W+ Sbjct: 65 GRPGCRADSCRNLPPAGRWSRWARDARRRITRGGPSSSSLSQWQ 196 Score = 25.4 bits (49), Expect(3) = 3.5 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 / +3 Query: 223 RWRLSHDNGATVHPGR 270 RWR G T++PGR Sbjct: 939 RWRGREPQGGTIYPGR 986 Score = 24.9 bits (48), Expect(3) = 3.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 / +1 Query: 268 RPRGHLRVWHSAAESSHSPVGPQVQEVDR 354 RP R HSA+ +HSP G ++ R Sbjct: 2335 RPPAPKRSPHSASARTHSPSGSELSRKPR 2421
>LOC_Os08g41520:12008.t03881:unspliced-genomic zinc finger, C3HC4 type family protein, expressed| Length = 920 Score = 28.1 bits (55), Expect(2) = 3.6 Identities = 16/57 (28%), Positives = 23/57 (40%) Frame = +1 / -3 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 P PP P+P+ R + + A+S P ST + + P PP PP Sbjct: 738 PPPPRPPPPPIPMPMRRRRETRDAAARSRPSRRSTAAPSAPAAPSGTPSPPAPPPPP 568 Score = 27.6 bits (54), Expect(2) = 3.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 / -3 Query: 237 PRQRCYRPSRATPRPPAG 290 PR+R RPS PR PAG Sbjct: 222 PRRRWRRPSPRAPRRPAG 169
>LOC_Os01g08780:12001.t00756:unspliced-genomic type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2, putative,| expressed Length = 4673 Score = 26.3 bits (51), Expect(2) = 3.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 / +2 Query: 97 PVALSTPSLRLGSQP*ELAEPPPRSVPPW 183 P + ++P R G * ++ PPP PPW Sbjct: 2072 PSSRTSPPPRGG*PG*TISLPPPTPPPPW 2158 Score = 24.9 bits (48), Expect(2) = 3.8 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 / +2 Query: 10 PTPPPINIGKSPLPIHGREPS 72 P PPP+ S PI R P+ Sbjct: 1973 PPPPPMTTSSSLAPIRTRTPT 2035
>LOC_Os01g42010:12001.t03721:unspliced-genomic expressed protein| Length = 4468 Score = 25.8 bits (50), Expect(2) = 3.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 / -3 Query: 4 GSPTPPPINIGKSPLPI 54 GSP PPP + SP PI Sbjct: 176 GSPPPPPPPVLPSPSPI 126 Score = 25.4 bits (49), Expect(2) = 3.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 / -2 Query: 40 SPLPIHGREPSTNPEAKSIPVALSTP 117 +PLPI R + P S+P+ TP Sbjct: 147 APLPIPHRRRCSPPPPPSLPLGYGTP 70
>LOC_Os07g31370:12007.t02825:unspliced-genomic ras-related protein Rab-6A, putative, expressed| Length = 4013 Score = 26.7 bits (52), Expect(2) = 3.8 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 / +2 Query: 110 ERATGMDLASGLVEGSRPW 54 ER G+DL GL S PW Sbjct: 551 ERRLGLDLCRGLAADSVPW 607 Score = 24.4 bits (47), Expect(2) = 3.8 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = -2 / +3 Query: 281 WPRGRPGWTVAPLSWL 234 WP GRP W W+ Sbjct: 525 WPAGRPIWRRGGWDWI 572
>LOC_Os02g53280:12002.t04907:unspliced-genomic expressed protein| Length = 2653 Score = 29.5 bits (58), Expect(2) = 3.8 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -2 / -2 Query: 1433 PESCPGWPLCPHDTCHRRGQTKLSQTG 1353 P P P PH TC RRG T+ + G Sbjct: 1800 PTGHPPTPTPPHLTCQRRGATRRRRGG 1720 Score = 27.6 bits (54), Expect(2) = 3.8 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -2 / -1 Query: 398 ATTGQRQRGPWVAPWRSTSCTCG 330 A QR W WR+ SC CG Sbjct: 1576 AVAAQRLARWWCERWRARSCGCG 1508
>LOC_Os01g52050:12001.t04632:unspliced-genomic systemin receptor SR160 precursor, putative, expressed| Length = 3945 Score = 28.1 bits (55), Expect(2) = 3.8 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 / -3 Query: 15 PSSNQHRKVPSSHPWPRALHQSRSQIHPRS 104 P+S+ +P HP P LH +HP S Sbjct: 373 PASDSDVSLPFRHPAPGNLHAPSPPLHPLS 284 Score = 23.1 bits (44), Expect(2) = 3.8 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 / -3 Query: 96 PRSPFHSLSSSWKSTLGASGATAALRSA 179 P P H LS++W T + +++ SA Sbjct: 310 PSPPLHPLSAAWFGTACLNSSSSWASSA 227
>LOC_Os03g56781:12003.t04940:unspliced-genomic hypothetical protein| Length = 990 Score = 29.0 bits (57), Expect(2) = 3.9 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 / +2 Query: 404 FLATTGQRQRGPWVAPWRSTSCTCGPTG 321 +L +R+ P A WR T+CTC G Sbjct: 800 WLRGISRRRATPASAGWRRTACTCSTRG 883 Score = 26.7 bits (52), Expect(2) = 3.9 Identities = 16/69 (23%), Positives = 21/69 (30%) Frame = -2 / +2 Query: 1409 LCPHDTCHRRGQTKLSQTGTPGSNNQLGSQGYCRLPG*GSACA*PSVSGGIGERARYQTK 1230 +CP TC R G S P + S P A + + G + Sbjct: 248 ICPKTTCRRGGAPASSPASRPAATAAASSSSSTLSPPCSGTAASAATATASGRSTSTTSA 427 Query: 1229 SRLSYTGKC 1203 R S T C Sbjct: 428 RRASTTRAC 454
>LOC_Os05g39000:12005.t03442:unspliced-genomic protein kinase interacting protein 1, putative, expressed| Length = 3389 Score = 27.2 bits (53), Expect(2) = 3.9 Identities = 15/55 (27%), Positives = 23/55 (41%) Frame = +3 / +3 Query: 9 PNPSSNQHRKVPSSHPWPRALHQSRSQIHPRSPFHSLSSSWKSTLGASGATAALR 173 P SS + P P PRA+ R HP S ++ G G++++ R Sbjct: 279 PLLSSGRLAVSPPPQPSPRAVRARRGSHHPTSVASRRAARLAERAGGGGSSSSSR 443 Score = 24.0 bits (46), Expect(2) = 3.9 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 / +2 Query: 234 EPRQRCYRPSRATPRPPAG 290 +P + C+ RATP P G Sbjct: 482 DPGRLCFSARRATPTPGGG 538
>LOC_Os07g04260:12007.t00314:unspliced-genomic hypothetical protein| Length = 2027 Score = 25.8 bits (50), Expect(2) = 4.0 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +1 / +2 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVA 105 P PPP P R P+ P A + P A Sbjct: 884 PRPPPARAQPRPPARRRRPPAARPRAAAPPAA 979 Score = 25.4 bits (49), Expect(2) = 4.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 / +2 Query: 118 SLRLGSQP*ELAEPPPRSVPP 180 S R + P A PPP S PP Sbjct: 1022 STRAAASPRAAAPPPPASCPP 1084
>LOC_Os11g38590:12011.t03402:unspliced-genomic hypothetical protein| Length = 561 Score = 34.1 bits (68), Expect = 4.1 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = -3 / +3 Query: 247 RCRGSSASDRRAPTGNCASKTSMAERSAAVAPLAPRVDF 131 RCRGS AS R AP G R A+ APR+ F Sbjct: 297 RCRGSCASSRAAPAGGPLRDRRRRGRPVALRGEAPRLFF 413
>LOC_Os11g04267:12011.t00319:unspliced-genomic hypothetical protein| Length = 1854 Score = 34.1 bits (68), Expect = 4.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 / -3 Query: 625 RRLRKEKEPFQRLCFQ*PKAYSHPKLCPST 536 RR + +EP ++C YSHP CP T Sbjct: 529 RRYTRNQEPVAQICRDPHMGYSHPHTCPQT 440
>LOC_Os11g04260:12011.t00318:unspliced-genomic hypothetical protein| Length = 1854 Score = 34.1 bits (68), Expect = 4.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 / -3 Query: 625 RRLRKEKEPFQRLCFQ*PKAYSHPKLCPST 536 RR + +EP ++C YSHP CP T Sbjct: 529 RRYTRNQEPVAQICRDPHMGYSHPHTCPQT 440
>LOC_Os10g06240:12010.t00493:unspliced-genomic transposon protein, putative, unclassified| Length = 2958 Score = 34.1 bits (68), Expect = 4.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 / -3 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR W +R Sbjct: 2491 HLLSEYNLFE*PRPRLWASR 2432
>LOC_Os09g33490:12009.t02925:unspliced-genomic NAC domain-containing protein 18, putative, expressed| Length = 1860 Score = 34.1 bits (68), Expect = 4.1 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = -3 / +2 Query: 247 RCRGSSASDRRAPTGNCASKTS 182 RC S+ S RRAPTG+C S S Sbjct: 680 RCSSSARSRRRAPTGSCTSTAS 745
>LOC_Os09g21810:12009.t01915:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5620 Score = 34.1 bits (68), Expect = 4.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 / -3 Query: 284 RWPRGRPGWTVAPLSWLKRQRSESS 210 RW +GR GW W +RQR +SS Sbjct: 1256 RWQQGRQGWRRQGWKWKQRQRRQSS 1182
>LOC_Os08g02040:12008.t00102:unspliced-genomic expressed protein| Length = 3089 Score = 34.1 bits (68), Expect = 4.1 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 / -2 Query: 359 PWRSTSCTCGPTGEWDDSAALCHTRRWPRGR 267 P R+ GP D AA C +R WPRGR Sbjct: 352 PGRAWRRARGPARRGDGRAARCRSRGWPRGR 260
>LOC_Os07g41920:12007.t03847:unspliced-genomic C1-like domain containing protein| Length = 1773 Score = 34.1 bits (68), Expect = 4.1 Identities = 22/61 (36%), Positives = 28/61 (45%) Frame = +3 / +2 Query: 33 RKVPSSHPWPRALHQSRSQIHPRSPFHSLSSSWKSTLGASGATAALRSAMEVLLAQFPVG 212 R++ +S W + S + SP HS S ST ASG+ AA SA LA P Sbjct: 1172 RQIINSLSWQQRPAIS*PRAGRTSPIHSTRFSRHSTAAASGSRAAATSAASAGLASSPAP 1351 Query: 213 A 215 A Sbjct: 1352 A 1354
