ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf70o15 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g01030:12002.t00003:unspliced-genomic hsc70-interacting protein, putative, expressed| Length = 4538 Score = 108 bits (231), Expect(11) = e-103 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 / +1 Query: 696 INPDSAKGYKTRGMANAMLGKWEEAARDLHAASNIDYDDEINAVLKKVE 842 INPDSAKGYKTRGMA AMLGKWEEAA DLH ASN+DYDDEINAVLKKV+ Sbjct: 1297 INPDSAKGYKTRGMAYAMLGKWEEAAHDLHTASNMDYDDEINAVLKKVD 1443 Score = 73.5 bits (154), Expect(11) = e-103 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 / +1 Query: 108 AIAMDPSKLGELRSFVDACKKDPSILADPALAFFRDY 218 A AMD S++GELR+FV+ACKKDPS+LADP LAFFRDY Sbjct: 79 ADAMDASRVGELRTFVEACKKDPSLLADPNLAFFRDY 189 Score = 65.7 bits (137), Expect(11) = e-103 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 / +1 Query: 1389 VMSNPANLAKHQANPKVGPIIAKMMAKMNGNR* 1487 VM+NPA+ A+HQANPKVGPIIAKMMAK NG++* Sbjct: 4066 VMNNPASFARHQANPKVGPIIAKMMAKFNGSQ* 4164 Score = 62.9 bits (131), Expect(11) = e-103 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 / +2 Query: 459 KMGDSSVEVTEENRDASQEAKGQAMEAMSEGKL 557 +MGD S++VTEENRDASQEAK +AMEAMSEG L Sbjct: 557 QMGDPSIDVTEENRDASQEAKSKAMEAMSEGAL 655 Score = 59.7 bits (124), Expect(11) = e-103 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 / +2 Query: 549 GKLEEAVEHLTKAILLNPTSAIMYGTR 629 GKLEEA++HLTKAILLNP SAIMYGTR Sbjct: 746 GKLEEAIDHLTKAILLNPLSAIMYGTR 826 Score = 53.3 bits (110), Expect(11) = e-103 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +2 / +3 Query: 629 SICVYQNEKARCCHP*CECCSRDQ 700 S CVYQNE+ CCHP*C+CCSR + Sbjct: 918 SFCVYQNEETCCCHP*CKCCSRGE 989 Score = 47.3 bits (97), Expect(11) = e-103 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +3 / +1 Query: 1332 DPDLMSAFGDPEVMAALQDVM 1394 DPDLM+AFGDPEVMAALQD M Sbjct: 2266 DPDLMAAFGDPEVMAALQDGM 2328 Score = 35.0 bits (70), Expect(11) = e-103 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 / +2 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWW 1096 W RW R W+AWWLPW W Sbjct: 2057 WRFPRWYAWWRFPRWDAWWLPWGCYAW 2137 Score = 32.7 bits (65), Expect(11) = e-103 Identities = 15/23 (65%), Positives = 15/23 (65%) Frame = +2 / +2 Query: 941 CRGAGCL**GQEEGRIIKPLIRR 1009 C GCL* GQ EG IIK LI R Sbjct: 1922 CFSTGCL*QGQAEGAIIKSLIGR 1990 Score = 29.5 bits (58), Expect(11) = e-103 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = +2 / +2 Query: 836 GGA*CTQDSGASQ 874 GGA*CTQD+G SQ Sbjct: 1517 GGA*CTQDNGTSQ 1555 Score = 24.9 bits (48), Expect(11) = e-103 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 / +2 Query: 1274 WYAWSWRCSR*C*YG*HLE 1330 W ++WRCS C Y *+ E Sbjct: 2120 WGCYAWRCSWECRYE*NSE 2176 Score = 85.4 bits (180), Expect(10) = 9e-75 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = -2 / -1 Query: 841 STFLRTALISSS*SMFDAACRSRAASSHLPSMALAIPRVL*PFAESGLI 695 STFL TALISSS*SMFDA RS AASSH PS+A AIPRVL*PFAESGLI Sbjct: 1442 STFLSTALISSS*SMFDAV*RSWAASSHFPSIA*AIPRVL*PFAESGLI 1296 Score = 58.8 bits (122), Expect(10) = 9e-75 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = -2 / -1 Query: 1477 PFILAIILAMMGPTFGLAWCLAKLAGLLIT 1388 P AII AMMGPT GLAWCLAKLAGL IT Sbjct: 4154 PLNFAIIFAMMGPTLGLAWCLAKLAGLFIT 4065 Score = 49.6 bits (102), Expect(10) = 9e-75 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = -2 / -3 Query: 628 LVPYMIAEVGFSSIALVRCSTASSSFPSDIASIAW 524 LVPYMIAE G SSIA VR S ASSSFP + W Sbjct: 825 LVPYMIAESGLSSIAFVRWSIASSSFPDKQCHM*W 721 Score = 48.7 bits (100), Expect(10) = 9e-75 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -1 / -2 Query: 548 F*HCFHCLALCFLGGVTVLLGHLNRRVTHL 459 F*HCFH LA L G+T+ LG +NRR++HL Sbjct: 646 F*HCFHGLAFGLL*GITIFLGDINRRISHL 557 Score = 46.9 bits (96), Expect(10) = 9e-75 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -3 / -2 Query: 693 LEQHSHHGWQQRAFSF**TQMLWYHT 616 LEQH HHGWQQ+ SF**TQ L HT Sbjct: 982 LEQHLHHGWQQQVSSF**TQKLHKHT 905 Score = 45.5 bits (93), Expect(10) = 9e-75 Identities = 18/31 (58%), Positives = 20/31 (64%) Frame = -3 / -3 Query: 924 HAQXXXXXXXXSAYHTSCDAPLSCVH*APPS 832 HAQ +A H SCD PLSCVH*APP+ Sbjct: 1605 HAQLSFLPSLFAAVHISCDVPLSCVH*APPA 1513 Score = 40.5 bits (82), Expect(10) = 9e-75 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 / -1 Query: 1393 ITS*RAAITSGSPNADIRSGS 1331 I S*RAAITSGSPNA IRSGS Sbjct: 2327 IPS*RAAITSGSPNAAIRSGS 2265 Score = 38.2 bits (77), Expect(10) = 9e-75 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -2 / -1 Query: 178 EGSFLQASTKDRSSPSLDGSIAIA 107 EGSFLQASTK RSSP+ + S+A A Sbjct: 149 EGSFLQASTKVRSSPTREASMASA 78 Score = 37.7 bits (76), Expect(10) = 9e-75 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 / -3 Query: 1008 LLMSGLMILPSSWPYHKQPAPRHD 937 L MS LMI PS+WP HKQP + + Sbjct: 1989 LPMSDLMIAPSAWPCHKQPVEKQN 1918 Score = 24.9 bits (48), Expect(10) = 9e-75 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 / -3 Query: 1332 HSRCHPYQHYREHLQ 1288 HS + Y+H +EHLQ Sbjct: 2178 HSEFYSYRHSQEHLQ 2134 Score = 81.3 bits (171), Expect(9) = 9e-51 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +2 / +3 Query: 695 DQPRLCKGLQDPWNG*CHAWQVGGSCS*SACRVKH*L***DQCCPQEG 838 D PRLCK LQ+ WNG C+AW++GGSC *S+ ++H L***DQCC QEG Sbjct: 1296 D*PRLCKRLQNSWNGLCYAWKMGGSCP*SSHSIEHGL***DQCCAQEG 1439 Score = 51.9 bits (107), Expect(9) = 9e-51 Identities = 22/27 (81%), Positives = 23/27 (85%) Frame = +3 / +1 Query: 618 YGTRASVFIKMKKPAAAIRDANAALEI 698 Y ASVFIKMKKP AAIRDANAALE+ Sbjct: 907 YACAASVFIKMKKPVAAIRDANAALEV 987 Score = 51.9 bits (107), Expect(9) = 9e-51 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +2 / +3 Query: 1391 DEQPCQLGQAPGQPEGGTHHRQDDGQDEREPV 1486 DEQ CQL +AP QP+GG HH +DDG+ + PV Sbjct: 4068 DEQSCQLCEAPSQPQGGPHHCKDDGEIQWVPV 4163 Score = 38.2 bits (77), Expect(9) = 9e-51 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +2 / +1 Query: 548 RETGRGRRASHQGYTAESNLGNHVWY 625 RETGR S++G TA+S L HVWY Sbjct: 745 RETGRSY*PSYKGNTAQSTLSYHVWY 822 Score = 32.7 bits (65), Expect(9) = 9e-51 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +1 / +2 Query: 1333 TLT*CQHLVTQRLWRPFKM 1389 TL * QHLVT RLW+ FKM Sbjct: 2267 TLI*WQHLVTLRLWQLFKM 2323 Score = 31.8 bits (63), Expect(9) = 9e-51 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +3 / +3 Query: 816 INAVLKKVEPNAHKIVEH 869 + ++ +VEPNAHKI+EH Sbjct: 1497 VTLIILQVEPNAHKIMEH 1550 Score = 30.4 bits (60), Expect(9) = 9e-51 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +2 / +1 Query: 461 DG*LFC*GDRGEP*RLPGSKGPGNGSNVRR 550 DG F * RG+ * L G + G+GSNVRR Sbjct: 559 DGRSFY*CHRGKS*CLTGGQKQGHGSNVRR 648 Score = 28.1 bits (55), Expect(9) = 9e-51 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 / +1 Query: 850 HTR*WSIAGSMIXXXXXXXXXXLSVT 927 HTR*W+IAG+M LSVT Sbjct: 1531 HTR*WNIAGNMNGCEKRGKKRELSVT 1608 Score = 27.6 bits (54), Expect(9) = 9e-51 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 / +2 Query: 1067 WWLPWRNAWWFPW 1105 W P +AWW PW Sbjct: 2084 WRFPRWDAWWLPW 2122 Score = 74.4 bits (156), Expect(6) = 8e-35 Identities = 33/63 (52%), Positives = 44/63 (69%) Frame = -1 / -3 Query: 845 RLHLLEDSIDLIIIVNV*RGMQITSSFLPLAKHGISHSTGLVALCRVWVDL*SSIRITDG 666 ++ LLE SIDLIII++V ++I SFLP +KH ISHST VA CRVWV+L ++ R+ Sbjct: 1446 KIDLLEHSIDLIIIIHVRCCVKIMGSFLPFSKHSISHSTSFVAFCRVWVNLHNNGRLCKA 1267 Query: 665 SSG 657 G Sbjct: 1266 HLG 1258 Score = 47.8 bits (98), Expect(6) = 8e-35 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = -2 / -3 Query: 550 PSDIASIAWPFASWEASRFSSVTSTEESPIF 458 PSDIAS+A AS EASRFSSVTS E SPI+ Sbjct: 648 PSDIASMALLLASCEASRFSSVTSIEGSPIW 556 Score = 40.5 bits (82), Expect(6) = 8e-35 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -1 / -2 Query: 644 DKHRCSGTIHDCRGWIQQYSLGEMLDGLFQFP 549 ++ S TIHD WI+QY L +M++ FQFP Sbjct: 841 ERRPTSSTIHDS*EWIEQYCLCKMVNSFFQFP 746 Score = 38.2 bits (77), Expect(6) = 8e-35 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 / -3 Query: 1394 HHILKGRHNLWVTKC*HQVRVI 1329 H ILK HNL VTKC HQ+RV+ Sbjct: 2328 HTILKSCHNLRVTKCCHQIRVL 2263 Score = 33.1 bits (66), Expect(6) = 8e-35 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 / -1 Query: 872 AMLHYLVCIRLHL 834 AM HYLVCIRLHL Sbjct: 1553 AMFHYLVCIRLHL 1515 Score = 27.2 bits (53), Expect(6) = 8e-35 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 / -1 Query: 1016 RHAS**AA**FFLPLGLIISSL 951 R S *A ** LPLGL+ISSL Sbjct: 1997 RCTSR*AT**LLLPLGLVISSL 1932 Score = 49.6 bits (102), Expect(6) = 2e-17 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +1 / +2 Query: 685 LL*RSTQTLQRATRPVEWLMPCLASGRKLLVI 780 LL R TQTLQ+AT+ VEWLM CL +GRKL +I Sbjct: 1286 LLCRLTQTLQKATKLVEWLMLCLENGRKLPMI 1381 Score = 34.5 bits (69), Expect(6) = 2e-17 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 / +3 Query: 547 KGNWKRPSSISPRLYC*IQPRQSCMVPE 630 +GNWK+ +I R YC I + SCMV E Sbjct: 744 QGNWKKLLTILQRQYCSIHSQLSCMVLE 827 Score = 33.6 bits (67), Expect(6) = 2e-17 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +1 / +2 Query: 1381 FKM**ATLPTWPSTRPTRRWDPSSPR*W 1464 F ** LP T+PT RW PS R*W Sbjct: 4058 FFQ**TILPALRGTKPTPRWAPSLQR*W 4141 Score = 30.4 bits (60), Expect(6) = 2e-17 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 / +3 Query: 1334 P*PDVSIW*PRGYGGPSR 1387 P* D SIW*P GYG SR Sbjct: 2268 P*SDGSIW*P*GYGSSSR 2321 Score = 26.3 bits (51), Expect(6) = 2e-17 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 / +3 Query: 514 KQRARQWKQCQK 549 + +AR WKQCQK Sbjct: 612 RPKARPWKQCQK 647 Score = 25.4 bits (49), Expect(6) = 2e-17 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = +2 / +2 Query: 1061 NAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 +AWW R W+ + + WR W W W Sbjct: 2021 DAWWRFPRRNAWWRFPRWYAWWRFPRWDAWWLPW 2122 Score = 46.9 bits (96), Expect(3) = 2e-11 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -3 / -2 Query: 780 DHEQLPPTCQAWH*PFHGSCSPLQSLG*S 694 DH QLPP QA H PFH CS LQSLG*S Sbjct: 1381 DHGQLPPIFQA*HKPFHEFCSLLQSLG*S 1295 Score = 38.2 bits (77), Expect(3) = 2e-11 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -1 / -3 Query: 695 L*SSIRITDGSSGLFHFDKHRCSGTI 618 L*SSI ITDGS+ HFDKHR +I Sbjct: 984 L*SSICITDGSNRFLHFDKHRSCTSI 907 Score = 33.1 bits (66), Expect(3) = 2e-11 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 / -2 Query: 1389 HLEGPP*PLGHQMLTSGQG 1333 HLE P*P GHQML S QG Sbjct: 2323 HLEELP*PQGHQMLPSDQG 2267