>LOC_Os06g08790:12006.t00758:unspliced-genomic origin recognition complex subunit 1, putative, expressed| Length = 7754 Score = 34.1 bits (68), Expect = 4.1 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -3 / -3 Query: 601 PFQRLCFQ*PKAYSHPKLCPSTLSKLESVI*KYASTNPSQRAD 473 P ++ +* +A+ HP LCP S + + * Y NP AD Sbjct: 2763 PPEKCSVK**RAFFHPTLCPLNCSYITCIY*NYMHYNPFNMAD 2635
>LOC_Os12g42780:12012.t03951:unspliced-genomic hypothetical protein| Length = 309 Score = 34.1 bits (68), Expect = 4.1 Identities = 17/65 (26%), Positives = 24/65 (36%) Frame = +1 / -2 Query: 4 GSPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPW 183 G +P P +P P+ P T+ + P S+ S P + P PW Sbjct: 299 GLSSPSPAPTAPAPHPVTAALPWTSSRRLATPPPCSSSPCPAASPPCSSSPHPATPPSPW 120 Query: 184 RSCWR 198 S WR Sbjct: 119 TSSWR 105
>LOC_Os08g38780:12008.t03612:unspliced-genomic nuclear transcription factor Y subunit C-2, putative, expressed| Length = 974 Score = 34.1 bits (68), Expect = 4.1 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = +1 / +3 Query: 61 REPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRS 189 REP+ +P + STP L P PPPRS PP RS Sbjct: 159 REPTPHPSGPTPTRRRSTPRLPPPPPPPPPPPPPPRSRPPPRS 287
>LOC_Os08g19750:12008.t01793:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 8868 Score = 34.1 bits (68), Expect = 4.1 Identities = 21/72 (29%), Positives = 31/72 (43%) Frame = +1 / +3 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRS 189 P PP +SP H R P + + K + VA+ PS + + +A P R P+ Sbjct: 4569 PRPPLRFRQRSPEHRHRRRPDRHRQFKLVGVAVRLPSAAVRASVRFVASPASRRCLPFAP 4748 Query: 190 CWRSSPLELSDR 225 R SP + R Sbjct: 4749 SRRRSPASVRGR 4784
>LOC_Os07g32680:12007.t02950:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1424 Score = 34.1 bits (68), Expect = 4.1 Identities = 18/57 (31%), Positives = 20/57 (35%) Frame = +1 / -3 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 P PPP P+P P+ NP P L P P PPP PP Sbjct: 804 PPPPPPKPPPPPMPPPAPPPAPNPPPWPPPSPLPPPPPNPPPPPTPPPAPPPTPAPP 634
>LOC_Os04g59630:12004.t05419:unspliced-genomic prenylcysteine oxidase precursor, putative, expressed| Length = 552 Score = 34.1 bits (68), Expect = 4.1 Identities = 19/59 (32%), Positives = 25/59 (42%) Frame = -1 / +2 Query: 1575 FDTLHRCALYTHHGAPSLMIPFVWTSVAPTKPASPMTLSSYHRHSSSPGVLPWVAPVSS 1399 FDT++RC + + S P + AP AS S H SS P +PV S Sbjct: 32 FDTIYRCRCRCQYSSSSCSSPRARATAAPATSASWAAASPDHPPPSSSPTTPPPSPVPS 208
>LOC_Os02g22530:12002.t02040:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 897 Score = 34.1 bits (68), Expect = 4.1 Identities = 21/79 (26%), Positives = 29/79 (36%) Frame = +1 / +1 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSCW 195 PPP + P+P P PV +S P+ L P A P W S Sbjct: 556 PPPPAVPAPPVPPAAPTVPAAPAPAPAPVHVSAPTSALSFAPASAARGPASGNGGWLSAT 735 Query: 196 RSSPLELSDRWRLSHDNGA 252 S +LS S ++G+ Sbjct: 736 PSGSRDLSSNSSSSSESGS 792
>LOC_Os01g69030:12001.t06257:unspliced-genomic sucrose-phosphate synthase, putative, expressed| Length = 5783 Score = 34.1 bits (68), Expect = 4.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 / -2 Query: 4 GSPTPPPINIGKSPLPIH 57 GSP PPP G+ PLP+H Sbjct: 460 GSPPPPPATSGRLPLPLH 407
>LOC_Os01g39570:12001.t03484:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 5455 Score = 34.1 bits (68), Expect = 4.1 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +1 / +3 Query: 1549 KCAPVQSVKSIRIAASTVLDSPS 1617 +C P+ VK IRIAA +V+D PS Sbjct: 258 RCTPLIKVKPIRIAAPSVMDKPS 326
>LOC_Os01g17050:12001.t01553:unspliced-genomic VQ, putative, expressed| Length = 1020 Score = 34.1 bits (68), Expect = 4.1 Identities = 17/54 (31%), Positives = 22/54 (40%) Frame = +1 / +1 Query: 25 INIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 I+ +P P ++ P + P L GS P PPRS PPWR Sbjct: 13 IHQATTPSPWRTAASASTPPGPTSPRRLRRRRTTPGSPPPPTTRSPPRSGPPWR 174
>LOC_Os11g16550:12011.t01435:unspliced-genomic expressed protein| Length = 1573 Score = 26.3 bits (51), Expect(2) = 4.1 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 / +3 Query: 152 RSHRRAPFRHGGLAGAVPRWSSPIAGA 232 R H RAP R G A + PR + GA Sbjct: 846 RDHPRAPHRARGRASSAPRVRLLLGGA 926 Score = 24.9 bits (48), Expect(2) = 4.1 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 / +1 Query: 70 STNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSV 174 +T+ + S+ STP+ + P + PPP S+ Sbjct: 694 TTSSSSSSVTTTASTPNSPVTPAPVTASSPPPPSL 798
>LOC_Os09g31300:12009.t02771:unspliced-genomic helix-loop-helix DNA-binding domain containing protein, expressed| Length = 3010 Score = 31.8 bits (63), Expect(2) = 4.3 Identities = 20/64 (31%), Positives = 22/64 (34%) Frame = +1 / +2 Query: 34 GKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSCWRSSPLE 213 G+SP R T S P S +P A PPP PP R W S Sbjct: 1226 GRSPRRRRRRSSRTAASRPSAPATTCRGSSASRRRPRTAASPPPPPPPPRRRRWPPSRSS 1405 Query: 214 LSDR 225 S R Sbjct: 1406 SSSR 1417 Score = 25.4 bits (49), Expect(2) = 4.3 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +1 / +3 Query: 1096 RCLVAALISYCGKTHVYIMNVVGWSRVTCP 1185 +C+ LIS C TH + V + CP Sbjct: 2778 KCIDGCLISVCHSTHQVQVAAVSACKNACP 2867
>LOC_Os09g31462:12009.t02793:unspliced-genomic hypothetical protein| Length = 402 Score = 28.1 bits (55), Expect(2) = 4.5 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 / -3 Query: 157 PPPRSVPPWRSCWRSSP 207 PPP S P RSC RS P Sbjct: 283 PPPPSTPRRRSCARSCP 233 Score = 23.1 bits (44), Expect(2) = 4.5 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 / -1 Query: 225 LALEPRQRCYRPSRATPRPP 284 + L PR+R P R P PP Sbjct: 231 VVLVPRRRGEPPPRCAPPPP 172
>LOC_Os02g02210:12002.t00121:unspliced-genomic aminotransferase y4uB, putative, expressed| Length = 17903 Score = 28.1 bits (55), Expect(2) = 4.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 / +3 Query: 1606 PIPWTRLFE*I*HSAQVRTLHTPWST*PHDPIRVDQ 1499 P PW RLFE + + TL+ T P+ P R+++ Sbjct: 5085 P*PWARLFEQFVNLCRGGTLYPHDITNPNHPARIER 5192 Score = 22.6 bits (43), Expect(2) = 4.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 / +3 Query: 1452 HRHSSSPGVLPWVAPVSS 1399 H SPGVLP P++S Sbjct: 5304 HTVLGSPGVLPDTTPLNS 5357
>LOC_Os05g20240:12005.t01785:unspliced-genomic transposon protein, putative, unclassified| Length = 1187 Score = 32.7 bits (65), Expect(2) = 4.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 / +1 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR W +R Sbjct: 211 HL*SEYNLFE*PRPRLWASR 270 Score = 23.1 bits (44), Expect(2) = 4.6 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +3 / +3 Query: 2007 FKSTQRLLTWPGSHKDPSSIIKEPECSR 2090 F TQ+ + W PSS + C R Sbjct: 630 FSQTQKRILWKMKALVPSSCLPSSACGR 713
>LOC_Os07g24950:12007.t02191:unspliced-genomic hypothetical protein| Length = 336 Score = 27.2 bits (53), Expect(2) = 4.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 / -3 Query: 42 PSSHPWPRALHQSRSQIHPRSPFHSL 119 PSS P PR LH+ + R P H L Sbjct: 292 PSSPPPPRPLHRHPRRRQIRRPLHPL 215 Score = 24.0 bits (46), Expect(2) = 4.6 Identities = 17/54 (31%), Positives = 23/54 (42%) Frame = +3 / -1 Query: 123 SSWKSTLGASGATAALRSAMEVLLAQFPVGALRSLALEPRQRCYRPSRATPRPP 284 S+ +TL A +TAA S + L L L R+R + R P PP Sbjct: 225 STLSATLYALLSTAASTSPLPTSLPLTLSADLPDAGLHHRRRTHSLDRRHPSPP 64
>LOC_Os06g51300:12006.t04813:unspliced-genomic hypothetical protein| Length = 282 Score = 26.3 bits (51), Expect(2) = 4.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 / -1 Query: 96 PRSPFHSLSSSWKSTLGASGATAALRSA 179 PR PFH L++ + L A+ A + RSA Sbjct: 189 PRRPFHRLAACRRRHLIAAAAPSPSRSA 106 Score = 24.9 bits (48), Expect(2) = 4.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 / -3 Query: 15 PSSNQHRKVPSSHPWPRA 68 PS +HR P + P PRA Sbjct: 265 PSRRRHRLAPRAAPLPRA 212
>LOC_Os06g01620:12006.t00059:unspliced-genomic scarecrow-like 6, putative, expressed| Length = 1766 Score = 28.1 bits (55), Expect(2) = 4.8 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = -1 / +2 Query: 1482 PASPMTLSSYHRHSSSPGVLPWVAPVSS*HLPPS 1381 P SP L SSSP PW P PPS Sbjct: 569 PPSPSPLLPSTSRSSSPRTRPWRTPPRPCSSPPS 670 Score = 28.1 bits (55), Expect(2) = 4.8 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -2 / +2 Query: 392 TGQRQRGPWVAPWRSTSCTCGPTGEWDDSAALCHTRRWPRGRP 264 T + +R W W S+SC G + +A C R P RP Sbjct: 1166 TRRARRRTWCPRWSSSSCGHGWSASRSAAATSCLRRCSPCWRP 1294
>LOC_Os03g24339:12003.t02128:unspliced-genomic PWWP domain containing protein, expressed| Length = 19760 Score = 30.4 bits (60), Expect(2) = 4.9 Identities = 17/61 (27%), Positives = 27/61 (44%) Frame = -2 / -2 Query: 2036 PC*KPLSTFECSRKQTKLTYTPSNAIPWHSSMHFLLEQY*LS*HSIPI*QY*LSRYNTII 1857 P KPL CS KQT L I W + L+ + H +P+ L+ ++ ++ Sbjct: 12772 PMLKPLVDILCSSKQTDLHLRGQACITWMIDLKQYLQLFLSRKHYLPLLTDRLNNHHQVV 12593 Query: 1856 Q 1854 Q Sbjct: 12592 Q 12590 Score = 29.0 bits (57), Expect(2) = 4.9 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -1 / -1 Query: 1515 PFVWTSVAPTKPASPMTLSSYHRHSSSPGVLPWVAPVSS*HLPP 1384 P + T A P TL S +S V+ WV PVS H P Sbjct: 6302 PLISTREASLNLTEPRTLGSSSVKNSRRPVM*WVEPVSRYHPSP 6171
>LOC_Os02g54410:12002.t05020:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4957 Score = 31.3 bits (62), Expect(2) = 4.9 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 / +3 Query: 1246 ALSPIPPDTEGYAHALP*PGRRQ*PCEPS 1332 A SP+PP T A A P P RR+ P PS Sbjct: 60 AASPLPPPTSHLAAADPAPRRRRFPPPPS 146 Score = 26.3 bits (51), Expect(2) = 4.9 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 / +2 Query: 1943 CLNAMELHCLVYMLVWFACDYI 2008 CL ++LH ++ L ++ C Y+ Sbjct: 1232 CLKGLQLHPPMFFLSYYICTYV 1297
>LOC_Os08g32370:12008.t02982:unspliced-genomic mucin-associated surface protein, putative| Length = 5752 Score = 27.6 bits (54), Expect(2) = 5.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 / +2 Query: 287 RRWPRGRPGWTVAPLSWLKRQR 222 RRW R RP W +W +R+R Sbjct: 488 RRWRRKRPRWWRWRRTWSRRRR 553 Score = 23.1 bits (44), Expect(2) = 5.0 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -3 / +2 Query: 100 RGWIWLRDWWRAL 62 R W WLR W R L Sbjct: 566 RRWRWLRRWPRRL 604
>LOC_Os01g34680:12001.t03025:unspliced-genomic conserved hypothetical protein| Length = 5782 Score = 26.7 bits (52), Expect(2) = 5.0 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +1 / -2 Query: 328 GPQVQEVDRQGATQGPLCLCPVVARKTTVREERERSHVGPHVIQSALTSP 477 G ++ V + + P C CP +R R R R+ P + +A +P Sbjct: 324 GEELDAVRARRRSSTPSCRCPSASRAARGRACRGRALAHPCIAAAAAPAP 175 Score = 24.0 bits (46), Expect(2) = 5.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +1 / -2 Query: 586 INVGKAPSPFSAVGRKC*RVSIHPLGTVVDTVLP 687 I AP+P+ R C R PL + T +P Sbjct: 201 IAAAAAPAPYRRPHRHCHRYRPRPLPPPLPTAIP 100
>LOC_Os04g44270:12004.t03967:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2599 Score = 30.9 bits (61), Expect(2) = 5.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 1699 LAMGWL*DEWSDDHMSWIGFGSDSDSI 1779 L + WL EW D + W+G + D I Sbjct: 1643 LRLRWLWHEWKDPNKPWVGLDTPCDEI 1723 Score = 25.8 bits (50), Expect(2) = 5.1 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 / +3 Query: 148 LAEPPPRSVPP 180 LA PPPRS PP Sbjct: 342 LASPPPRSPPP 374
>LOC_Os11g37630:12011.t03303:unspliced-genomic conserved hypothetical protein| Length = 4369 Score = 28.1 bits (55), Expect(2) = 5.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 / -1 Query: 91 SIPVALSTPSLRLGSQP*ELAEPP 162 SIP A STP G++P L+ PP Sbjct: 2305 SIPCAASTPCTCSGARPPALSSPP 2234 Score = 22.6 bits (43), Expect(2) = 5.1 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 / -1 Query: 222 SLALEPRQRCYRPSRATPRPP 284 S + PR+RC+R PP Sbjct: 2224 SASSSPRRRCHRSRSPPSSPP 2162
>LOC_Os08g06240:12008.t00514:unspliced-genomic dnajc2 protein, putative, expressed| Length = 3556 Score = 26.3 bits (51), Expect(2) = 5.2 Identities = 16/57 (28%), Positives = 20/57 (35%) Frame = +1 / +3 Query: 16 PPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 PPP P P P+ +S P ++ S P PP S PP R Sbjct: 156 PPPPRRPNRPAPSPTPPPAPPRPWRSSPRRTTSSRTTRSSHPSSSGSRPPSSSPPSR 326 Score = 24.4 bits (47), Expect(2) = 5.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 / +3 Query: 258 PSRATPRPPAGVA*RGR 308 PSR P PPA V R R Sbjct: 402 PSRIPPPPPAAVGARAR 452
>LOC_Os10g40720:12010.t03312:unspliced-genomic beta-expansin 1a precursor, putative, expressed| Length = 1922 Score = 30.4 bits (60), Expect(2) = 5.2 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 / -3 Query: 359 PWRSTSCTCGPTGEWDDSAALC 294 PWR T C G +G W ++ C Sbjct: 768 PWRRTPCRSGRSGTWKRGSSSC 703 Score = 25.8 bits (50), Expect(2) = 5.2 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 / -3 Query: 50 GRGDFPMLIGGGVG 9 G GDFP+ IGG VG Sbjct: 252 GPGDFPVGIGGEVG 211
>LOC_Os04g39170:12004.t03487:unspliced-genomic expressed protein| Length = 3839 Score = 30.9 bits (61), Expect(2) = 5.3 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +1 / +3 Query: 67 PSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRS 189 PST P S + +PS S P PPP PW S Sbjct: 201 PSTPPTPSSARTSAPSPSGSPRSSPPRPRPPPPWGTSPWAS 323 Score = 26.3 bits (51), Expect(2) = 5.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 / +2 Query: 1956 WNCIAWCIC*FGLLATTFKSTQRLL 2030 W+CI C LLA FK++Q++L Sbjct: 2261 WHCIISCDSNKLLLAVVFKTSQQVL 2335
>LOC_Os03g48150:12003.t04174:unspliced-genomic expressed protein| Length = 2703 Score = 28.6 bits (56), Expect(2) = 5.3 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +1 / +3 Query: 43 PLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSV 174 P P H PS +P A P+ P P L+ PPPR++ Sbjct: 2019 PSPSHRSYPSLSP*ALPPPLLSFPPPPPRALPPPLLSRPPPRAL 2150 Score = 22.1 bits (42), Expect(2) = 5.3 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +1 / +1 Query: 157 PPPRSVPP 180 PPPR++PP Sbjct: 2179 PPPRALPP 2202
>LOC_Os10g15310:12010.t01196:unspliced-genomic expressed protein| Length = 2617 Score = 26.3 bits (51), Expect(2) = 5.3 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +1 / -2 Query: 151 AEPPPRSVPPWRSCWRSSPLELSDRWRLSHDNGATVHPGRPR 276 AEP R PP S +E + WR+ + A RPR Sbjct: 213 AEPVARYPPPRLRARHRSAVEEVEPWRIPPTDAALAVARRPR 88 Score = 24.4 bits (47), Expect(2) = 5.3 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 / -1 Query: 52 IHGREPSTNPEAKSIPVA 105 +H +PS+NP S+P A Sbjct: 316 LHRHKPSSNPPLGSLPAA 263
>LOC_Os04g18090:12004.t01556:unspliced-genomic histone H1, putative, expressed| Length = 1014 Score = 29.9 bits (59), Expect(2) = 5.3 Identities = 12/36 (33%), Positives = 14/36 (38%) Frame = -2 / -1 Query: 458 WMTWGPTWXXXXXXLTVVFLATTGQRQRGPWVAPWR 351 W P+W L L RQ PW +PWR Sbjct: 612 WQRRRPSWVWRRPSLASALLPWGRGRQAWPWASPWR 505 Score = 25.4 bits (49), Expect(2) = 5.3 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -2 / -3 Query: 308 SAALCHTRRWPRGRPGW 258 SA+ TR W RGR W Sbjct: 145 SASSAPTRAWQRGRRAW 95
>LOC_Os12g19010:12012.t01749:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2470 Score = 27.6 bits (54), Expect(2) = 5.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 / -3 Query: 225 LALEPRQRCYRPSRATPRPPAG 290 L+ P +R P RA P PPAG Sbjct: 1244 LSAAPPRRAPTPHRAPPAPPAG 1179 Score = 23.1 bits (44), Expect(2) = 5.3 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +1 / -3 Query: 154 EPPPRSVPPWRS 189 +PP PPWRS Sbjct: 1361 QPPAPPPPPWRS 1326
>LOC_Os07g16470:12007.t01507:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2347 Score = 28.1 bits (55), Expect(2) = 5.4 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +1 / -1 Query: 61 REPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 R P + PE+ S +LS PS P PP S PP Sbjct: 358 RRPLSPPESSSRRRSLSPPSPPNSGPPPSSPGPPSPSAPP 239 Score = 22.6 bits (43), Expect(2) = 5.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 / -1 Query: 166 RSVPPWRSCWRSSPLELSDRW 228 R +PP RS + SSP + W Sbjct: 142 RRLPPLRSPFPSSPSTRGEPW 80