>LOC_Os09g23650:12009.t03474:unspliced-genomic hsc70-interacting protein, putative, expressed| Length = 2740 Score = 93.2 bits (197), Expect(3) = 2e-33 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = +3 / +3 Query: 693 EINPDSAKGYKTRGMANAMLGKWEEAARDLHAASNIDYDDEINAVLKKV 839 +INPDSAKGYK+RGMA AMLGKWEEAA+DL A+ +DYD+EI A LKKV Sbjct: 1227 QINPDSAKGYKSRGMAKAMLGKWEEAAQDLRMAAKLDYDEEIGAELKKV 1373 Score = 55.6 bits (115), Expect(3) = 2e-33 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +3 / +1 Query: 549 GKLEEAVEHLTKAILLNPTSAIMYGTRASVFIKMKKPA 662 GKL+EA+EHLT+AI+LNPTSAI Y TR + + + P+ Sbjct: 892 GKLDEAIEHLTEAIVLNPTSAIAYATRGIMTLSIYGPS 1005 Score = 43.7 bits (89), Expect(3) = 2e-33 Identities = 17/33 (51%), Positives = 25/33 (75%) Frame = +3 / +2 Query: 459 KMGDSSVEVTEENRDASQEAKGQAMEAMSEGKL 557 +MGD SVEV++E RD +Q K + ++A SEGK+ Sbjct: 656 QMGDPSVEVSDEKRDQAQLCKNKGVDAFSEGKV 754 Score = 64.8 bits (135), Expect(4) = 1e-17 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = -2 / -1 Query: 838 TFLRTALISSS*SMFDAACRSRAASSHLPSMALAIPRVL*PFAESGLI 695 TFL +A ISSS*S F A RS AASSH PS+A AIPR L P AESGLI Sbjct: 1372 TFLSSAPISSS*SNFAAMRRS*AASSHFPSIAFAIPRDLYPLAESGLI 1229 Score = 40.9 bits (83), Expect(4) = 1e-17 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = -2 / -3 Query: 628 LVPYMIAEVGFSSIALVRCSTASSSFP 548 LV IAEVGFS+IA VRCS ASS+ P Sbjct: 971 LVA*AIAEVGFSTIASVRCSIASSNLP 891 Score = 29.5 bits (58), Expect(4) = 1e-17 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -2 / -2 Query: 568 TASSSFPSDIASIAWPFASWEASRFSSVTSTEESPI 461 T + PS+ AS S SRFSS TST+ SPI Sbjct: 765 TGK*TLPSENASTPLFLHSCAWSRFSSETSTDGSPI 658 Score = 24.0 bits (46), Expect(4) = 1e-17 Identities = 10/43 (23%), Positives = 20/43 (46%) Frame = -2 / -3 Query: 1702 VQVQVHYHYLLPTYNKKPGMKSPIQQAPLHASITNQHLHVSGY 1574 V + Y+Y+ + + + I L +S +++ LHV Y Sbjct: 1949 VNASIQYYYISESIGRTEQISMKISLTILQSSRSSRDLHVKMY 1821 Score = 38.2 bits (77), Expect = 0.19 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +3 / +2 Query: 630 ASVFIKMKKPAAAIRDANAALEI 698 A +F+K KKP AAIRDA+AAL++ Sbjct: 1064 AVIFVKSKKPNAAIRDADAALKV 1132 Score = 35.9 bits (72), Expect = 0.93 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -1 / -3 Query: 839 HLLEDSIDLIIIVNV*RGMQITSSFLPLAKHGISHSTGLVALCRVWVDL 693 +LL+ +L II+ ++ SS P KH H + ++ R+W++L Sbjct: 1373 NLLKFCSNLFIIIQFCCHAKVLSSLFPFPKHSFCHPS*FISFSRIWINL 1227
>LOC_Os02g43020:12002.t03887:unspliced-genomic heat shock protein STI, putative, expressed| Length = 4433 Score = 74.8 bits (157), Expect(2) = 2e-15 Identities = 34/100 (34%), Positives = 53/100 (53%) Frame = +3 / +2 Query: 456 QKMGDSSVEVTEENRDASQEAKGQAMEAMSEGKLEEAVEHLTKAILLNPTSAIMYGTRAS 635 QK+ + + + R + EAK + A S G+ EEA H T AI L P + ++Y R++ Sbjct: 71 QKLPEPAPPI*SPPRAMADEAKAKGNAAFSAGRYEEAARHFTDAIALAPGNHVLYSNRSA 250 Query: 636 VFIKMKKPAAAIRDANAALEINPDSAKGYKTRGMANAMLG 755 + + + A+ DA +E+ PD AKGY G A+ LG Sbjct: 251 ALASVHRYSEALADAEKTVELKPDWAKGYSRLGAAHLGLG 370 Score = 35.0 bits (70), Expect(2) = 2e-15 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +3 / +2 Query: 1323 ILNDPDLMSAFGDPEVMAALQDVMSNPANLAKHQANPKVGPIIAKMM 1463 I +DP + P+ M L+DV NP++L + ++P++ ++ M+ Sbjct: 551 IASDPTTRAYLEQPDFMQMLRDVQRNPSSLNMYLSDPRMMQVLGLML 691 Score = 36.3 bits (73), Expect = 0.68 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +3 / +2 Query: 489 EENRDASQEAKGQAMEAMSEGKLEEAVEHLTKAILLNPTSAIMYGTRASVFIKMKK 656 +E + ++Q+ K A + E A++H TKA+ L+ RA+V+I+M K Sbjct: 848 KERKSSAQKEKEAGNAAYKKKDFETAIQHYTKAMELDDEDISYLTNRAAVYIEMGK 1015 Score = 32.7 bits (65), Expect = 8.6 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -2 / -3 Query: 601 GFSSIALVRCSTASSSFPSDIASIAWPFASWEASRFSSVTSTEESPIFW 455 G S++A V+C ASS P++ A++ + FAS +R S FW Sbjct: 216 GASAMASVKCRAASS*RPAEKAALPFAFASSAMARGGDQIGGAGSGSFW 70
>LOC_Os02g43010:12002.t03886:unspliced-genomic vacuolar processing enzyme, beta-isozyme precursor, putative,| expressed Length = 10478 Score = 74.8 bits (157), Expect(2) = 5e-15 Identities = 34/100 (34%), Positives = 53/100 (53%) Frame = +3 / -2 Query: 456 QKMGDSSVEVTEENRDASQEAKGQAMEAMSEGKLEEAVEHLTKAILLNPTSAIMYGTRAS 635 QK+ + + + R + EAK + A S G+ EEA H T AI L P + ++Y R++ Sbjct: 5350 QKLPEPAPPI*SPPRAMADEAKAKGNAAFSAGRYEEAARHFTDAIALAPGNHVLYSNRSA 5171 Query: 636 VFIKMKKPAAAIRDANAALEINPDSAKGYKTRGMANAMLG 755 + + + A+ DA +E+ PD AKGY G A+ LG Sbjct: 5170 ALASVHRYSEALADAEKTVELKPDWAKGYSRLGAAHLGLG 5051 Score = 35.0 bits (70), Expect(2) = 5e-15 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +3 / -2 Query: 1323 ILNDPDLMSAFGDPEVMAALQDVMSNPANLAKHQANPKVGPIIAKMM 1463 I +DP + P+ M L+DV NP++L + ++P++ ++ M+ Sbjct: 4870 IASDPTTRAYLEQPDFMQMLRDVQRNPSSLNMYLSDPRMMQVLGLML 4730 Score = 36.3 bits (73), Expect = 0.68 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = +3 / -2 Query: 489 EENRDASQEAKGQAMEAMSEGKLEEAVEHLTKAILLNPTSAIMYGTRASVFIKMKK 656 +E + ++Q+ K A + E A++H TKA+ L+ RA+V+I+M K Sbjct: 4573 KERKSSAQKEKEAGNAAYKKKDFETAIQHYTKAMELDDEDISYLTNRAAVYIEMGK 4406 Score = 32.7 bits (65), Expect = 8.6 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = -2 / +3 Query: 601 GFSSIALVRCSTASSSFPSDIASIAWPFASWEASRFSSVTSTEESPIFW 455 G S++A V+C ASS P++ A++ + FAS +R S FW Sbjct: 5205 GASAMASVKCRAASS*RPAEKAALPFAFASSAMARGGDQIGGAGSGSFW 5351
>LOC_Os04g45480:12004.t04082:unspliced-genomic heat shock protein STI, putative, expressed| Length = 3447 Score = 66.6 bits (139), Expect = 5e-10 Identities = 30/86 (34%), Positives = 44/86 (51%) Frame = +3 / +1 Query: 498 RDASQEAKGQAMEAMSEGKLEEAVEHLTKAILLNPTSAIMYGTRASVFIKMKKPAAAIRD 677 R + EAK + A S G+ EEA H T AI L P + ++Y R++ + + + A+ D Sbjct: 94 RAMADEAKAKGNAAFSAGRFEEAAAHFTDAIALAPDNHVLYSNRSAAYASLHRYPEALAD 273 Query: 678 ANAALEINPDSAKGYKTRGMANAMLG 755 A + + PD AKG G A LG Sbjct: 274 AERTVALRPDWAKGCSRLGAARLGLG 351 Score = 38.2 bits (77), Expect = 0.19 Identities = 19/68 (27%), Positives = 35/68 (51%) Frame = +3 / +1 Query: 453 PQKMGDSSVEVTEENRDASQEAKGQAMEAMSEGKLEEAVEHLTKAILLNPTSAIMYGTRA 632 P+ M + E + R A+ + + +A A + E A++H TKA+ L+ RA Sbjct: 781 PEPMEVTEEEKERKERKAAAQEEKEAGNAAYKKDFETAIQHYTKAMELDDEDVSYLTNRA 960 Query: 633 SVFIKMKK 656 +V+++M K Sbjct: 961 AVYLEMGK 984
>LOC_Os07g48910:12007.t04519:unspliced-genomic collagen-like protein 2, putative, expressed| Length = 1705 Score = 40.5 bits (82), Expect(3) = 5e-09 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +2 / +1 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWY 1279 R+ RR GRW+ R RR CR RR W R RW+ Sbjct: 1138 RFRRRQGRWFRWRRRRRPWCRRRRRRWRRRIWRRRWRWH 1254 Score = 34.1 bits (68), Expect(3) = 5e-09 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWW 1096 W RW R+ W WW W W+ Sbjct: 874 WRWRWCRWRGRNRWRCWWWRWSRRWF 951 Score = 24.0 bits (46), Expect(3) = 5e-09 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +2 / +1 Query: 1079 WRNAWWFPWRYGWYAWRNGG 1138 WR WW R +WR G Sbjct: 1039 WRLRWWLRRRQRRRSWRRCG 1098 Score = 31.3 bits (62), Expect(5) = 2e-08 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 / +1 Query: 1112 GWYAWRNGGWFPWRNGW 1162 GW+ W G W+ WR W Sbjct: 244 GWWCWGWGRWWIWRGRW 294 Score = 29.5 bits (58), Expect(5) = 2e-08 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / +1 Query: 1139 WFPWRNGWRYARRNGRWYARR 1201 W WR G R RR+ RW RR Sbjct: 454 WSWWRRGRRCRRRSWRWSRRR 516 Score = 29.0 bits (57), Expect(5) = 2e-08 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 / +1 Query: 1058 WNAWWLPWRNAWWFPWRY 1111 W W PWR W WR+ Sbjct: 187 WRWWRWPWRRCWDRVWRW 240 Score = 28.1 bits (55), Expect(5) = 2e-08 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = +2 / +1 Query: 1253 RW*RNGRWYAWSWRCSR 1303 RW RW W WR SR Sbjct: 892 RWRGRNRWRCWWWRWSR 942 Score = 24.4 bits (47), Expect(5) = 2e-08 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 / +1 Query: 1196 RRNGRRYACRNGRRYAWNGRW*RNGRW 1276 RR RR+ R + W+GR R RW Sbjct: 634 RRRSRRWCWWRRRCWWWSGRRCRWRRW 714 Score = 28.6 bits (56), Expect(4) = 4e-07 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 / +1 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGR 1186 R+ W++W G R WR++RR R Sbjct: 442 RWWWWSWWRRGRRCRRRSWRWSRRRRR 522 Score = 27.6 bits (54), Expect(4) = 4e-07 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 1091 WWFPWRYGWYAW 1126 WW WR W+ W Sbjct: 337 WWERWRLRWWCW 372 Score = 25.8 bits (50), Expect(4) = 4e-07 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = +2 / +1 Query: 1055 GWNAWWLPWRNAWW 1096 GW WW+ WW Sbjct: 259 GWGRWWIWRGRWWW 300 Score = 25.8 bits (50), Expect(4) = 4e-07 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 / +1 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRRYAW 1246 W ++ R + RR RR++ R RR++W Sbjct: 532 WWWSGSGRRCWWRRWSRRWSRRRCRRWSW 618 Score = 25.4 bits (49), Expect(4) = 0.003 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 / +1 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGR 1234 WR W RR R RR GRR R R Sbjct: 1039 WRLRWWLRRRQRRRSWRRCGRRIRWRRWR 1125 Score = 23.1 bits (44), Expect(4) = 0.003 Identities = 6/20 (30%), Positives = 8/20 (40%) Frame = +2 / +1 Query: 1091 WWFPWRYGWYAWRNGGWFPW 1150 WW+ W W+ R W Sbjct: 922 WWWRWSRRWFRRRQRWRLRW 981 Score = 22.6 bits (43), Expect(4) = 0.003 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +2 / +1 Query: 1004 RRHAWWNARWLPIPRRHGWNAWW 1072 RR W+ RW RR WW Sbjct: 595 RRCRRWSWRWFRWRRRSRRWCWW 663 Score = 22.6 bits (43), Expect(4) = 0.003 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +2 / +1 Query: 1067 WWLPWR 1084 WW PWR Sbjct: 772 WWRPWR 789 Score = 41.4 bits (84), Expect = 0.021 Identities = 27/85 (31%), Positives = 29/85 (34%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYAR 1198 W+ RW +R WW WR W WR W R R RR GR Sbjct: 934 WSRRWFRRRQRWRLRWWWRRWRRRRCRRWLRRRQGWRLRWWLRRRQRRRSWRRCGRRIRW 1113 Query: 1199 RNGRRYACRNGRRYAWNGRW*RNGR 1273 R R R RR RW R R Sbjct: 1114 RRWRWSRRRFRRRQGRWFRWRRRRR 1188 Score = 35.4 bits (71), Expect(2) = 0.021 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 / +1 Query: 1070 WLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 W WR WW+ W + + R W WR W Sbjct: 271 WWIWRGRWWWSWPWRRHWRRVWWWERWRLRW 363 Score = 23.5 bits (45), Expect(2) = 0.021 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +2 / +1 Query: 1232 RRYAWNGRW*RNGRWYAW 1285 RR W RW W++W Sbjct: 409 RRVWWRKRWRPRWWWWSW 462 Score = 30.4 bits (60), Expect(3) = 0.031 Identities = 10/33 (30%), Positives = 12/33 (36%) Frame = +2 / +1 Query: 1031 WLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWR 1129 W RR W W W W + W+ WR Sbjct: 538 WSGSGRRCWWRRWSRRWSRRRCRRWSWRWFRWR 636 Score = 28.1 bits (55), Expect(3) = 0.031 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 / +1 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAW 1246 W+ + WF R WR RW RR R R G R W Sbjct: 922 WWWRWSRRWFRRRQRWRLRWWWRRWRRRRCRRWLRRRQGWRLRW 1053 Score = 24.4 bits (47), Expect(3) = 0.031 Identities = 6/11 (54%), Positives = 6/11 (54%) Frame = +2 / +1 Query: 1007 RHAWWNARWLP 1039 R WW RW P Sbjct: 409 RRVWWRKRWRP 441 Score = 35.9 bits (72), Expect = 0.93 Identities = 21/69 (30%), Positives = 26/69 (37%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYAR 1198 W W R W W W + WR W+ R + W + WR RR R R Sbjct: 322 WRRVWWWERWRLRWWCWCWWRDRTWRWRWRRVWWRKRWRPRWWWWSWWRRGRRCRRRSWR 501 Query: 1199 RNGRRYACR 1225 + RR CR Sbjct: 502 WSRRRRRCR 528 Score = 26.7 bits (52), Expect(3) = 3.9 Identities = 7/23 (30%), Positives = 9/23 (39%) Frame = +2 / +1 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAW 1126 W WW WW W++W Sbjct: 238 W*GWWCWGWGRWWIWRGRWWWSW 306 Score = 24.9 bits (48), Expect(3) = 3.9 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 / +1 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGR 1186 R GW++ R W WR+ R GR Sbjct: 826 RCGWWSGRRCRCRGWPWRWRWCRWRGR 906 Score = 23.5 bits (45), Expect(3) = 3.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 / +1 Query: 1196 RRNGRRYACRNGRRYAWNGRW*RNGRW 1276 RR R R RR W RW + RW Sbjct: 1183 RRPWCRRRRRRWRRRIWRRRWRWHRRW 1263
>LOC_Os07g32680:12007.t02950:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1424 Score = 37.7 bits (76), Expect(3) = 5e-09 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 / +1 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPW 1150 W WW+ W + W WR G W W Sbjct: 499 WWWPWWWVWCWRWCRWRRGWWSWW 570 Score = 33.1 bits (66), Expect(3) = 5e-09 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +2 / +1 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAW 1285 R W + R W+ RR R A R R+ W W R RW+ W Sbjct: 550 RGWWSWWWRRLWWWWRRWPRWRAWRRLWRWCWCRWWSRWWRWWGW 684 Score = 27.6 bits (54), Expect(3) = 5e-09 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 / +1 Query: 1004 RRHAWWNARWLPIPRRHGW 1060 RR AWW RW R W Sbjct: 373 RRWAWWRTRWRVWGRSWSW 429 Score = 39.6 bits (80), Expect(3) = 3e-08 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / +1 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 W W W WW+ W + W WR W Sbjct: 802 WRPRWWTWWRLWWWSWCWQWCRWRCRWW 885 Score = 31.3 bits (62), Expect(3) = 3e-08 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 / +1 Query: 1004 RRHAWWNARWLPIPRRHGWNAWW 1072 +R WW RW+ RR W WW Sbjct: 706 QRAWWWPRRWVWCWRRSWWWHWW 774 Score = 24.9 bits (48), Expect(3) = 3e-08 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 / +1 Query: 1148 WRNGWRYARRNGRWYARR 1201 WR W + RR W++RR Sbjct: 991 WRRIWWWWRRRPWWWSRR 1044 Score = 39.6 bits (80), Expect(3) = 2e-06 Identities = 13/48 (27%), Positives = 19/48 (39%) Frame = +2 / +1 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 R W W W + WW W + + WR + W W + R W+ Sbjct: 622 RRLWRWCWCRWWSRWWRWWGWWVWRWRRQRAWWWPRRWVWCWRRSWWW 765 Score = 27.2 bits (53), Expect(3) = 2e-06 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +1 Query: 1016 WWNARWLPIPRRHGWNAWW 1072 WW W R GW +WW Sbjct: 514 WWVWCWRWCRWRRGWWSWW 570 Score = 22.6 bits (43), Expect(3) = 2e-06 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 / +1 Query: 1232 RRYAWNGRW*RNGRWYAWSW 1291 R + W RW R + WSW Sbjct: 790 RWWWWRPRWWTWWRLWWWSW 849 Score = 42.8 bits (87), Expect(3) = 2e-05 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +2 / +1 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRY 1168 RR W WW+ W W WR+ W WR W R +R+ Sbjct: 202 RRRLWWGWWVRWWWRWRARWRWRWTWWRTWWWVRRRWRFRW 324 Score = 29.0 bits (57), Expect(3) = 2e-05 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / +1 Query: 1244 WNGRW*RNGRWYAWSWRCSR 1303 W RW R W+ W WR R Sbjct: 652 WWSRWWRWWGWWVWRWRRQR 711 Score = 22.6 bits (43), Expect(3) = 2e-05 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / +1 Query: 1148 WRNGWRYARRNGRWYARR 1201 WR W + RR RW A R Sbjct: 571 WRRLWWWWRRWPRWRAWR 624 Score = 42.3 bits (86), Expect(2) = 2e-04 Identities = 20/66 (30%), Positives = 26/66 (39%) Frame = +2 / +1 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRN 1228 R W W R W F WR W W G++ WR W + R R + R R+ Sbjct: 268 RWTWWRTWWWVRRRWRFRWRC*WRCWGWRGFWWWRRRWAWWRTRWRVWGRSWSWRWCGWW 447 Query: 1229 GRRYAW 1246 R+ W Sbjct: 448 AWRWRW 465 Score = 24.0 bits (46), Expect(2) = 2e-04 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 / +1 Query: 1235 RYAWNGRW*RNGRWYAWSW 1291 R+ W RW R RW+ W Sbjct: 460 RWLWRRRWRRIRRWWWPWW 516 Score = 29.9 bits (59), Expect(3) = 5e-04 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = +2 / +1 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 W W + + W W WR WR R+ W Sbjct: 334 WRCWGWRGFWWWRRRWAWWRTRWRVWGRSWSW 429 Score = 28.1 bits (55), Expect(3) = 5e-04 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 / +1 Query: 1070 WLPWRNAWWFPWRYGW 1117 W W WW+ WR W Sbjct: 214 WWGWWVRWWWRWRARW 261 Score = 22.6 bits (43), Expect(3) = 5e-04 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +2 / +1 Query: 1274 WYAWSWR 1294 W+AW WR Sbjct: 442 WWAWRWR 462 Score = 31.8 bits (63), Expect(3) = 0.002 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +2 / +1 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 WR WW+ R W+ R W R WR R W+ Sbjct: 991 WRRIWWWWRRRPWWWSRRRVWSWCRRRWRCWWRCWWWW 1104 Score = 23.5 bits (45), Expect(3) = 0.002 Identities = 6/13 (46%), Positives = 6/13 (46%) Frame = +2 / +1 Query: 1058 WNAWWLPWRNAWW 1096 W W WR WW Sbjct: 847 WCWQWCRWRCRWW 885 Score = 23.1 bits (44), Expect(3) = 0.002 Identities = 7/19 (36%), Positives = 8/19 (42%) Frame = +2 / +1 Query: 1016 WWNARWLPIPRRHGWNAWW 1072 WW RW R W+ W Sbjct: 799 WWRPRWWTWWRLWWWSWCW 855 Score = 39.1 bits (79), Expect(2) = 0.005 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +2 / +1 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 R W W WR W+ WR W+ W W+ W W Sbjct: 748 RRSWWWHWWRWRLWRWWWWRPRWWTWWRLWWWSWCWQW 861 Score = 22.1 bits (42), Expect(2) = 0.005 Identities = 7/20 (35%), Positives = 9/20 (45%) Frame = +2 / +1 Query: 1238 YAWNGRW*RNGRWYAWSWRC 1297 + W W R W+ WRC Sbjct: 925 WTW*RIWRRCWCWWRCRWRC 984 Score = 40.0 bits (81), Expect = 0.053 Identities = 16/45 (35%), Positives = 20/45 (44%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWR 1153 W W R GW W + AWW+P R+ W R+ W WR Sbjct: 643 WCRWWSRWWRWWGWWVWRWRRQRAWWWPRRWVWCWRRSWWWHWWR 777 Score = 32.7 bits (65), Expect(2) = 0.095 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 / +1 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARR 1177 WW W + W A W WR W RR Sbjct: 223 WWVRWWWRWRARWRWRWTWWRTWWWVRRR 309 Score = 24.0 bits (46), Expect(2) = 0.095 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 / +1 Query: 1244 WNGRW*RNGRWYAWSW 1291 W RW GR ++W W Sbjct: 388 WRTRWRVWGRSWSWRW 435 Score = 31.8 bits (63), Expect(2) = 0.32 Identities = 10/33 (30%), Positives = 12/33 (36%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGW 1117 W +W R WW W WW+ W W Sbjct: 847 WCWQWCRWRCRWWRRIWWRRWGGPWWWTW*RIW 945 Score = 23.1 bits (44), Expect(2) = 0.32 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = +2 / +1 Query: 1103 WRYGWYAWRNGGWF 1144 WR W+ WR W+ Sbjct: 991 WRRIWWWWRRRPWW 1032 Score = 29.9 bits (59), Expect(2) = 0.34 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 / +1 Query: 1118 YAWRNGGWFPWRNGWRYARR 1177 ++WR GW+ WR W + RR Sbjct: 421 WSWRWCGWWAWRWRWLWRRR 480 Score = 29.5 bits (58), Expect(2) = 0.34 Identities = 8/23 (34%), Positives = 10/23 (43%) Frame = +2 / +1 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAW 1126 W WW WR W + W + W Sbjct: 226 WVRWWWRWRARWRWRWTWWRTWW 294 Score = 36.8 bits (74), Expect = 0.49 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 W W+ RR W W W W + W+ WR W+ WR W Sbjct: 673 WWGWWVWRWRRQRAWWWPRRWVWCWRRSWWWHWWRWRLWRWWWWRPRW 816 Score = 35.9 bits (72), Expect = 0.93 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 / +1 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAW 1126 WW W R W AW WR W W W W Sbjct: 568 WWRRLWWWWRRWPRWRAWRRLWRWCWCRWWSRWWRWW 678 Score = 35.9 bits (72), Expect = 0.93 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / +1 Query: 1070 WLPWRNAWWFPWRYGWYAW 1126 W WR WW WR W++W Sbjct: 793 WWWWRPRWWTWWRLWWWSW 849 Score = 30.4 bits (60), Expect(2) = 1.4 Identities = 15/45 (33%), Positives = 18/45 (40%) Frame = +2 / +1 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 W R W + W W+ R F WR WR G W+ RR Sbjct: 241 WRWRARWRWRWTWWRTWWWVRRRWRFRWRC*WRCWGWRGFWWWRR 375 Score = 22.1 bits (42), Expect(2) = 1.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 / +1 Query: 1205 GRRYACRNGRRYAWNGRW*RNGRW 1276 GR ++ R +AW RW RW Sbjct: 412 GRSWSWRWCGWWAWRWRWLWRRRW 483 Score = 34.5 bits (69), Expect = 2.4 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 W RWL R WW PW W + W W + W Sbjct: 451 WRWRWLWRRRWRRIRRWWWPWWWVWCWRWCRWRRGWWSWWW 573 Score = 27.6 bits (54), Expect(2) = 4.6 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 / +1 Query: 1115 WYAWRNGGWFPWRNGWRY 1168 W+ W W+ WR WR+ Sbjct: 214 WWGWWVRWWWRWRARWRW 267 Score = 23.1 bits (44), Expect(2) = 4.6 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 / +1 Query: 1232 RRYAWNGRW*RNGRWYAWSWR 1294 R + W G W RW W R Sbjct: 337 RCWGWRGFWWWRRRWAWWRTR 399 Score = 32.7 bits (65), Expect = 8.6 Identities = 15/50 (30%), Positives = 21/50 (42%) Frame = +2 / +1 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRY 1216 WW WR W W + W + W W++ R RW+ R RR+ Sbjct: 760 WWHWWRWRLWRWWWWRPRWWTWWRLWWWSWCWQWCRWRCRWWRRIWWRRW 909 Score = 32.7 bits (65), Expect = 8.6 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 / +1 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWR 1129 RR W W PW W WR W WR Sbjct: 886 RRIWWRRWGGPWWWTW*RIWRRCWCWWR 969
>LOC_Os03g19600:12003.t01725:unspliced-genomic PE_PGRS family protein, putative, expressed| Length = 2044 Score = 43.7 bits (89), Expect(3) = 1e-08 Identities = 15/48 (31%), Positives = 20/48 (41%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 W W W WW WR+ + W + W W + R RW+ RR Sbjct: 432 WARWRSWWWPRWWCRWRWRTWWWCWRRTWRWSRWWWWCWRRPRWWCRR 575 Score = 27.6 bits (54), Expect(3) = 1e-08 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 / +3 Query: 1244 WNGRW*RNGRWYAWSWRCSR 1303 W W R RW W W C R Sbjct: 642 WWWCWRRTWRWSRWWWWCRR 701 Score = 25.8 bits (50), Expect(3) = 1e-08 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWW 1072 WW RW RR W + W Sbjct: 351 WWEGRWSWRRRRSWWWSRW 407 Score = 40.9 bits (83), Expect(3) = 6e-07 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 1064 AWWLPWRNAWWFPWRYGWYAWRNGGWFPWR 1153 +WW PWR W+ R+ W R+ W WR Sbjct: 321 SWWWPWRWVRWWEGRWSWRRRRSWWWSRWR 410 Score = 25.8 bits (50), Expect(3) = 6e-07 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 1232 RRYAWNGRW*RNGRWYAWSWR 1294 RR+AW W R W+ WR Sbjct: 570 RRWAW*WCWRRRWTWWWCRWR 632 Score = 24.4 bits (47), Expect(3) = 6e-07 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 / +3 Query: 1139 WFPWRNGWRYAR 1174 W+ WR WR++R Sbjct: 495 WWCWRRTWRWSR 530 Score = 35.4 bits (71), Expect(3) = 2e-06 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 / +3 Query: 1031 WLPIPRRHGWNAWWLPWRNAWWFPWRYGW 1117 W R W WW WR+ WW W W Sbjct: 393 WWSRWRWRAW*WWWARWRSWWWPRWWCRW 479 Score = 29.9 bits (59), Expect(3) = 2e-06 Identities = 17/52 (32%), Positives = 19/52 (36%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAW 1246 WW+ WR W R W R W R W RR + CR R W Sbjct: 492 WWWCWRRTWRWSRWWWWCWRRPRWWCRRWAW*WCWRRRWTWWWCRWRWRTWW 647 Score = 24.0 bits (46), Expect(3) = 2e-06 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +2 / +3 Query: 1004 RRHAWWNARW 1033 RR +WW +RW Sbjct: 378 RRRSWWWSRW 407 Score = 32.7 bits (65), Expect(4) = 3e-06 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAW 1126 W WW WW W + W AW Sbjct: 138 WLWWWWWSWRRWWCRWWFRWRAW 206 Score = 30.9 bits (61), Expect(4) = 3e-06 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 / +3 Query: 1118 YAWRNGGWFPWRNGWRYARRNGRWYAR 1198 + WR W P R W + RR RW+ R Sbjct: 228 WVWRG*RWRPRRRRWSWWRRWRRWWFR 308 Score = 27.2 bits (53), Expect(4) = 3e-06 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 / +3 Query: 1187 WYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSW 1291 W+ R+ R R R+ W RW R RW W Sbjct: 1056 WWWCRSRGRARWRCWCRWRWWTRWWRRRRWRTRRW 1160 Score = 26.3 bits (51), Expect(4) = 3e-06 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +3 Query: 1274 WYAWSWRCSR*C 1309 WY W WR R C Sbjct: 1452 WYRWRWRTRRWC 1487 Score = 32.7 bits (65), Expect(3) = 3e-05 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGWRY 1168 W W W + W WR+ W W WR+ Sbjct: 396 WSRWRWRAW*WWWARWRSWWWPRWWCRWRW 485 Score = 26.7 bits (52), Expect(3) = 3e-05 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 / +3 Query: 1244 WNGRW*RNGRWYAWSWRCSR 1303 W W R RW W W C R Sbjct: 492 WWWCWRRTWRWSRWWWWCWR 551 Score = 25.8 bits (50), Expect(3) = 3e-05 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWF 1099 W WW WR W+ Sbjct: 288 WRRWWFRWRAWSWW 329 Score = 34.5 bits (69), Expect(3) = 7e-05 Identities = 11/33 (33%), Positives = 13/33 (39%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGW 1117 W RW R W WW WR W + + W Sbjct: 594 WRRRWTWWWCRWRWRTWWWCWRRTWRWSRWWWW 692 Score = 25.8 bits (50), Expect(3) = 7e-05 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +2 / +3 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWRY 1168 W R+ W+ R W+ WR W + Sbjct: 666 WRWSRWWWWCRRWAWWWCWRRRWTW 740 Score = 23.5 bits (45), Expect(3) = 7e-05 Identities = 8/23 (34%), Positives = 10/23 (43%) Frame = +2 / +3 Query: 1235 RYAWNGRW*RNGRWYAWSWRCSR 1303 R+ W RW RW+ W R Sbjct: 834 RWRWWTRWWHRRRWWTRWWHRRR 902 Score = 34.1 bits (68), Expect(3) = 9e-05 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAW 1126 WW R AWW+ WR W W Sbjct: 684 WWWCRRWAWWWCWRRRWTWW 743 Score = 27.2 bits (53), Expect(3) = 9e-05 Identities = 18/62 (29%), Positives = 22/62 (35%) Frame = +2 / +3 Query: 1100 PWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWY 1279 PW + WR W R W R W + RR+ R R W RW R + Sbjct: 759 PWWGCRWRWRA*RWCRGRTRWWCWCRWRWWTRWWHRRRWWTRWWHRRRWWTRWWCRRRSW 938 Query: 1280 AW 1285 W Sbjct: 939 WW 944 Score = 22.1 bits (42), Expect(3) = 9e-05 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +3 Query: 1004 RRHAWWNARW 1033 RR WW RW Sbjct: 600 RRWTWWWCRW 629 Score = 34.1 bits (68), Expect(3) = 1e-04 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 / +3 Query: 1082 RNAWWFPWRYGWYAWRNGGWF 1144 R +WW WR W+ WR W+ Sbjct: 267 RWSWWRRWRRWWFRWRAWSWW 329 Score = 25.4 bits (49), Expect(3) = 1e-04 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = +2 / +3 Query: 1049 RHGWNAWWLPWRNAWW 1096 R W WW WR W Sbjct: 165 RRWWCRWWFRWRAWSW 212 Score = 23.5 bits (45), Expect(3) = 1e-04 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = +2 / +3 Query: 1244 WNGRW*RNGRWYAWSW 1291 W RW RW W W Sbjct: 453 WWPRWWCRWRWRTWWW 500 Score = 29.9 bits (59), Expect(3) = 2e-04 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWW 1096 RR W WW R+ WW Sbjct: 894 RRRWWTRWWCRRRSWWW 944 Score = 27.6 bits (54), Expect(3) = 2e-04 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACR 1225 WR W+ R+ G WR R+ W RR R CR Sbjct: 1044 WRRSWWWCRSRGRARWRCWCRWRWWTRWWRRRRWRTRRWCR 1166 Score = 24.4 bits (47), Expect(3) = 2e-04 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +3 Query: 1004 RRHAWWNARW 1033 RR WW RW Sbjct: 750 RRRPWWGCRW 779 Score = 33.6 bits (67), Expect(3) = 4e-04 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 WW R+ W + WR WR+ R RW RR Sbjct: 153 WWSWRRWWCRWWFRWRAWSWRRSWRWVWRG*RWRPRR 263 Score = 24.4 bits (47), Expect(3) = 4e-04 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = +2 / +3 Query: 1055 GWNAWWLPWRNAWWFPWRY 1111 GW WR WW+ W + Sbjct: 108 GWRRRLRWWRWLWWWWWSW 164 Score = 23.1 bits (44), Expect(3) = 4e-04 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 / +3 Query: 1271 RWYAWSW 1291 RW AWSW Sbjct: 306 