>LOC_Os06g42680:12006.t03959:unspliced-genomic phytosulfokines 1 precursor, putative, expressed| Length = 1948 Score = 26.3 bits (51), Expect(2) = 5.4 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 / +1 Query: 1977 IC*FGLLATTFKSTQRLLTWPG 2042 IC FGL T K R+L W G Sbjct: 667 ICTFGL*DTKMKQEHRVLKWRG 732 Score = 24.4 bits (47), Expect(2) = 5.4 Identities = 5/9 (55%), Positives = 8/9 (88%) Frame = +2 / +3 Query: 1964 HCLVYMLVW 1990 HC++YM +W Sbjct: 654 HCIIYMYIW 680
>LOC_Os05g04540:12005.t00350:unspliced-genomic expressed protein| Length = 1755 Score = 27.2 bits (53), Expect(2) = 5.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 / +2 Query: 163 PRSVPPWRSCWRSSPLELSDRWR 231 PR+ WR WR+SP R R Sbjct: 401 PRASSSWRRAWRTSPSRAPRRRR 469 Score = 23.5 bits (45), Expect(2) = 5.5 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 / +2 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPS 120 P PP + + PS+ P A + P A STP+ Sbjct: 245 PAPPAASSSPTTPASRTPSPSSAPPAPTPPWAGSTPT 355
>LOC_Os12g06570:12012.t00542:unspliced-genomic cyclic nucleotide-gated ion channel 18, putative, expressed| Length = 3156 Score = 33.6 bits (67), Expect = 5.6 Identities = 19/43 (44%), Positives = 22/43 (51%) Frame = -3 / +2 Query: 268 ARDGR*HRCRGSSASDRRAPTGNCASKTSMAERSAAVAPLAPR 140 AR R RC SSA+ RAP A TS+A +A A A R Sbjct: 2453 ARATRSARCCSSSAASSRAPPPTAAGPTSLAPSPSAPATSAAR 2581
>LOC_Os11g06870:12011.t00579:unspliced-genomic glyoxal oxidase, putative| Length = 1886 Score = 33.6 bits (67), Expect = 5.6 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 / +1 Query: 241 RGSSASDRRAPTGNCASKTSMAERSAAVAPLAPRVDFQDEEREW 110 RG S+ R+PT C S+T + R + +P P R W Sbjct: 1156 RGGSSGASRSPTRCCTSRTCSSARGSRCSPRQPSRGCTTRRRRW 1287
>LOC_Os10g37180:12010.t02987:unspliced-genomic glycine cleavage system H protein, mitochondrial precursor, putative,| expressed Length = 2118 Score = 33.6 bits (67), Expect = 5.6 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -2 / +3 Query: 1502 PALLQQNLPHP*LSHRTTGIHPPPESC 1422 P LL Q +P+P +S + + I PPP SC Sbjct: 45 PLLLSQTIPYPLISLQLSTILPPPLSC 125
>LOC_Os10g35470:12010.t02843:unspliced-genomic oxidoreductase, putative, expressed| Length = 3887 Score = 33.6 bits (67), Expect = 5.6 Identities = 21/51 (41%), Positives = 24/51 (47%) Frame = -3 / -2 Query: 328 RPASGTTRPRYATPAGGLGVARDGR*HRCRGSSASDRRAPTGNCASKTSMA 176 R + T R + AGG G R GR R R +A RRAP G A T A Sbjct: 424 RRTTRTRRICGSAGAGGGGRCRRGRRRRRRPRAARARRAPRGGAAPPTPAA 272
>LOC_Os08g07810:12008.t00669:unspliced-genomic strictosidine synthase 1 precursor, putative| Length = 1909 Score = 33.6 bits (67), Expect = 5.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 / +2 Query: 946 RWLACLGSNNTPGISAESPRKESPEAVRSRR 854 RW C GS+ + + SPR+ +P RSRR Sbjct: 32 RWSRCCGSSAACFLPSSSPRRRAPPRSRSRR 124
>LOC_Os07g40150:12007.t03676:unspliced-genomic expressed protein| Length = 2407 Score = 33.6 bits (67), Expect = 5.6 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 / -1 Query: 389 GQRQRGPWVAPWRSTSCTCGPTGEWDDSAALCHTRR 282 G RGPW R+T+C G W A C RR Sbjct: 1219 GAGARGPWRRGRRATACGARRGGRWIPRAPCCRRRR 1112
>LOC_Os07g34370:12007.t03113:unspliced-genomic conserved hypothetical protein| Length = 3453 Score = 33.6 bits (67), Expect = 5.6 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = -2 / +2 Query: 1457 RTTGIHPPPESCPGWPLCPHDTCHRRGQTKLSQTGTPGSNNQLGSQGY 1314 RTT PP PG CP T RR +T G + +G + Sbjct: 2819 RTTATPPPSPRAPGRSSCPSSTASRRSIPYRRRTTKRGPRSSVGDSAF 2962
>LOC_Os05g31290:12005.t02725:unspliced-genomic acyl carrier protein, mitochondrial precursor, putative, expressed| Length = 2571 Score = 33.6 bits (67), Expect = 5.6 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -2 / -2 Query: 878 AGSRSLSKGLIGGNGKMVIFNM*QHNENGTNRTCS 774 AG KG +GG G + ++ HN NG N+ CS Sbjct: 2519 AGKDQKRKGPLGGGGGGLSIHLCLHNNNGYNQQCS 2415
>LOC_Os03g15630:12003.t01349:unspliced-genomic harpin-induced protein, putative, expressed| Length = 1248 Score = 33.6 bits (67), Expect = 5.6 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +3 / +1 Query: 1410 GPPRAGLRGRMNAGGTMRESWVR 1478 GPPRAG R R AGG E+ VR Sbjct: 289 GPPRAGRRARRGAGGEAAEAAVR 357
>LOC_Os03g14820:12003.t01268:unspliced-genomic hypothetical protein| Length = 741 Score = 33.6 bits (67), Expect = 5.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 / -3 Query: 1439 PPPESCPGWPLCPHDTC 1389 PPP CP WPL P C Sbjct: 208 PPPRMCPSWPLLPWMRC 158
>LOC_Os02g56680:12002.t05240:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 1788 Score = 33.6 bits (67), Expect = 5.6 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -2 / +1 Query: 332 GPTGEWDDSAALCHTRRWPRGRPGWTVAPLSWLKRQ 225 G +W ++A LC RW G AP WL RQ Sbjct: 85 GQQQQWREAAGLCDRSRWLHWVVGGEGAPHPWLPRQ 192
>LOC_Os01g43460:12001.t03861:unspliced-genomic C4-dicarboxylate transporter/malic acid transport protein, expressed| Length = 2690 Score = 33.6 bits (67), Expect = 5.6 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +3 / +1 Query: 15 PSSNQHRKVPSSHPWPRALHQSRSQIHPRSPFHSLSSS 128 PSS+ P+S PWP + S P SP S SSS Sbjct: 1759 PSSSSSSPPPASPPWPGPRSSASSTTAPASPTSSPSSS 1872
>LOC_Os01g35700:12001.t03122:unspliced-genomic transposon protein, putative, unclassified| Length = 684 Score = 33.6 bits (67), Expect = 5.6 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 / +1 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR W +R Sbjct: 211 HLWSEYNLFE*PRPRLWASR 270
>LOC_Os12g05970:12012.t00483:unspliced-genomic hypothetical protein| Length = 2531 Score = 33.6 bits (67), Expect = 5.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 / +3 Query: 160 PPRSVPPWRSCWRSSPLELSDRWRL 234 PP PP CW P +L+ +WRL Sbjct: 1584 PPHPRPPPPPCWSDLPTDLAGQWRL 1658
>LOC_Os09g25710:12009.t02250:unspliced-genomic WAG22 antigen precursor, putative, expressed| Length = 528 Score = 33.6 bits (67), Expect = 5.6 Identities = 19/55 (34%), Positives = 24/55 (43%) Frame = +1 / -2 Query: 13 TPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 T P ++ P P EP +PEA++ PV TPS P P P S P Sbjct: 266 TDPDLDPEVDPAPATEPEPDPDPEAETPPVPALTPSPSPIPSPIPCPLPKPMSRP 102
>LOC_Os07g37560:12007.t03425:unspliced-genomic myosin-5C, putative, expressed| Length = 8899 Score = 33.6 bits (67), Expect = 5.6 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 / +3 Query: 136 QP*ELAEPPPRSVPPWRSCWR 198 QP +P PR PWRSCWR Sbjct: 42 QPP*WRQPRPRRRAPWRSCWR 104
>LOC_Os07g25810:12007.t02277:unspliced-genomic expressed protein| Length = 1681 Score = 33.6 bits (67), Expect = 5.6 Identities = 20/59 (33%), Positives = 22/59 (37%) Frame = +1 / -3 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 P PPP P P P P+ IP L P R P PPP +PP R Sbjct: 1247 PNPPPPPPPPPPSPPPPPRPPPFPKPPPIPPPLPKPPPRPPPLPKLPPRPPPFPIPPPR 1071 Score = 33.6 bits (67), Expect = 5.6 Identities = 19/59 (32%), Positives = 24/59 (40%) Frame = +1 / -3 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 P PPP + P P +P P P P +L +P PPPR +PP R Sbjct: 1229 PPPPPPSPPPPPRPPPFPKPPPIPPPLPKPPPRPPPLPKLPPRPPPFPIPPPRPLPPPR 1053
>LOC_Os06g20430:12006.t01860:unspliced-genomic lipid binding protein, putative, expressed| Length = 3896 Score = 33.6 bits (67), Expect = 5.6 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 / -3 Query: 103 ALSTPSLRLGSQP*ELAEPPPRSVPPWRSCWRSSP 207 A + PS R G PPPRS PWRS S P Sbjct: 291 APARPSPRRGGAAGSATAPPPRSARPWRSPGPSLP 187
>LOC_Os06g08710:12006.t00750:unspliced-genomic receptor-like protein kinase 5 precursor, putative| Length = 3485 Score = 33.6 bits (67), Expect = 5.6 Identities = 20/72 (27%), Positives = 24/72 (33%) Frame = +1 / -2 Query: 61 REPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSCWRSSPLELSDRWRLSH 240 R P T P +P R PPP + P R+ WR+ R Sbjct: 2002 RAPGTISSGAPSPPPPGSPRRRRAGPTAASLSPPPSTGTPPRTAWRTRRRRCRRRRGAPR 1823 Query: 241 DNGATVHPGRPR 276 GA V P PR Sbjct: 1822 GGGACVSPSPPR 1787
>LOC_Os05g05260:12005.t00416:unspliced-genomic DNA repair helicase UVH6, putative, expressed| Length = 5323 Score = 33.6 bits (67), Expect = 5.6 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 / +2 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 SP PPP S P ST P STP +P PPP PP Sbjct: 422 SPPPPPAPSSPSASPPARTSASTPRPPPPPPATPSTPPAAASPRPGCATGPPPTRTPP 595
>LOC_Os08g37190:12008.t03456:unspliced-genomic transposon protein, putative, unclassified| Length = 1233 Score = 28.1 bits (55), Expect(2) = 5.6 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -3 / +3 Query: 1606 PIPWTRLFE*I*HSAQVRTLHTPWST*PHDPIRVDQ 1499 P PW RLFE + + TL+ T P P R DQ Sbjct: 357 P*PWARLFEQFVNLCRGGTLYPHDITNPDHPARGDQ 464 Score = 22.6 bits (43), Expect(2) = 5.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -1 / +3 Query: 1452 HRHSSSPGVLPWVAPVS 1402 H SPGVLP PV+ Sbjct: 576 HTVPGSPGVLPDTTPVN 626
>LOC_Os11g08390:12011.t00730:unspliced-genomic retrotransposon protein, putative, LINE subclass| Length = 1546 Score = 30.9 bits (61), Expect(2) = 5.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 / +1 Query: 1699 LAMGWL*DEWSDDHMSWIGFGSDSDSIMRI 1788 L + WL +EW +W+G G+ D R+ Sbjct: 850 LRLRWLWNEWRSPEKAWVGSGTPCDDTDRL 939 Score = 24.9 bits (48), Expect(2) = 5.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 / +3 Query: 1 GGSPTPPPINIGKSPLPIHGRE 66 G P PPP+++G P P R+ Sbjct: 168 G*HPIPPPLHLGYRPPPAPVRQ 233
>LOC_Os01g33090:12001.t02879:unspliced-genomic ATP binding protein, putative, expressed| Length = 3045 Score = 29.5 bits (58), Expect(2) = 5.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 / -2 Query: 9 PNPSSNQHRKVPSSHPW 59 P P S+QHR S HPW Sbjct: 1001 PTPCSSQHRGRRSPHPW 951 Score = 27.2 bits (53), Expect(2) = 5.8 Identities = 17/57 (29%), Positives = 25/57 (43%) Frame = +3 / -1 Query: 120 SSSWKSTLGASGATAALRSAMEVLLAQFPVGALRSLALEPRQRCYRPSRATPRPPAG 290 +S S S +TAAL+++ A P A S + R+ R +PRP G Sbjct: 192 ASQSASAPSGSRSTAALKASSACPSAASPPAAAGSASRSSRRSTIRSRTYSPRPRVG 22
>LOC_Os03g01060:12003.t00006:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6406 Score = 32.7 bits (65), Expect(2) = 6.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 / -3 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR W +R Sbjct: 2675 HL*SEYNLFE*PRPRLWASR 2616 Score = 24.9 bits (48), Expect(2) = 6.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 / -1 Query: 160 PPRSVPPWRSCWRSSPLELSDRW 228 P R +PP RS + SSP + W Sbjct: 4201 PRRRLPPLRSPFPSSPSTRGEPW 4133
>LOC_Os12g22839:12012.t004148:unspliced-genomic expressed protein| Length = 855 Score = 32.7 bits (65), Expect(2) = 6.1 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 / +1 Query: 127 DEEREWKGLRGWIWLRDWWRALGHGWEEGTFR 32 ++ R W+ L + LR R +G GWE GT+R Sbjct: 490 EDRRYWRCLFFILILRQRCRPIGAGWETGTYR 585 Score = 22.1 bits (42), Expect(2) = 6.1 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 / +3 Query: 337 PAVRPASGTTRPRYATPAGGLGVARDG 257 P RP+S R R + GG RDG Sbjct: 45 PLSRPSSSFARRRRLSSGGGGDGWRDG 125
>LOC_Os10g01290:12010.t00025:unspliced-genomic CF9, putative, expressed| Length = 1675 Score = 25.8 bits (50), Expect(3) = 6.5 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 / +2 Query: 781 VLLVPFSLCCHILKMTIFPLPP 846 + + F+LC HI T F LPP Sbjct: 1061 IFTICFALCMHISMGTRFLLPP 1126 Score = 24.9 bits (48), Expect(3) = 6.5 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +1 / +3 Query: 148 LAEPPPRSVPPWRSCWRS 201 LAE PPR P WRS Sbjct: 918 LAESPPRPSAPCSISWRS 971 Score = 24.4 bits (47), Expect(3) = 6.5 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 / +3 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKS 93 S PPP + + H PST P +++ Sbjct: 645 STGPPPCRVPLTSCSRHSPTPSTRPSSRT 731
>LOC_Os02g44136:12002.t04005:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 7889 Score = 25.8 bits (50), Expect(2) = 6.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 / -1 Query: 103 ALSTPSLRLGSQP*ELAEPPPRSVPP 180 +L P L L P A PPR PP Sbjct: 557 SLPAPPLSLARTPRARAREPPRRAPP 480 Score = 24.4 bits (47), Expect(2) = 6.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 / -3 Query: 156 ATAALRSAMEVLLAQFPVGALRSLALEPRQRCYRPSRATPR 278 A + +A+ + PV LRS +R +RP+ A PR Sbjct: 363 ADRPVTAAVSLCTRLSPVSPLRSKPPRRHRRRHRPAPAPPR 241
>LOC_Os01g70320:12001.t06333:unspliced-genomic expressed protein| Length = 7123 Score = 25.8 bits (50), Expect(2) = 6.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 / +3 Query: 157 PPPRSVPPWRSCWRSSP 207 PPP PPW + R +P Sbjct: 69 PPPPPPPPWTASARGAP 119 Score = 24.4 bits (47), Expect(2) = 6.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 / +3 Query: 210 GALRSLALEPRQRCYRPSRATPRPP 284 GA + A PR RP+ A P PP Sbjct: 135 GAAAARAPPPRAASPRPTTAPPPPP 209
>LOC_Os06g12260:12006.t01103:unspliced-genomic expressed protein| Length = 6537 Score = 25.4 bits (49), Expect(2) = 6.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +1 / -3 Query: 184 RSCWRSSPLELSDRWRLSHDNGATVHPGRPRG 279 RS WRSS L S R L HP R RG Sbjct: 610 RSGWRSSLLPASLRLHLRLPLDQLSHPERCRG 515 Score = 24.9 bits (48), Expect(2) = 6.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 / -2 Query: 42 PSSHPWPRALHQSRSQIHP 98 P + P P+A+HQ Q HP Sbjct: 689 PVAKPEPQAMHQHCHQHHP 633
>LOC_Os11g01154:12011.t00015:unspliced-genomic trans-2-enoyl-CoA reductase, mitochondrial precursor, putative,| expressed Length = 5453 Score = 25.4 bits (49), Expect(2) = 6.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 / -1 Query: 93 HPRSPFHSLSSSWKST 140 HP P +LSSSW+ T Sbjct: 1688 HPPPPSSTLSSSWQCT 1641 Score = 24.9 bits (48), Expect(2) = 6.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 / -2 Query: 166 RSVPPWRSCWRS 201 +S PPW SC RS Sbjct: 1567 KSTPPWPSCRRS 1532
>LOC_Os01g12550:12001.t01122:unspliced-genomic expressed protein| Length = 5089 Score = 28.1 bits (55), Expect(2) = 6.8 Identities = 17/56 (30%), Positives = 21/56 (37%) Frame = +1 / +1 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 PTP + SP P P + P ++PSL P PPPR P Sbjct: 76 PTPSTPSPPPSPSSPPRPRPQPPPRPRPRPRLPTSPSLSSSPSPPPPPPPPPRLPP 243 Score = 22.1 bits (42), Expect(2) = 6.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 / +1 Query: 157 PPPRSVPPWRSCWRSSP 207 PPP +PP R+ R P Sbjct: 220 PPPPRLPPSRTVGRGWP 270
>LOC_Os02g12690:12002.t01066:unspliced-genomic cytochrome P450 74A4, putative, expressed| Length = 1908 Score = 28.6 bits (56), Expect(2) = 6.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 / -3 Query: 1457 RTTGIHPPPESCPGWPLCP 1401 RT G PPP + P P CP Sbjct: 1498 RTAGTAPPPSAAPPPPPCP 1442 Score = 27.2 bits (53), Expect(2) = 6.9 Identities = 15/47 (31%), Positives = 19/47 (40%) Frame = -3 / -3 Query: 301 RYATPAGGLGVARDGR*HRCRGSSASDRRAPTGNCASKTSMAERSAA 161 R A P G R G CR + A P G+CA+ + AA Sbjct: 1264 RTAAPPCGPRTPRRGSRRPCRAARARTGTPPAGSCAAPPTPPTSPAA 1124
>LOC_Os03g44890:12003.t03873:unspliced-genomic anthranilate phosphoribosyltransferase-like protein, putative,| expressed Length = 3542 Score = 25.4 bits (49), Expect(2) = 6.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 / -1 Query: 365 VAPWRSTSCTCGPTG 321 +A RSTSC GP+G Sbjct: 2636 IAVCRSTSCCAGPSG 2592 Score = 24.9 bits (48), Expect(2) = 6.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -3 / -1 Query: 289 PAGGLGVARDGR*HRCRGSSASDRRAPTG 203 P + V+ DG+ +R SS+ R PTG Sbjct: 2558 PYACISVSHDGQVNRMASSSSPILRTPTG 2472
>LOC_Os10g33450:12010.t02645:unspliced-genomic hypothetical protein| Length = 984 Score = 30.9 bits (61), Expect(2) = 7.0 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 / +1 Query: 597 KGSFSFLSRRSKVLKSEHSPVRNCG 671 K F++R+ ++ S SP+RNCG Sbjct: 853 KDEIEFMARKMMMMMSSSSPLRNCG 927 Score = 24.0 bits (46), Expect(2) = 7.0 Identities = 16/78 (20%), Positives = 25/78 (32%) Frame = +1 / +2 Query: 193 WRSSPLELSDRWRLSHDNGATVHPGRPRGHLRVWHSAAESSHSPVGPQVQEVDRQGATQG 372 WR + R R + P PRG R W ++ ++ + + R A+ Sbjct: 2 WRRTSGLRRPRTRAAARRRRAARPSTPRGRRRRWRTSRRTAGARTSCWSRRSGRASASAP 181 Query: 373 PLCLCPVVARKTTVREER 426 C T R R Sbjct: 182 TRCAASPCPCPATARRGR 235