RWRAWSW 326 Score = 30.4 bits (60), Expect(3) = 5e-04 Identities = 10/36 (27%), Positives = 12/36 (33%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWR 1165 W WW R WW+ W R W W+ Sbjct: 1497 WRTWWWRRRRPWWWCRSRRWLWGRQRWWLRRGARWQ 1604 Score = 27.6 bits (54), Expect(3) = 5e-04 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = +2 / +3 Query: 1004 RRHAWWNARWLPIPRRHGWNAWWLPW 1081 RR W W R GW WW W Sbjct: 1371 RRRRWRTRWWCWRWCRSGWWVWWWCW 1448 Score = 22.6 bits (43), Expect(3) = 5e-04 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 / +3 Query: 1271 RWYAWSWRCSR 1303 RW+ W W SR Sbjct: 1620 RWWVWCWWWSR 1652 Score = 35.9 bits (72), Expect(2) = 0.038 Identities = 15/52 (28%), Positives = 20/52 (38%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 RR W W WW WR+ + W + W W + RR W+ R Sbjct: 570 RRWAW*WCWRRRWTWWWCRWRWRTWWWCWRRTWRWSRWWWWCRRWAWWWCWR 725 Score = 22.1 bits (42), Expect(2) = 0.038 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = +2 / +3 Query: 1211 RYACRNGRRYAWNGRW*RNGRWYAWSW 1291 R+ R R W RW RW+ W Sbjct: 840 RWWTRWWHRRRWWTRWWHRRRWWTRWW 920 Score = 30.4 bits (60), Expect(3) = 0.043 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACR 1225 WW+ WR W R W W RR W+ R + CR Sbjct: 642 WWWCWRRTWRWSRWWWWCRRWAWWWCWRRRWTWWWCRRRPWWGCR 776 Score = 27.6 bits (54), Expect(3) = 0.043 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWR 1108 W W W WWF WR Sbjct: 150 WWWSWRRWWCRWWFRWR 200 Score = 24.9 bits (48), Expect(3) = 0.043 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +2 / +3 Query: 1223 RNGRRYAWNGRW*RNGRWYAWSWRC 1297 R R W RW R+G W W C Sbjct: 1377 RRWRTRWWCWRWCRSGWWVWWWCWC 1451 Score = 35.0 bits (70), Expect(2) = 0.051 Identities = 14/49 (28%), Positives = 18/49 (36%) Frame = +2 / +3 Query: 1031 WLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARR 1177 W R W WW WR W+ + W W+ WR + RR Sbjct: 429 WWARWRSWWWPRWWCRWRWRTWWWCWRRTWRWSRWWWWCWRRPRWWCRR 575 Score = 22.6 bits (43), Expect(2) = 0.051 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = +2 / +3 Query: 1208 RRYACRNGRRYAWNGRW*RNGRWYAWSWR 1294 RR+A R W W R W+ WR Sbjct: 696 RRWAWWWCWRRRWTWWWCRRRPWWGCRWR 782 Score = 28.6 bits (56), Expect(3) = 0.054 Identities = 9/27 (33%), Positives = 12/27 (44%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRYGWYAWRNGGWFPW 1150 W R+ WW WR+ + W W W Sbjct: 372 WRRRRSWWWSRWRWRAW*WWWARWRSW 452 Score = 22.6 bits (43), Expect(3) = 0.054 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / +3 Query: 1262 RNGRWYAWSWRCSR 1303 R RW+ W WR R Sbjct: 519 RWSRWWWWCWRRPR 560 Score = 22.1 bits (42), Expect(3) = 0.054 Identities = 8/23 (34%), Positives = 9/23 (39%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGRWY 1192 W W W WR R RW+ Sbjct: 468 WCRWRWRTWWWCWRRTWRWSRWW 536 Score = 32.7 bits (65), Expect(2) = 0.093 Identities = 15/49 (30%), Positives = 18/49 (36%) Frame = +2 / +3 Query: 1031 WLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARR 1177 W RR W WR +WW+ G WR + W W RR Sbjct: 996 WTRWWRRRRWRTRRWCWRRSWWWCRSRGRARWRCWCRWRWWTRWWRRRR 1142 Score = 30.9 bits (61), Expect(2) = 0.093 Identities = 13/45 (28%), Positives = 16/45 (35%) Frame = +2 / +3 Query: 1007 RHAWWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 R WW W R W W WR + W+ W + W W Sbjct: 444 RSWWWPRWWCRWRWRTWWWCWRRTWRWSRWWWWCWRRPRWWCRRW 578 Score = 25.8 bits (50), Expect(2) = 0.093 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAW 1285 W W + RR W+ R R + R + W+ W RW W Sbjct: 576 WAW*WCWRRRWTWWWCRWRWRTWWWCWRRTWRWSRWWWWCRRWAWW 713 Score = 24.0 bits (46), Expect(2) = 0.093 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = +2 / +3 Query: 1175 RNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAW 1285 R RW RR+ R R+ RW RW+ W Sbjct: 1146 RTRRWCRRRSWWWCRSRGRARWRCWYRWRWWTRWWCW 1256 Score = 30.4 bits (60), Expect(2) = 0.31 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 RR W W W +W W W+ WR W Sbjct: 117 RRLRWWRWLWWWWWSWRRWWCRWWFRWRAWSW 212 Score = 30.4 bits (60), Expect(2) = 0.31 Identities = 10/31 (32%), Positives = 12/31 (38%) Frame = +2 / +3 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 R W WW WR W + + W R W Sbjct: 474 RWRWRTWWWCWRRTWRWSRWWWWCWRRPRWW 566 Score = 24.4 bits (47), Expect(2) = 0.31 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 / +3 Query: 1115 WYAWRNGGWFPWRNGWRYAR 1174 W+ WR W+ R WR R Sbjct: 327 WWPWRWVRWWEGRWSWRRRR 386 Score = 24.4 bits (47), Expect(2) = 0.31 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 / +3 Query: 1139 WFPWRNGWRYAR 1174 W+ WR WR++R Sbjct: 645 WWCWRRTWRWSR 680 Score = 28.6 bits (56), Expect(2) = 0.42 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGWFPWR 1153 W + W + W W WF WR Sbjct: 138 WLWWWWWSWRRWWCRWWFRWR 200 Score = 25.8 bits (50), Expect(2) = 0.42 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 / +3 Query: 1271 RWYAWSWRCS 1300 RW AWSWR S Sbjct: 192 RWRAWSWRRS 221 Score = 30.9 bits (61), Expect(2) = 0.56 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = +2 / +3 Query: 1061 NAWWLPWRNAWWFPWRYGWYAWRNGGWFPW 1150 + WW+ W W+ WR+ W W W Sbjct: 1419 SGWWVWWWCWCWYRWRWRTRRWCWRRWRTW 1508 Score = 23.1 bits (44), Expect(2) = 0.56 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 W+ WF W + R W R GRR Sbjct: 1599 WQQR*WFRWWVWCWWWSRRWCWCGFRRGRR 1688 Score = 31.3 bits (62), Expect(2) = 1.5 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRYGWYAW 1126 W W WW+ WR W W Sbjct: 129 WWRWLWWWWWSWRRWWCRW 185 Score = 26.3 bits (51), Expect(2) = 1.5 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = +2 / +3 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 R W+ R+ G WR +R+ W RR R CR + RW Sbjct: 1167 RRSWWWCRSRGRARWRCWYRWRWWTRWWCWRRWWTRRWCRRRPWWWCRSRW 1319 Score = 34.5 bits (69), Expect = 2.4 Identities = 20/74 (27%), Positives = 26/74 (35%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWN 1249 W W W+ + W W R R+ R W+ R+ R R R+ W Sbjct: 819 WWCWCRWRWWTRWWHRRRWWTRWWHRRRWWTRWWCRRRSWWWCRSRGRARWRCWCRWRWW 998 Query: 1250 GRW*RNGRWYAWSW 1291 RW R RW W Sbjct: 999 TRWWRRRRWRTRRW 1040 Score = 29.5 bits (58), Expect(2) = 6.7 Identities = 8/25 (32%), Positives = 12/25 (48%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGW 1141 WW +WW+P + + WR W Sbjct: 426 WWWARWRSWWWPRWWCRWRWRTWWW 500 Score = 25.8 bits (50), Expect(2) = 6.7 Identities = 16/58 (27%), Positives = 21/58 (36%) Frame = +2 / +3 Query: 1118 YAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSW 1291 + W W R R R W+ R+ R R R+ W RW RW+ W Sbjct: 1107 WRWWTRWWRRRRWRTRRWCRRRSWWWCRSRGRARWRCWYRWRWWTRWWCWRRWWTRRW 1280 Score = 32.7 bits (65), Expect = 8.6 Identities = 14/53 (26%), Positives = 20/53 (37%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYAR 1174 W +RW R W W W + R+ + W GW+ W W + R Sbjct: 1302 WCRSRWWVWRRCRCWWRWRTWWWRRRRWRTRWWCWRWCRSGWWVWWWCWCWYR 1460
>LOC_Os06g41740:12006.t03866:unspliced-genomic expressed protein| Length = 966 Score = 46.4 bits (95), Expect(3) = 1e-07 Identities = 19/48 (39%), Positives = 21/48 (43%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGR 1210 WW WR WW R W+ W G R WR+ RR RW R R Sbjct: 288 WWRRWRWWWWRRRRRRWWWWWGGWTRRGRWRWRWWRRRWRWRRWRRRR 431 Score = 24.0 bits (46), Expect(3) = 1e-07 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / +3 Query: 1271 RWYAWSWRC 1297 RW W WRC Sbjct: 471 RW*RWRWRC 497 Score = 23.5 bits (45), Expect(3) = 1e-07 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +3 Query: 1004 RRHAWWNARW 1033 RR WW RW Sbjct: 255 RRRWWWRGRW 284 Score = 44.1 bits (90), Expect(2) = 4e-04 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 WW R WW WR+ W+ R W+ W GW Sbjct: 264 WWWRGRWWWWRRWRWWWWRRRRRRWWWWWGGW 359 Score = 24.9 bits (48), Expect(2) = 4e-04 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +2 Query: 677 CECCSRDQPRLCKGLQDPW 733 C C SR + R CK PW Sbjct: 59 CSCGSRWRRRSCKRRPPPW 115 Score = 40.9 bits (83), Expect = 0.028 Identities = 16/51 (31%), Positives = 20/51 (39%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGR 1210 W WW R W+ W GW W WR WR+ R R + + R Sbjct: 300 WRWWWWRRRRRRWWWWWGGWTRRGRWRWRWWRRRWRWRRWRRRRWGWKRRR 452 Score = 36.8 bits (74), Expect = 0.49 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYAR 1174 RR W WW W + WR+ WR W R GW+ R Sbjct: 324 RRRRWWWWWGGWTRRGRWRWRWWRRRWRWRRWRRRRWGWKRRR 452 Score = 29.5 bits (58), Expect(2) = 1.4 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 / +3 Query: 1187 WYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWR 1294 W+ R + R R + W G W R GRW WR Sbjct: 288 WWRRWRWWWWRRRRRRWWWWWGGWTRRGRWRWRWWR 395 Score = 23.1 bits (44), Expect(2) = 1.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWR 1153 WR+ W G W+ WR Sbjct: 246 WRWRRRWWWRGRWWWWR 296 Score = 34.5 bits (69), Expect = 2.4 Identities = 18/56 (32%), Positives = 21/56 (37%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAW 1246 W W+ WR + W W W R GRW R RR+ R RR W Sbjct: 267 WWRGRWWWWRRWRWWWWRRRRRRWWWWWGGWTRRGRWRWRWWRRRWRWRRWRRRRW 434 Score = 32.7 bits (65), Expect = 8.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 / +3 Query: 1232 RRYAWNGRW*RNGRWYAWSWRCSR 1303 RR+ W GRW RW W WR R Sbjct: 258 RRWWWRGRWWWWRRWRWWWWRRRR 329
>LOC_Os07g32710:12007.t02953:unspliced-genomic expressed protein| Length = 1402 Score = 40.9 bits (83), Expect(3) = 6e-07 Identities = 18/58 (31%), Positives = 24/58 (41%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 WR W+ W+ + W WR++ R R R R + R R W RW RW Sbjct: 537 WRAWWWRWQGRRIWSWWWCWRWSGRRRRNGRRWRWRVWRRRGQRWRVWRRRWHGRWRW 710 Score = 34.1 bits (68), Expect(3) = 6e-07 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 / +3 Query: 1076 PWRNAWWFPWR 1108 PWR WW+PWR Sbjct: 369 PWRRRWWWPWR 401 Score = 24.4 bits (47), Expect(3) = 6e-07 Identities = 8/27 (29%), Positives = 9/27 (33%) Frame = +2 / +3 Query: 1634 WGFHAWLFIICWXXXXXXXXXXXXRWP 1714 W F W + CW RWP Sbjct: 789 WRFRWWSWRRCWSRRQRRSRRRRWRWP 869 Score = 35.0 bits (70), Expect(4) = 1e-06 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 / +3 Query: 1085 NAWWFPWRYGWYAWR 1129 N WW WR+ W++WR Sbjct: 771 NGWWRRWRFRWWSWR 815 Score = 30.4 bits (60), Expect(4) = 1e-06 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 / +3 Query: 1007 RHAWWNARWLPIPRRHGWNAWW 1072 R WW A W R W+ WW Sbjct: 525 RRRWWRAWWWRWQGRRIWSWWW 590 Score = 26.3 bits (51), Expect(4) = 1e-06 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 / +3 Query: 1253 RW*RNGRWYAWSWRC 1297 RW R RW+ W RC Sbjct: 996 RWCRRWRWFWWWCRC 1040 Score = 24.9 bits (48), Expect(4) = 1e-06 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +2 / +3 Query: 1136 GWFPWRNGWRYARRNGRWYARR 1201 GW+ WR W + R ARR Sbjct: 900 GWWCWRRPWPWRWTRWRTRARR 965 Score = 42.3 bits (86), Expect(2) = 2e-06 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWF 1144 WW RW RR W WR WW W + W R W+ Sbjct: 459 WWCRRWKWYGRRAWRWRRWWLWRRRWWRAWWWRWQGRRIWSWW 587 Score = 30.4 bits (60), Expect(2) = 2e-06 Identities = 17/49 (34%), Positives = 21/49 (42%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWR 1294 WR R RW RR+ + R+G R W R R+ WSWR Sbjct: 669 WRVWRRRWHGRWRWRRRRSWWWWWRRHGWRRRRWNGWWRRWRFRWWSWR 815 Score = 36.8 bits (74), Expect(2) = 1e-05 Identities = 21/70 (30%), Positives = 26/70 (37%) Frame = +2 / +3 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGR 1273 W R W+ WR GW R + R RW++ R R RR W R R Sbjct: 708 WRRRRSWWWWWRRHGWRRRRWNGWWRRWRFRWWSWRRCWSRRQRRSRRRRWRWPRRRRWR 887 Query: 1274 WYAWSWRCSR 1303 + W C R Sbjct: 888 RWWLGWWCWR 917 Score = 33.1 bits (66), Expect(2) = 1e-05 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGW 1117 W R + RR W AWW W+ + W + W Sbjct: 498 WRWRRWWLWRRRWWRAWWWRWQGRRIWSWWWCW 596 Score = 38.2 bits (77), Expect(3) = 7e-05 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWW 1096 RR WN WW WR WW Sbjct: 756 RRRRWNGWWRRWRFRWW 806 Score = 28.6 bits (56), Expect(3) = 7e-05 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWF 1099 W RW RR WW W W++ Sbjct: 372 WRRRWWWPWRRWRRRGWWWRWSRRWFW 452 Score = 27.6 bits (54), Expect(3) = 7e-05 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / +3 Query: 1109 YGWYAWRNGGWFPWRNGW 1162 YG AWR W+ WR W Sbjct: 483 YGRRAWRWRRWWLWRRRW 536 Score = 27.6 bits (54), Expect(3) = 7e-05 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 / +3 Query: 1196 RRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 RRNGRR+ R RR R R W WR R Sbjct: 615 RRNGRRWRWRVWRRRGQRWRVWRRRWHGRWRWRRRR 722 Score = 23.5 bits (45), Expect(3) = 7e-05 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWR 1129 W PW + W WR Sbjct: 912 WRRPWPWRWTRWR 950 Score = 22.1 bits (42), Expect(3) = 7e-05 Identities = 10/33 (30%), Positives = 13/33 (39%) Frame = +2 / +3 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 WR R W+ R RR+ R + W W Sbjct: 945 WRTRARRRPWWGRLRRRRWCRRWRWFWWWCRCW 1043 Score = 29.0 bits (57), Expect(3) = 9e-05 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 / +3 Query: 1028 RWLPIPRRHGWNAWWLPWRNAWWFPWRY 1111 R +P R W W L R WW WR+ Sbjct: 171 RPVPRRRWRIWRRWRLRRRRRWWAWWRW 254 Score = 27.6 bits (54), Expect(3) = 9e-05 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGR 1186 W W WR WR+ RR R Sbjct: 237 WAWWRWRVWRRRWRWRRRRSR 299 Score = 26.7 bits (52), Expect(3) = 9e-05 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 1205 GRRYACRNGRRYAWNGRW*RNGRWY 1279 GR R+GRR+ W RW RW+ Sbjct: 315 GRWLWRRSGRRWWW*RRWPWRRRWW 389 Score = 32.2 bits (64), Expect(3) = 1e-04 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 R+ W R+ W+ R+GWR R NG W Sbjct: 699 RWRWRRRRSWWWWWRRHGWRRRRWNGWW 782 Score = 27.6 bits (54), Expect(3) = 1e-04 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWR 1084 WW RW RR+G W WR Sbjct: 585 WWCWRWSGRRRRNGRRWRWRVWR 653 Score = 23.1 bits (44), Expect(3) = 1e-04 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRY 1111 W WR W WR+ Sbjct: 669 WRVWRRRWHGRWRW 710 Score = 37.7 bits (76), Expect(2) = 2e-04 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = +2 / +3 Query: 1004 RRHAWWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARR 1177 RR W W P R WW R +W W + W + WR W + RR Sbjct: 360 RRWPWRRRWWWPWRRWRRRGWWWRWSRRWFWSRWWCRRWKWYGRRAWRWRRWWLWRRR 533 Score = 28.1 bits (55), Expect(2) = 2e-04 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 / +3 Query: 1223 RNGRRYAWNGRW*RNGRWYAWSWR 1294 RNGRR+ W R RW W R Sbjct: 618 RNGRRWRWRVWRRRGQRWRVWRRR 689 Score = 30.4 bits (60), Expect(2) = 0.009 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 / +3 Query: 1043 PRRHGWNAWWLPW 1081 PRR W WWL W Sbjct: 867 PRRRRWRRWWLGW 905 Score = 29.9 bits (59), Expect(2) = 0.009 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYAR 1174 W R W WR+ W+ R W WR R+ R Sbjct: 975 WGRLRRRRWCRRWRWFWWWCRCWWWRGWRRTLRHRR 1082 Score = 26.3 bits (51), Expect(3) = 0.010 Identities = 9/29 (31%), Positives = 12/29 (41%) Frame = +2 / +3 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 W+ WR W W W+ R W+ R Sbjct: 513 WWLWRRRWWRAWWWRWQGRRIWSWWWCWR 599 Score = 24.9 bits (48), Expect(3) = 0.010 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGW 1117 WW PWR W + W Sbjct: 384 WWWPWRRWRRRGWWWRW 434 Score = 24.9 bits (48), Expect(3) = 0.010 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 / +3 Query: 1238 YAWNGRW*RNGRWYAW 1285 + W+GR RNGR + W Sbjct: 594 WRWSGRRRRNGRRWRW 641 Score = 33.1 bits (66), Expect(2) = 0.021 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +2 / +3 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWF 1144 R WW R W W + W WR GW+ Sbjct: 330 RRSGRRWWW*RRWPWRRRWWWPWRRWRRRGWW 425 Score = 32.7 bits (65), Expect(2) = 0.021 Identities = 15/47 (31%), Positives = 17/47 (36%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGR 1210 W R W W GW+ WR + W ARR W R R Sbjct: 858 WRWPRRRRWRRWWLGWWCWRRPWPWRWTRWRTRARRRPWWGRLRRRR 998 Score = 26.3 bits (51), Expect(2) = 0.021 Identities = 9/26 (34%), Positives = 10/26 (38%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWW 1096 W RW R +WW WR W Sbjct: 678 WRRRWHGRWRWRRRRSWWWWWRRHGW 755 Score = 25.8 bits (50), Expect(2) = 0.021 Identities = 12/47 (25%), Positives = 19/47 (40%) Frame = +2 / +3 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSW 1291 R GW + +++R RR+ R + W W RW+ W Sbjct: 411 RRGWWWRWSRRWFWSRWWCRRWKWYGRRAWRWRRWWLWRRRWWRAWW 551 Score = 35.9 bits (72), Expect(2) = 0.029 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 / +3 Query: 1088 AWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGR 1210 +WW+ WR+ RNG + WR R +R W R +GR Sbjct: 579 SWWWCWRWSGRRRRNGRRWRWRVWRRRGQRWRVWRRRWHGR 701 Score = 22.6 bits (43), Expect(2) = 0.029 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +3 Query: 1235 RYAWNGRW*RNGRWYAWSW 1291 R W+GRW R W W Sbjct: 681 RRRWHGRWRWRRRRSWWWW 737 Score = 32.7 bits (65), Expect(2) = 0.071 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 / +3 Query: 1028 RWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWF 1144 RW RR W R+ WW+ R+GW R GW+ Sbjct: 666 RWRVWRRRWHGRWRWRRRRSWWWWWRRHGWRRRRWNGWW 782 Score = 24.4 bits (47), Expect(2) = 0.071 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +2 / +3 Query: 1130 NGGWFPWRNGWRYARRNGRWYARRNGRR 1213 NG W WR W RR RR+ RR Sbjct: 771 NGWWRRWRFRWWSWRRCWSRRQRRSRRR 854 Score = 26.7 bits (52), Expect(2) = 1.9 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWR 1153 WR + W + WR W+PWR Sbjct: 327 WRRSGRRWWW*RRWPWRRRWWWPWR 401 Score = 25.4 bits (49), Expect(2) = 1.9 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +3 Query: 1253 RW*RNGRWYAWSWR 1294 RW R G W+ WS R Sbjct: 402 RWRRRGWWWRWSRR 443 Score = 25.4 bits (49), Expect(2) = 8.3 Identities = 8/25 (32%), Positives = 11/25 (44%) Frame = +2 / +3 Query: 1112 GWYAWRNGGWFPWRNGWRYARRNGR 1186 GW+ W+ WR W +R R Sbjct: 774 GWWRRWRFRWWSWRRCWSRRQRRSR 848 Score = 24.4 bits (47), Expect(2) = 8.3 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWR 1108 RR W R +WW+ WR Sbjct: 681 RRRWHGRWRWRRRRSWWWWWR 743