>LOC_Os04g41030:12004.t03664:unspliced-genomic systemin receptor SR160 precursor, putative, expressed| Length = 2851 Score = 25.4 bits (49), Expect(2) = 7.1 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 / +2 Query: 42 PSSHPWPRALHQSRSQIHPRSPFHSLS 122 PSS P PR+L Q P P H S Sbjct: 44 PSSAPPPRSLVSPPGQTTPPHPHHHAS 124 Score = 24.9 bits (48), Expect(2) = 7.1 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +3 / +3 Query: 180 MEVLLAQFPVGALRSLALEPRQRCYRPSRATPRPPAG 290 + VLLA P A + E RC + +A R P G Sbjct: 150 LAVLLAAAPAAAQSATPREDDVRCLKEVKAELRDPDG 260
>LOC_Os07g49000:12007.t04528:unspliced-genomic heat shock protein binding protein, putative, expressed| Length = 2717 Score = 25.4 bits (49), Expect(2) = 7.1 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +1 / +2 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPS 120 P PPP P P R P T P P A S S Sbjct: 857 PPPPPPLAPPPPAPTCSRLPVTAPTLPPPPPASSAAS 967 Score = 24.9 bits (48), Expect(2) = 7.1 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 / +2 Query: 246 RCYRPSRATPRP 281 RC RP+ A+PRP Sbjct: 1094 RCSRPAAASPRP 1129
>LOC_Os01g68810:12001.t06236:unspliced-genomic expressed protein| Length = 15615 Score = 32.7 bits (65), Expect(2) = 7.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +1 / +2 Query: 157 PPPRSVPPWRSCWRSSPLELSDRW 228 PPP S P RS WR+S + RW Sbjct: 80 PPPPSASPIRSPWRASSTSSAGRW 151 Score = 25.8 bits (50), Expect(2) = 7.1 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 / +1 Query: 719 LRDRSSDSGETNAHIFALSSMFCWYHFHYVVTY*K*PFF 835 L D S + +N F LS F Y+ HY * PFF Sbjct: 2515 LLDCSGNPPLSNWFRFGLSKFFFSYYEHYKGVL*NIPFF 2631
>LOC_Os10g01880:12010.t00084:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2410 Score = 27.2 bits (53), Expect(2) = 7.2 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 / -1 Query: 40 SPLPIHGREPSTNPEAKSIPVALSTP 117 +P HGR PS P + PVA S P Sbjct: 739 TPATFHGRRPSFPPPFPAPPVAGSFP 662 Score = 23.1 bits (44), Expect(2) = 7.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 / -2 Query: 213 ALRSLALEPRQRCYRPSRATPRPPA 287 +LRSL L P + P +P PP+ Sbjct: 639 SLRSLVLAPSRAPPWPHHLSPPPPS 565
>LOC_Os09g39000:12009.t03367:unspliced-genomic F-box protein interaction domain containing protein| Length = 1419 Score = 28.1 bits (55), Expect(2) = 7.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 / -3 Query: 386 QRQRGPWVAPWRSTSCTC 333 +R+R P PWR+ SC C Sbjct: 1192 RRRRTPCAPPWRA*SCCC 1139 Score = 27.2 bits (53), Expect(2) = 7.2 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 / -3 Query: 353 RSTSCTCGPTGEWDDSAALCHTRRWPRGRPGWT 255 R + P G W +AAL R R RPG T Sbjct: 790 RRRTPAAAPGGGWPRTAALARRRGATRRRPGCT 692
>LOC_Os02g52080:12002.t04789:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2297 Score = 25.8 bits (50), Expect(2) = 7.2 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 / -1 Query: 103 ALSTPSLRLGSQP*ELAEPPPRSVPP 180 +L P L L P A PPR PP Sbjct: 548 SLPAPPLSLARTPCARARKPPRRAPP 471 Score = 24.4 bits (47), Expect(2) = 7.2 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +3 / -3 Query: 156 ATAALRSAMEVLLAQFPVGALRSLALEPRQRCYRPSRATPR 278 A + +A+ + PV LRS +R +RP+ A PR Sbjct: 354 ADRPVAAAVSLCTRLSPVSPLRSKPPRRHRRRHRPAPAPPR 232
>LOC_Os03g40070:12003.t03438:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3947 Score = 32.2 bits (64), Expect(2) = 7.2 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -2 / -1 Query: 353 RSTSCTCGPTGEWDDSAALCHTRRWPRGRP 264 RS +C P W + C RWPR P Sbjct: 3422 RSCRPSCSPARRWTSPSRGCRRSRWPRSPP 3333 Score = 24.4 bits (47), Expect(2) = 7.2 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = -3 / -1 Query: 286 AGGLGVARDGR*HRCRGSSASDRRAPTGNCASKTSMAERSAAVAPLAP 143 AGG GR R A RRA G ++ T++ ++VA P Sbjct: 1613 AGGRTEEEHGRASRGAVGGAGRRRAGRGRGSASTALPTTRSSVAVAEP 1470
>LOC_Os03g51330:12003.t04463:unspliced-genomic DELLA protein SLR1, putative, expressed| Length = 2547 Score = 27.6 bits (54), Expect(3) = 7.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 / -3 Query: 287 RRWPRGRPGWTVAPLSWLKRQR 222 R WP G PGW +W + +R Sbjct: 1198 RLWPPGWPGWR*GARTWSRGRR 1133 Score = 24.9 bits (48), Expect(3) = 7.4 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 / -1 Query: 2181 RVMAAEKLYLRQHGLGAAPIHTDL 2110 ++ A + +HGL AAP+H L Sbjct: 1893 KISLAPGIVAERHGLEAAPLHQGL 1822 Score = 23.5 bits (45), Expect(3) = 7.4 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -3 / -3 Query: 88 WLRDWWRALGHGWEEGTFR 32 W R WR H W GT R Sbjct: 772 WRRWRWRWRRHAWGVGTAR 716
>LOC_Os01g24560:12001.t02177:unspliced-genomic bromelain precursor, putative, expressed| Length = 1478 Score = 25.4 bits (49), Expect(2) = 7.4 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -3 / +3 Query: 337 PAVRPASGTTRPRYATPAGGLGVARDGR*HRCRGSSASDRRAPT 206 P RPA T R A GG G + S+S APT Sbjct: 456 PRRRPAPSTPSGRPAASTGGSGAPSPASRTKAPAVSSSPSPAPT 587 Score = 24.9 bits (48), Expect(2) = 7.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -2 / +3 Query: 380 QRGPWVAPWRSTSCTCGPT 324 +R P PW STS PT Sbjct: 357 RRSPTTPPWGSTSSPTSPT 413
>LOC_Os08g33290:12008.t03071:unspliced-genomic hypothetical protein| Length = 2067 Score = 28.6 bits (56), Expect(2) = 7.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 / +3 Query: 24 NQHRKVPSSHPWP 62 N H +VP HPWP Sbjct: 21 NSHCRVPPDHPWP 59 Score = 27.2 bits (53), Expect(2) = 7.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 / +3 Query: 145 ELAEPPPRSVPPWRSCWRSSPLELS 219 ++ PPP S WR+ PL LS Sbjct: 1653 QIEAPPPSSGASGHDSWRADPLPLS 1727
>LOC_Os02g56520:12002.t05224:unspliced-genomic expressed protein| Length = 4154 Score = 31.3 bits (62), Expect(2) = 7.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 / -2 Query: 281 WPRGRPGWTVAPLSWLKRQRSESSNGELRQQ 189 WP G WT AP W R + SS R++ Sbjct: 202 WPSGSTTWTTAPRRWAWRAWTPSSPSRQRRR 110 Score = 25.4 bits (49), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 / -2 Query: 1708 PWLTYRHLMSAQ 1673 PWL Y HL+ AQ Sbjct: 1558 PWLYYSHLLEAQ 1523
>LOC_Os11g47560:12011.t04251:unspliced-genomic xylanase inhibitor protein 2 precursor, putative, expressed| Length = 1095 Score = 33.1 bits (66), Expect = 7.7 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = -2 / -3 Query: 1439 PPPESCPGWPLCPHDTCHRRGQTKLSQTGTPGSNNQLGSQGYCR 1308 PPP CPG P + RRG+ Q G + CR Sbjct: 610 PPPSGCPGTRTSPSPSAARRGRAAAGQAARSGRRRPGR*RSRCR 479
>LOC_Os11g09680:12011.t00860:unspliced-genomic expressed protein| Length = 2444 Score = 33.1 bits (66), Expect = 7.7 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 / +1 Query: 2147 CLR*SFSAAITLVIYLVRLIYPLTEK 2224 CLR*SFS + + Y+ RL++P +K Sbjct: 1480 CLR*SFSVTLDFICYVQRLVWPGVQK 1557
>LOC_Os10g34560:12010.t02751:unspliced-genomic hypothetical protein| Length = 627 Score = 33.1 bits (66), Expect = 7.7 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = -3 / -2 Query: 325 PASGTTRPRYATPAGGLGVARDGR*HRCRGSSASDRRAPT 206 P SGTTR R ATP R GR R + RRAP+ Sbjct: 458 PISGTTRTRPATPPRAAARRRGGRARRRTARWWAARRAPS 339
>LOC_Os08g01910:12008.t00090:unspliced-genomic expressed protein| Length = 1265 Score = 33.1 bits (66), Expect = 7.7 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -3 / +2 Query: 322 ASGTTRPRYATPAGGLGVARDGR*HRCRGSSASDRRAPTGNCASKTS 182 ++ T + +T +G A R R SS RR P+G CA+ TS Sbjct: 602 SASATTSKASTASGATSAASAWRPPRWTSSSRRRRRRPSGGCAASTS 742
>LOC_Os07g46920:12007.t04328:unspliced-genomic sex determination protein tasselseed-2, putative, expressed| Length = 2375 Score = 33.1 bits (66), Expect = 7.7 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 / +1 Query: 413 TVVFLATTGQRQRGPWVAPWRSTSCTCGPT 324 T ++ T +R R PW +PWR+T+ + T Sbjct: 1459 TPAAMSPTRRRSRRPWTSPWRATAASTSCT 1548
>LOC_Os06g13990:12006.t01274:unspliced-genomic F-box domain containing protein| Length = 1549 Score = 33.1 bits (66), Expect = 7.7 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -3 / -1 Query: 199 CASKTSMAERSAAVAPLAPRVDFQDEEREWKGLRGWIWL 83 C+S +S A RS+ + AP D R W RG W+ Sbjct: 466 CSSTSSAAARSSGCSSSAPASPAADPRRSWGPTRGAAWV 350
>LOC_Os06g03220:12006.t00215:unspliced-genomic expressed protein| Length = 1499 Score = 33.1 bits (66), Expect = 7.7 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -3 / +3 Query: 2173 GSGKALSKAAWSWCCSNPHR 2114 GS K S WSWC S+P R Sbjct: 1035 GSNKRTSSTCWSWCTSSPPR 1094
>LOC_Os06g01760:12006.t00072:unspliced-genomic aldehyde dehydrogenase, putative, expressed| Length = 2870 Score = 33.1 bits (66), Expect = 7.7 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -3 / +1 Query: 340 APAVRPASGTTRPRYATPAGGLGVARDGR*HRCRGSSASDRRAPTGNCASKTS 182 +P P+ +TR T G +R R RCRG + + R+P C S +S Sbjct: 2059 SPPRSPSRASTRGPAPTSRGCPPASRRRRASRCRGRTMAPARSPRTRCPSTSS 2217
>LOC_Os05g39520:12005.t03493:unspliced-genomic ankyrin-like protein, putative, expressed| Length = 4529 Score = 33.1 bits (66), Expect = 7.7 Identities = 23/77 (29%), Positives = 28/77 (36%) Frame = -3 / -1 Query: 316 GTTRPRYATPAGGLGVARDGR*HRCRGSSASDRRAPTGNCASKTSMAERSAAVAPLAPRV 137 G R R G G R GR R RG A+ R CA + S P P Sbjct: 473 GGRRGRRGIARRGRGRGRRGRGARRRGGRATARGGRAAACAGRRWARPSSLLPPPPPP*R 294 Query: 136 DFQDEEREWKGLRGWIW 86 D + ER+ + W W Sbjct: 293 DAGEAERDRRRWWRWWW 243
>LOC_Os04g35190:12004.t03190:unspliced-genomic F-box only protein 9, putative, expressed| Length = 5270 Score = 33.1 bits (66), Expect = 7.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 / +1 Query: 1919 NIALIKNACLNAMELHCLVYMLVWFACDYIQKY 2017 N L +NACL ++ + +LV F CD + KY Sbjct: 1453 NPTLWRNACLKTWQVSLHISILVGFVCDVLLKY 1551
>LOC_Os03g15690:12003.t01355:unspliced-genomic phosphate carrier protein, mitochondrial precursor, putative,| expressed Length = 3592 Score = 33.1 bits (66), Expect = 7.7 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -3 / -3 Query: 340 APAVRPASGTTRPRYATPAGGLGVARDGR*HRCRGSSASDRR 215 AP + R R A P GG G A CRGS DRR Sbjct: 425 APPPTSSRAARRWRRARPGGGRGAAAPVSSRPCRGSPCGDRR 300
>LOC_Os02g53890:12002.t04968:unspliced-genomic hypothetical protein| Length = 381 Score = 33.1 bits (66), Expect = 7.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 / +2 Query: 287 RRWPRGRPGWTVAPLSWLKRQRSESSNGELR 195 RRW GR W A W++R+ + + +G R Sbjct: 245 RRWRSGRGRWAAAAAEWMRRRYAATGSGVRR 337
>LOC_Os01g54990:12001.t04912:unspliced-genomic auxin response factor 4, putative, expressed| Length = 6039 Score = 33.1 bits (66), Expect = 7.7 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +3 / -2 Query: 198 QFPVGALRSLALEPRQRCYRPSRATPRPPAGVA*RGRVVPLAGR 329 + P+ + A PRQR +RPS P+ PA R RV+ A R Sbjct: 623 EVPLRQVHDRAAPPRQRHHRPSARVPQIPAHRPRRRRVLLAAAR 492
>LOC_Os01g07760:12001.t00656:unspliced-genomic phospholipase D alpha 1 precursor, putative, expressed| Length = 4970 Score = 33.1 bits (66), Expect = 7.7 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = -2 / +2 Query: 1442 HPPPESCPGWPLCPHDTCHRRGQTKLSQTG 1353 H P S P CP + HRRG T L G Sbjct: 4244 HGPASSAPSRITCPPSSPHRRGSTTLQSAG 4333
>LOC_Os12g44300:12012.t04096:unspliced-genomic monovalent cation proton antiporter, putative, expressed| Length = 2749 Score = 33.1 bits (66), Expect = 7.7 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +1 / +2 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 PTPP SP P R + A + TPS P PPPRS P Sbjct: 296 PTPPSPTPASSPPPSSSRSSTPPSCAPPPASSTRTPSAPSSPSPPPSPTPPPRSSP 463
>LOC_Os11g30510:12011.t02654:unspliced-genomic hypothetical protein| Length = 1762 Score = 33.1 bits (66), Expect = 7.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 / +3 Query: 835 PLPPISPFESERLPAIPSA 891 PLPP SP+ RLP PSA Sbjct: 1497 PLPPCSPYRHRRLPPYPSA 1553
>LOC_Os10g30890:12010.t02420:unspliced-genomic expressed protein| Length = 2121 Score = 33.1 bits (66), Expect = 7.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +1 / -3 Query: 157 PPPRSVPPWRSCWRS 201 PPP S PWRS WRS Sbjct: 1399 PPPSSSAPWRSWWRS 1355
>LOC_Os08g01990:12008.t00098:unspliced-genomic hypothetical protein| Length = 552 Score = 33.1 bits (66), Expect = 7.7 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 / -2 Query: 157 PPPRSVPPWRSCWRSSPLELSDRWRLS 237 PPP + PP +C SSPL+ DR R S Sbjct: 197 PPPLASPPPSTCAASSPLDALDRSRWS 117
>LOC_Os06g12040:12006.t01081:unspliced-genomic mTERF family protein, expressed| Length = 1717 Score = 33.1 bits (66), Expect = 7.7 Identities = 21/66 (31%), Positives = 26/66 (39%) Frame = +1 / +3 Query: 7 SPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWR 186 SP P + S P REP S P + P+ S + P R+ PPW Sbjct: 243 SPRNPSPSRTTSSTPAA*REPEPRRPPGSSPTSGPPPTPMPSSPSSPASASPARTSPPWS 422 Query: 187 SCWRSS 204 S RSS Sbjct: 423 STTRSS 440
>LOC_Os04g38930:12004.t03463:unspliced-genomic tetratricopeptide-like helical, putative, expressed| Length = 1830 Score = 33.1 bits (66), Expect = 7.7 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +1 / +3 Query: 4 GSPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP 141 G+ PPP + PLP+ P A P+ L P RL S P Sbjct: 204 GTAPPPPPRLHLRPLPLPPPPQPALPPAPPAPLPLPPPPRRLSSGP 341
>LOC_Os04g38330:12004.t03404:unspliced-genomic lipoic acid synthetase, mitochondrial precursor, putative,| expressed Length = 3726 Score = 33.1 bits (66), Expect = 7.7 Identities = 20/65 (30%), Positives = 23/65 (35%) Frame = +1 / +1 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRS 189 P P + G P P P P +P R S+P PPPR P R Sbjct: 76 PPPAVVRSGPQPCTAAATSPPPWPAP*PTPPPAPSPPPRRSSKPSTRPRPPPRPPRPPRG 255 Query: 190 CWRSS 204 RSS Sbjct: 256 GSRSS 270
>LOC_Os03g51380:12003.t04467:unspliced-genomic expressed protein| Length = 3813 Score = 33.1 bits (66), Expect = 7.7 Identities = 16/50 (32%), Positives = 20/50 (40%) Frame = +1 / +1 Query: 43 PLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRSC 192 P P R PS P + S + P+ S P + PP S P R C Sbjct: 265 PPPPPLRSPSPTPTSSSASTSTPAPTTTRTSTPARITAPPSTSTSPRRPC 414
>LOC_Os03g16970:12003.t01478:unspliced-genomic expressed protein| Length = 639 Score = 33.1 bits (66), Expect = 7.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 / +1 Query: 133 SQP*ELAEPPPRSVPPWRSCWRSSPLELSDRWR 231 S P A PP + PP +C+R LE + W+ Sbjct: 442 SSPSRAARGPPPTAPPMLACFRCQDLEKDETWQ 540
>LOC_Os01g70930:12001.t06390:unspliced-genomic flavonol synthase/flavanone 3-hydroxylase, putative, expressed| Length = 1857 Score = 33.1 bits (66), Expect = 7.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 / -3 Query: 7 SPTPPPINIGKSPLPIHGREPSTN 78 +P+PP + SP P+HG +P+TN Sbjct: 604 TPSPPSPSPPSSPPPLHGSQPTTN 533
>LOC_Os01g21320:12001.t01869:unspliced-genomic UDP-glucuronic acid decarboxylase 1, putative, expressed| Length = 4053 Score = 33.1 bits (66), Expect = 7.7 Identities = 20/60 (33%), Positives = 23/60 (38%) Frame = +1 / +2 Query: 1 GGSPTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPP 180 G +P PP SP P PST P + S + PS P PPP PP Sbjct: 212 GSTPPSPPSRSPGSPAPPATPPPSTAPPSPSPGCSSPPPSSPSTPLPPTPHPPPPPPPPP 391
>LOC_Os01g13430:12001.t01205:unspliced-genomic importin-alpha re-exporter, putative, expressed| Length = 5184 Score = 33.1 bits (66), Expect = 7.7 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +1 / +3 Query: 61 REPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRS 171 R P T P A A S PS R GS A PPPR+ Sbjct: 189 RSPRTPPRAAPPSRASSRPSARRGSGSRSSASPPPRA 299
>LOC_Os01g06479:12001.t00531:unspliced-genomic expressed protein| Length = 911 Score = 26.3 bits (51), Expect(2) = 7.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 / -3 Query: 157 PPPRSVPPWRSCWRSS 204 PP + PPW WR S Sbjct: 480 PPRTAPPPWTRSWRRS 433 Score = 24.0 bits (46), Expect(2) = 7.7 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 / -3 Query: 6 KPNPSSNQHRKVPSSHPWP 62 +P P S + SS PWP Sbjct: 654 RPRPPSAASSRATSSPPWP 598
>LOC_Os05g09520:12005.t00828:unspliced-genomic IQ calmodulin-binding motif family protein, expressed| Length = 1580 Score = 28.1 bits (55), Expect(2) = 7.9 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +3 / -1 Query: 51 HPWPRALHQSRSQIHPRSPFHSLSSSWKSTLGASGATAALR 173 HP RALH +Q P H L+ A A LR Sbjct: 1478 HPVARALHAHAAQARPGLHHHHLAQRHPLPAAAGAGAAGLR 1356 Score = 27.2 bits (53), Expect(2) = 7.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 / -3 Query: 1609 SPSRPH*MVNHINDNNDGRTR 1671 SP+R H M+N D++D TR Sbjct: 534 SPARTHAMINDNGDDDDDETR 472
>LOC_Os02g47030:12002.t04289:unspliced-genomic expressed protein| Length = 1581 Score = 29.5 bits (58), Expect(2) = 7.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 / -1 Query: 19 PPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLR 126 PP+ SP +H R+PS++ +S PS R Sbjct: 906 PPLPTSSSPCQVHRRQPSSHSPMSQTYGPISAPS*R 799 Score = 25.8 bits (50), Expect(2) = 7.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 / -3 Query: 187 SCWRSSPLELSDRWR 231 S WR +P+ S RWR Sbjct: 427 SAWRVAPVSASTRWR 383
>LOC_Os10g24310:12010.t01856:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 8957 Score = 32.7 bits (65), Expect(2) = 8.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 / -2 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR W +R Sbjct: 5356 HL*SEYNLFE*PRPRLWASR 5297 Score = 24.9 bits (48), Expect(2) = 8.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 / -1 Query: 160 PPRSVPPWRSCWRSSPLELSDRW 228 P R +PP RS + SSP + W Sbjct: 6875 PRRRLPPLRSPFPSSPSTRGEPW 6807
>LOC_Os03g42654:12003.t03667:unspliced-genomic conserved hypothetical protein| Length = 495 Score = 26.3 bits (51), Expect(2) = 8.1 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +1 / +2 Query: 157 PPPRSVPPW 183 PPPR +PPW Sbjct: 164 PPPRHLPPW 190 Score = 24.0 bits (46), Expect(2) = 8.1 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = +1 / +1 Query: 10 PTPPPINIGKSPLPIHGREPSTNP 81 P PP ++ +P+P+ +T+P Sbjct: 109 PAPPTRSLATAPMPVATSPTATSP 180
>LOC_Os07g20430:12007.t01847:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9176 Score = 32.7 bits (65), Expect(2) = 8.2 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +2 / -2 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*PRPR W +R Sbjct: 1573 HL*SEYNLFE*PRPRLWASR 1514 Score = 24.9 bits (48), Expect(2) = 8.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 / -3 Query: 639 KSEHSPVRNCGGHCFAHLTP*RTNARIFATVAPIQVKPTLT 761 +S+H PV + C +T R AR + Q+ TLT Sbjct: 8910 RSQHGPVVDPDSTCRLPVTKSRCTARTALSARSTQLPETLT 8788
>LOC_Os06g32080:12006.t02906:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6709 Score = 29.9 bits (59), Expect(2) = 8.5 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 / +1 Query: 1556 HLCRVSNLFE*PRPRYWTAR 1615 HL NLFE*P PR W +R Sbjct: 5146 HL*SEYNLFE*PSPRLWASR 5205 Score = 27.2 bits (53), Expect(2) = 8.5 Identities = 16/59 (27%), Positives = 24/59 (40%) Frame = +3 / +2 Query: 99 RSPFHSLSSSWKSTLGASGATAALRSAMEVLLAQFPVGALRSLALEPRQRCYRPSRATP 275 R P H L + S + RSA+ +++ RS+ R+RC SR P Sbjct: 3515 R*PLHPLRRVAADPVRRSASPVDRRSAVAIVIPSRAAAFFRSVRRSRRRRCPGVSRGPP 3691
>LOC_Os03g22590:12003.t02009:unspliced-genomic MTN3, putative, expressed| Length = 3430 Score = 32.7 bits (65), Expect(2) = 8.6 Identities = 18/55 (32%), Positives = 21/55 (38%) Frame = +1 / +1 Query: 13 TPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVP 177 +PP + S PST+P S P PS S P* PP S P Sbjct: 661 SPPTSSSSPSTPSAASSSPSTSPSTSSTPPGRPWPSPSSSSAP*TSPSSPPSSPP 825 Score = 23.5 bits (45), Expect(2) = 8.6 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +3 / +1 Query: 1536 HGVCKVRTCAECQIYS 1583 H CK+ EC+ YS Sbjct: 2386 HVTCKISILVECKFYS 2433
>LOC_Os11g41034:12011.t004377:unspliced-genomic expressed protein| Length = 8674 Score = 27.6 bits (54), Expect(2) = 8.6 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 / +3 Query: 10 PTPPPINIGKSPLPIHGREPSTNPEAKSIPVALSTP 117 P PPP+ P+ R S+ P A+ AL++P Sbjct: 5859 PPPPPLASPPPRSPLRRRLASSTPVARLAAAALASP 5966 Score = 22.1 bits (42), Expect(2) = 8.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 / +3 Query: 161 RRAPFRHGGLAGAVPRWSS 217 RR+P R A A+PR +S Sbjct: 5991 RRSPRRRASSAAALPRLAS 6047
>LOC_Os01g11040:12001.t00977:unspliced-genomic SCAR-like protein 2, putative, expressed| Length = 7620 Score = 25.4 bits (49), Expect(2) = 8.7 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = +1 / -3 Query: 67 PSTNPEAKSIPVALSTPSLRLGSQP*ELAEPPPRSVPPWRS 189 P+T + S + S P P PPP PP+RS Sbjct: 493 PATATPSSSALGSASPPFFAAAPTPPPPPPPPPPPPPPYRS 371 Score = 24.4 bits (47), Expect(2) = 8.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 / -2 Query: 231 LEPRQRCYRPSRATPRPPAG 290 LEP QR P+ + PP+G Sbjct: 341 LEPHQRHLPPTSTSTSPPSG 282
>LOC_Os01g37750:12001.t03314:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1035 Score = 25.8 bits (50), Expect(3) = 8.7 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 / +1 Query: 1506 WTSVAPTKPASPMTLSSYHRHSSSPGVLPWVAPVSS 1399 WTS A +SP T S+ SSS P +P SS Sbjct: 235 WTSPARATSSSPPTPSTPRSPSSSTPGGPSASPCSS 342 Score = 24.4 bits (47), Expect(3) = 8.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 / +1 Query: 247 RCRGSSASDRRAPTG 203 RCR S+AS RRA G Sbjct: 772 RCRRSNASSRRARRG 816 Score = 23.1 bits (44), Expect(3) = 8.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -3 / +1 Query: 337 PAVRPASGTTRPRYATPAGGLGVARDGR 254 PA PASG + AGG G GR Sbjct: 430 PAPSPASGPPSSTASC*AGGWGSTTAGR 513
>LOC_Os07g36610:12007.t03332:unspliced-genomic CSLF9 - cellulose synthase-like family F; beta1,3;1,4 glucan| synthase, expressed Length = 6989 Score = 31.8 bits (63), Expect(2) = 8.8 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 / -1 Query: 76 WWRALGHGWEEGTFR 32 WWRA GH W+ G R Sbjct: 2321 WWRAAGHTWQRGQAR 2277 Score = 25.4 bits (49), Expect(2) = 8.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 / -3 Query: 250 HRCRGSSASDRRAPTGNCAS 191 H CRGS A RR P + A+ Sbjct: 5697 HTCRGSPAPWRRRPPASTAA 5638
>LOC_Os09g30320:12009.t02710:unspliced-genomic BURP domain containing protein, expressed| Length = 1798 Score = 28.6 bits (56), Expect(2) = 8.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 / -1 Query: 1580 IDLTLCTGAHFTHTMEHL 1527 I L T AHFTHT++H+ Sbjct: 1714 ITLQTVTNAHFTHTIKHV 1661 Score = 26.7 bits (52), Expect(2) = 8.8 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 / -1 Query: 289 PAGGLGVARDGR*HRCRGSSA 227 PAG +GVA DG HR ++A Sbjct: 1483 PAGRVGVAHDGGDHRVPAAAA 1421
>LOC_Os08g30780:12008.t02829:unspliced-genomic ATATH3, putative| Length = 6551 Score = 26.7 bits (52), Expect(2) = 8.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 / -3 Query: 112 TPSLRLGSQP*ELAEPPPRSVPP 180 TPS R G+ PPPR+ PP Sbjct: 6360 TPSPRRGTAAPPRVPPPPRAPPP 6292 Score = 23.1 bits (44), Expect(2) = 8.9 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 / -3 Query: 10 PTPPPINIGKSPLPIHGREPS 72 PTPPP P P R P+ Sbjct: 6471 PTPPPAPPAAPPPPRPARRPA 6409
>LOC_Os04g06790:12004.t00554:unspliced-genomic cupin, RmlC-type, putative, expressed| Length = 6309 Score = 26.7 bits (52), Expect(2) = 8.9 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 / +1 Query: 222 SLALEPRQRCYRPSRATPRP 281 S + P +R +RPS A+PRP Sbjct: 73 SFSAPPPRRRFRPSLASPRP 132 Score = 23.1 bits (44), Expect(2) = 8.9 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +1 / +3 Query: 157 PPPRSVPPWRSCWRSSP 207 PPP PP C SSP Sbjct: 48 PPPPPPPPLLLCASSSP 98
>LOC_Os12g31880:12012.t02891:unspliced-genomic eukaryotic translation initiation factor 5B, putative, expressed| Length = 5897 Score = 26.3 bits (51), Expect(2) = 8.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 / -1 Query: 243 QRCYRPSRATPRPPAG 290 +R YRP R P PP G Sbjct: 5345 RRRYRPQRPAPLPPGG 5298 Score = 23.5 bits (45), Expect(2) = 8.9 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +3 / -1 Query: 117 LSSSWKSTLGASGATAALRSAMEVLLAQFPVGALRSLALEPRQR 248 +S W + +G A RS + LLA G R +A RQR Sbjct: 5528 VSGVWLQQVARTGNGAPRRSLLLPLLAGDQPGHQRPVAHPERQR 5397 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 981,867,269 Number of extensions: 17854652 Number of successful extensions: 114719 Number of sequences better than 10.0: 272 Length of query: 746 Length of database: 55,613,886 Length adjustment: 52 Effective length of query: 694 Effective length of database: 52,687,430 Effective search space: 36565076420 Effective search space used: 36565076420 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)