>LOC_Os06g21250:12006.t01942:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 1240 Score = 55.6 bits (115), Expect = 1e-06 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARR 1177 W W+ + RR W WW WR WW WR W+ R W W W RR Sbjct: 717 WWRLWIWVRRRKWWWVWWWIWRLRWWIWWRIWWWRRRWWIWRIWWIWWWRIRR 875 Score = 31.8 bits (63), Expect(2) = 0.096 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWF 1144 W WW+ WR W+ W W+ Sbjct: 753 WWWVWWWIWRLRWWIWWRIWWW 818 Score = 24.9 bits (48), Expect(2) = 0.096 Identities = 14/48 (29%), Positives = 17/48 (35%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSW 1291 WR W R W+ R R R R + W + RW W W Sbjct: 816 WRRRWWIWRIWWIWWWRIRRIRQRIRWWRWWRRIWWWWLSRRWILWWW 959 Score = 35.9 bits (72), Expect = 0.93 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRY 1168 W + R WW WR W+ W + W W WR+ Sbjct: 861 WRIRRIRQRIRWWRWWRRIWWWWLSRRWILWWWWWRW 971 Score = 35.4 bits (71), Expect = 1.3 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 W RW R W W WR W + WR R W WR W Sbjct: 777 WRLRWWIWWRIWWWRRRWWIWRIWWIWWWRIRRIRQRIRWWRWWRRIW 920 Score = 28.1 bits (55), Expect(2) = 1.4 Identities = 8/20 (40%), Positives = 9/20 (45%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWRNGW 1162 W W+ WR W WR W Sbjct: 756 WWVWWWIWRLRWWIWWRIWW 815 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 6/13 (46%), Positives = 6/13 (46%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPW 1105 W WR WW W Sbjct: 693 WIWTWRRLWWRLW 731 Score = 34.1 bits (68), Expect = 3.3 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAW 1126 W W I R WW WR WW+ W W Sbjct: 846 WWIWWWRIRRIRQRIRWWRWWRRIWWWWLSRRWILW 953
>LOC_Os07g37380:12007.t03407:unspliced-genomic expressed protein| Length = 1199 Score = 32.2 bits (64), Expect(4) = 4e-06 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 / +2 Query: 1226 NGRRYAWNGRW*RNGRWYAWS 1288 +GRR+ W RW R G + WS Sbjct: 836 SGRRFGWGNRWWRFGWGFGWS 898 Score = 25.8 bits (50), Expect(4) = 4e-06 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / +2 Query: 1079 WRNAWWFPW 1105 WR WWF W Sbjct: 644 WRFGWWFGW 670 Score = 23.5 bits (45), Expect(4) = 4e-06 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +2 / +2 Query: 1016 WWNARWLPIPRRHGW 1060 WW W RR GW Sbjct: 536 WWWTGWSNSGRRFGW 580 Score = 22.6 bits (43), Expect(4) = 4e-06 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +2 Query: 1103 WRYGWYAWRNGGWFPWRNGWR 1165 +R+G WR G F W N R Sbjct: 689 FRWGNSWWRFGWGFGWSNSGR 751 Score = 29.0 bits (57), Expect(2) = 1.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 / +2 Query: 1226 NGRRYAWNGRW*RNGRWYAWS 1288 +GRR+ W W R G + WS Sbjct: 677 SGRRFRWGNSWWRFGWGFGWS 739 Score = 24.0 bits (46), Expect(2) = 1.1 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 / +2 Query: 1148 WRNGWRYARRNGRW 1189 WR GW R N W Sbjct: 605 WRFGWGLGRSNSGW 646 Score = 30.9 bits (61), Expect(2) = 7.6 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 / +2 Query: 1124 WRNGGWFPWRNGWRYARRNGRWY 1192 WR G WF W N R R W+ Sbjct: 644 WRFGWWFGWSNSGRRFRWGNSWW 712 Score = 23.5 bits (45), Expect(2) = 7.6 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 / +2 Query: 1226 NGRRYAWNGRW 1258 NGRR+ W W Sbjct: 1034 NGRRFGWGWHW 1066
>LOC_Os12g35710:12012.t03259:unspliced-genomic extensin-like protein, putative, expressed| Length = 2620 Score = 28.6 bits (56), Expect(4) = 1e-05 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 / -2 Query: 1124 WRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 WR W+ WR W R W+ R+ RR Sbjct: 2016 WRRFYWWWWRAHWCRGRWEFYWWRWRDHRR 1927 Score = 24.9 bits (48), Expect(4) = 1e-05 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 / -2 Query: 1082 RNAWWFPWRYGWYAWR 1129 R A+W W +G++ WR Sbjct: 2088 R*AYWCRWWWGFHRWR 2041 Score = 24.4 bits (47), Expect(4) = 1e-05 Identities = 6/17 (35%), Positives = 9/17 (52%) Frame = +2 / -2 Query: 1049 RHGWNAWWLPWRNAWWF 1099 R W+ WW + WW+ Sbjct: 2253 RRRWDDWWRWG*DGWWW 2203 Score = 24.4 bits (47), Expect(4) = 1e-05 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 / -2 Query: 1238 YAWNGRW*RNGRWYAWSW 1291 Y W R R GRW+ + W Sbjct: 1908 YQWGWRAHRCGRWWGF*W 1855 Score = 31.3 bits (62), Expect(2) = 0.23 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 / -2 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWF 1144 W W R WW +++GW A R G W+ Sbjct: 1953 WWRWRDHRRGWWWGFYQWGWRAHRCGRWW 1867 Score = 24.0 bits (46), Expect(2) = 0.23 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +2 / -2 Query: 1118 YAWRNGGWFPWRNGWRYARR 1177 + WR W+ WR W + R Sbjct: 1830 WGWRRFYWWRWRVDWCWGWR 1771 Score = 33.6 bits (67), Expect(2) = 0.32 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = +2 / -2 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 RR W W W W + + W R G W+ + A R GRW+ Sbjct: 2013 RRFYWWWWRAHWCRGRWEFYWWRWRDHRRGWWWGFYQWGWRAHRCGRWW 1867 Score = 26.7 bits (52), Expect(2) = 0.32 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = +3 / -1 Query: 1509 PTVLRSAAGQKTLVKCWKCPFAYPETCRCWLVILACRGAC 1628 P+ R AG CW+ P P + RC + G C Sbjct: 796 PSSARRCAGCSRRSGCWRAPPPSPSSRRCCPGCVRRSGCC 677 Score = 27.6 bits (54), Expect(2) = 3.3 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 / -2 Query: 1067 WWLPWRNAWWFPWRYGW 1117 W WR +W+ WR W Sbjct: 1644 WCGGWRGFYWWRWRVDW 1594 Score = 23.5 bits (45), Expect(2) = 3.3 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = +2 / -2 Query: 1109 YGWYAWRNGGWFPWR 1153 +G + WR W+ WR Sbjct: 1551 HGCWRWRGFDWWGWR 1507 Score = 27.6 bits (54), Expect(2) = 5.9 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 / -2 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 W W RR W + W W +R+ W A R GW Sbjct: 1800 WRVDWCWGWRRFYRWRWRVDWCRWWRGFYRWRWRAHRCWGW 1678 Score = 22.6 bits (43), Expect(2) = 5.9 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +2 / -2 Query: 1124 WRNGGWFPWRNGW 1162 WR W+ WR W Sbjct: 1632 WRGFYWWRWRVDW 1594 Score = 32.2 bits (64), Expect(2) = 6.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +2 / -2 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYAR 1198 WR W WR W W G W G + RR W R Sbjct: 2280 WRRQRWCRWRRRWDDWWRWG*DGWWWGMYWWRR*DHWRRR 2161 Score = 23.5 bits (45), Expect(2) = 6.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / -2 Query: 1634 WGFHAWLFIICW 1669 WGFH W I W Sbjct: 1413 WGFHWWRRIAHW 1378
>LOC_Os02g55160:12002.t05092:unspliced-genomic expressed protein| Length = 1444 Score = 30.9 bits (61), Expect(3) = 2e-05 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 / +3 Query: 1184 RWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 RW+ RR + + C R R * G+W+ W WR R Sbjct: 462 RWWNRRCLQPWYC*RRLRRWLRRRK**YGKWWGWGWRRRR 581 Score = 28.6 bits (56), Expect(3) = 2e-05 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 / +3 Query: 1076 PWRNAWWFPWRYGWYAWRNGGWFPWR 1153 PW + + WR+ W +W W WR Sbjct: 321 PWNHWRRWRWRWRWNSWCLLPWSCWR 398 Score = 26.7 bits (52), Expect(3) = 2e-05 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAW 1069 W W PR H WN W Sbjct: 285 WRRWWWNGPRLHPWNHW 335
>LOC_Os07g25810:12007.t02277:unspliced-genomic expressed protein| Length = 1681 Score = 36.3 bits (73), Expect(3) = 2e-05 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWW 1096 WW RW RR WW W WW Sbjct: 303 WWLWRWWWRRRRRWLRRWWWVWWRRWW 383 Score = 29.5 bits (58), Expect(3) = 2e-05 Identities = 14/47 (29%), Positives = 19/47 (40%) Frame = +2 / +3 Query: 1136 GWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 GW+ W W+ R G W+ R + + R W G W R W Sbjct: 978 GWWNWWWFWKRWRSWGWWWTWGRWRSWWRQWSRWRYWEGWWSRWQLW 1118 Score = 28.6 bits (56), Expect(3) = 2e-05 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRYGWYAWRNGGWFPW 1150 W WR W W +GW+ W W Sbjct: 657 WWTWRRFWKKWWTWGWWRTWWRRWSWW 737 Score = 30.9 bits (61), Expect(4) = 4e-05 Identities = 8/28 (28%), Positives = 12/28 (42%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPW 1150 WW W + W+ W+ W + W W Sbjct: 528 WWRHRTWCWRWIWQRWWFRWWHWSWHWW 611 Score = 23.5 bits (45), Expect(4) = 4e-05 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 / +3 Query: 1007 RHAWWNARWLPIPRRHGW 1060 R W RW RR GW Sbjct: 399 RRWWLRRRWWVWQRRRGW 452 Score = 23.1 bits (44), Expect(4) = 4e-05 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 / +3 Query: 1049 RHGWNAWWLPWR 1084 R W WW+ WR Sbjct: 471 RRFW*RWWIWWR 506 Score = 23.1 bits (44), Expect(4) = 4e-05 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +2 / +3 Query: 1136 GWFPWRNGWRYARRNGRW 1189 GW+ WR W+ G W Sbjct: 654 GWWTWRRFWKKWWTWGWW 707 Score = 46.9 bits (96), Expect = 5e-04 Identities = 19/58 (32%), Positives = 24/58 (41%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 W+ RW P R W W W WW ++ W + G W +R R RR RW Sbjct: 1170 WFRERWWPWGRWRTWWRRWWRWWRIWWRWRQWDWRWFWEGWWIWFRCWRRRFRRRWRW 1343 Score = 41.8 bits (85), Expect(2) = 8e-04 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYA 1195 W W RR WW+ WR W W W+ R + R GWR+ R+ R++ Sbjct: 306 WLWRWWWRRRRRWLRRWWWVWWRRWWRARWWRRWWLRRRWWVWQRRRGWRWFRQGRRFW* 485 Query: 1196 R 1198 R Sbjct: 486 R 488 Score = 22.1 bits (42), Expect(2) = 8e-04 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +2 / +3 Query: 1271 RWYAWSW 1291 RW+ WSW Sbjct: 582 RWWHWSW 602 Score = 37.3 bits (75), Expect(2) = 0.001 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRN 1132 W RW GW WW W+ + W + W WR+ Sbjct: 939 WGRGRWSRWRHWQGWWNWWWFWKRWRSWGWWWTWGRWRS 1055 Score = 30.9 bits (61), Expect(2) = 0.001 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 / +3 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWY 1192 W W W WR WR+ + + RW+ Sbjct: 1203 WRTWWRRWWRWWRIWWRWRQWDWRWF 1280 Score = 31.8 bits (63), Expect(2) = 0.003 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 / +3 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWR 1165 W+ W + W WR+ GW+ WR Sbjct: 981 WWNWWWFWKRWRSWGWWWTWGRWR 1052 Score = 30.4 bits (60), Expect(2) = 0.003 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 / +3 Query: 1055 GWNAWWLPWRNAWWFPW 1105 GW +WW W+ W + W Sbjct: 846 GWWSWWRHWQRRWTWWW 896 Score = 44.1 bits (90), Expect = 0.003 Identities = 19/57 (33%), Positives = 23/57 (40%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 W +RW RR W W W N WWF R+ + W W WR R +W Sbjct: 1095 WWSRWQLW*RRRSWWWLWQGWWNWWWFRERWWPWGRWRTWWRRWWRWWRIWWRWRQW 1265 Score = 31.8 bits (63), Expect(3) = 0.004 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPW 1105 WW R RR W W WR WW W Sbjct: 318 WWWRRRRRWLRRWWWVWWRRWWRARWWRRW 407 Score = 27.6 bits (54), Expect(3) = 0.004 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 / +3 Query: 1094 WFPWRYGWYAWRNGGWF 1144 W+ WR W W GW+ Sbjct: 657 WWTWRRFWKKWWTWGWW 707 Score = 26.7 bits (52), Expect(3) = 0.004 Identities = 10/40 (25%), Positives = 15/40 (37%) Frame = +2 / +3 Query: 1139 WFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 W+ W W + RW++ R + R W G W Sbjct: 735 WWHWEGRWTWWWFRKRWWSWGRWRTWWRRRSWWRHWEGWW 854 Score = 29.5 bits (58), Expect(2) = 0.070 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +2 / +3 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWR 1165 W+ WR + W GW+ W WR Sbjct: 1245 WWRWRQWDWRWFWEGWWIWFRCWR 1316 Score = 27.6 bits (54), Expect(2) = 0.070 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRYGW 1117 W W WW WR W Sbjct: 1203 WRTWWRRWWRWWRIWW 1250 Score = 35.4 bits (71), Expect(2) = 0.53 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 / +3 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRN 1156 RH W W W+ W + W W G W WR+ Sbjct: 864 RHWQRRWTWWWFW*RWWSWGWWWTWWGRGRWSRWRH 971 Score = 23.5 bits (45), Expect(2) = 0.53 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +2 / +3 Query: 1004 RRHAWWNARWLPIPRRHGWNAWW 1072 RR W RW + R W A W Sbjct: 327 RRRRRWLRRWWWVWWRRWWRARW 395 Score = 30.9 bits (61), Expect(2) = 0.71 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 W R+ WW + + W W+PW + RR RW+ Sbjct: 1116 W*RRRSWWWLWQGWWNWWWFRERWWPWGRWRTWWRRWWRWW 1238 Score = 27.6 bits (54), Expect(2) = 0.71 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWW 1096 WW W R W WWL R W Sbjct: 354 WWWVWWRRWWRARWWRRWWLRRRWWVW 434 Score = 34.1 bits (68), Expect = 3.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 W+ WWL R W+ GW+ WR W GW Sbjct: 600 WHWWWLW*RWRSWWRHW*GWWTWRRFWKKWWTWGW 704 Score = 34.1 bits (68), Expect = 3.3 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWR 1129 W WW W W WR+ + WR Sbjct: 1203 WRTWWRRWWRWWRIWWRWRQWDWR 1274 Score = 33.6 bits (67), Expect = 4.6 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +2 / +3 Query: 1082 RNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGR 1210 R WW WR W A W+ R W + RR G + R+ R Sbjct: 348 RRWWWVWWRRWWRARWWRRWWLRRRWWVWQRRRGWRWFRQGRR 476 Score = 33.1 bits (66), Expect = 6.3 Identities = 18/64 (28%), Positives = 23/64 (35%) Frame = +2 / +3 Query: 977 EGRIIKPLIRRHAWWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRN 1156 EGR R+ W RW RR W W W + W R + W W+ W Sbjct: 747 EGRWTWWWFRKRWWSWGRWRTWWRRRSWWRHWEGWWSWWRHWQRRWTWWWFW*RWWSWGW 926 Query: 1157 GWRY 1168 W + Sbjct: 927 WWTW 938 Score = 33.1 bits (66), Expect = 6.3 Identities = 12/44 (27%), Positives = 16/44 (36%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 W WW W W WR+ W ++ W + GRW Sbjct: 918 WGWWWTWWGRGRWSRWRHWQGWWNWWWFWKRWRSWGWWWTWGRW 1049 Score = 29.5 bits (58), Expect(2) = 7.6 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYAR 1198 +W WR + W G W W W R W++R Sbjct: 999 FWKRWRSWGWWWTWGRWRSWWRQWSRWRYWEGWWSR 1106 Score = 25.4 bits (49), Expect(2) = 7.6 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGW 1117 W WW R W WR W Sbjct: 756 WTWWWFRKRWWSWGRWRTWW 815
>LOC_Os08g01690:12008.t00068:unspliced-genomic vegetative cell wall protein gp1 precursor, putative, expressed| Length = 1776 Score = 50.6 bits (104), Expect = 4e-05 Identities = 19/61 (31%), Positives = 25/61 (40%) Frame = +2 / -1 Query: 1028 RWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNG 1207 RW G W W W+ W + W+ W + W+ GWR + GRW RR Sbjct: 453 RWGWSTAWRGRRCCWWGWSTTRWWWWGH*WWRWGTSWGWRWQGGWRGSTAWGRWGLRRRW 274 Query: 1208 R 1210 R Sbjct: 273 R 271 Score = 32.7 bits (65), Expect = 8.6 Identities = 11/36 (30%), Positives = 15/36 (41%) Frame = +2 / -1 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWR 1165 W W W +W + W+ GW G + R WR Sbjct: 378 WGH*WWRWGTSWGWRWQGGWRGSTAWGRWGLRRRWR 271
>LOC_Os01g08530:12001.t00731:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1461 Score = 35.0 bits (70), Expect(3) = 1e-04 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = +2 / +3 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 W+ W G W WR R +W+ R R+ RR W RW Sbjct: 687 WWVWCRRGCGWWHRSWRRHGRWCQWWHWRWCWRWHGGRHRRRCWRRRW 830 Score = 32.2 bits (64), Expect(3) = 1e-04 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWR 1129 R GW W R W + W W+ WR Sbjct: 186 RWRGWRCWCRWRRGWWHWRWGCRWFGWR 269 Score = 24.0 bits (46), Expect(3) = 1e-04 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 / +3 Query: 1235 RYAWNGRW*RNGRWYAWSW 1291 R+ W+GRW R R + W Sbjct: 837 RWGWDGRWRRFWRRWRCWW 893 Score = 29.0 bits (57), Expect(3) = 2e-04 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +3 Query: 1049 RHGWNAWWLPWRNAWWFPW 1105 R GW W W WW+ W Sbjct: 444 RGGWWRWIWWWCRGWWWHW 500 Score = 27.6 bits (54), Expect(3) = 2e-04 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 / +3 Query: 1235 RYAWNGRW*RNGRWYAWSWRCSR*C 1309 R WNG W RW W C R C Sbjct: 639 RRRWNGWWQWVWRWCRWWVWCRRGC 713 Score = 25.8 bits (50), Expect(3) = 2e-04 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGR 1210 WR WR+ RR W+ R R Sbjct: 585 WRWVWRWCRRWSWWWGRTRRR 647 Score = 39.6 bits (80), Expect(2) = 0.001 Identities = 19/74 (25%), Positives = 28/74 (37%) Frame = +2 / +3 Query: 1088 AWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RN 1267 +WW + W WR + WR W + R+ R + + G + W W R Sbjct: 306 SWWRRHGWQWRVWRWRWRWSWRWCWCWIRKRRGCRCRWWSQGWRWSRGGWWRWIWWWCRG 485 Query: 1268 GRWYAWSWRCSR*C 1309 W+ WR R C Sbjct: 486 WWWHWCWWRFRRRC 527 Score = 24.0 bits (46), Expect(2) = 0.001 Identities = 5/9 (55%), Positives = 5/9 (55%) Frame = +2 / +3 Query: 1070 WLPWRNAWW 1096 W WR WW Sbjct: 207 WCRWRRGWW 233 Score = 28.6 bits (56), Expect(3) = 0.002 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 / +3 Query: 1031 WLPIPRRHGWNAWWLPWR 1084 W RR W WW WR Sbjct: 1113 WWKRVRRRPWRRWWYRWR 1166 Score = 26.3 bits (51), Expect(3) = 0.002 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 WW+ WR W G + R W R R ++RR Sbjct: 1149 WWYRWRTWSGRWHWGWVWSKRRCWDGGRY**RSWSRR 1259 Score = 24.0 bits (46), Expect(3) = 0.002 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = +2 / +3 Query: 1256 W*RNGRWYAWSWRCSR 1303 W R W W W C R Sbjct: 1248 WSRRRTWSWWRWWCRR 1295 Score = 28.6 bits (56), Expect(2) = 0.23 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +3 Query: 1094 WFPWRYGWYAWRNG 1135 W WR GW+ WR G Sbjct: 207 WCRWRRGWWHWRWG 248 Score = 26.7 bits (52), Expect(2) = 0.23 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSW 1291 W W RW RR RR RR+ W R R ++W W Sbjct: 231 WHWRWGCRWFGWRWRWRRRLRREWWSWWRRHGWQWRVWRWRWRWSWRW 374 Score = 31.3 bits (62), Expect(2) = 0.35 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWR 1153 W W WR W R W++W + WR Sbjct: 243 WGCRWFGWRWRWRRRLRREWWSWWRRHGWQWR 338 Score = 28.1 bits (55), Expect(2) = 0.35 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 / +3 Query: 1136 GWFPWRNGWRYARRNGRW 1189 GW+ W WR R RW Sbjct: 1356 GWWRWCQSWRRRRTQKRW 1409 Score = 28.6 bits (56), Expect(2) = 0.43 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 1139 WFPWRNGWRYARRNGRWYARR 1201 W WR GW + R RW+ R Sbjct: 207 WCRWRRGWWHWRWGCRWFGWR 269 Score = 25.8 bits (50), Expect(2) = 0.43 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / +3 Query: 1232 RRYAWNGRW*RNGRWYAWSW 1291 R + W RW R R WSW Sbjct: 252 RWFGWRWRWRRRLRREWWSW 311 Score = 35.0 bits (70), Expect(2) = 1.1 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +2 / +3 Query: 1031 WLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 W RRHGW WR W + W + W R G W + R G W Sbjct: 300 WWSWWRRHGWQWRVWRWRWRWSWRWCWCWIRKRRGCRCRWWSQGWRWSRGGWW 458 Score = 22.6 bits (43), Expect(2) = 1.1 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / +3 Query: 1235 RYAWNGRW*RNGRW 1276 R W RW +GRW Sbjct: 819 RRRWRWRWGWDGRW 860 Score = 33.1 bits (66), Expect(2) = 2.8 Identities = 19/70 (27%), Positives = 23/70 (32%) Frame = +2 / +3 Query: 1061 NAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRY 1240 N WW R W W Y W W + W R GR+ R RR R + Sbjct: 1107 NWWWKRVRRRPWRRWWYRWRTWSGRWHWGWVWSKRRCWDGGRY**RSWSRRRTWSWWRWW 1286 Query: 1241 AWNGRW*RNG 1270 W + G Sbjct: 1287 CRRRNWCKQG 1316 Score = 23.1 bits (44), Expect(2) = 2.8 Identities = 8/23 (34%), Positives = 9/23 (39%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWR 1084 WW+ W R W W WR Sbjct: 717 WWHRSWRRHGRWCQWWHWRWCWR 785 Score = 34.1 bits (68), Expect = 3.3 Identities = 17/59 (28%), Positives = 22/59 (37%) Frame = +2 / +3 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNG 1270 WF WR+ W W+ W + R RW R + R C +R RW G Sbjct: 255 WFGWRWRWRRRLRREWWSWWRRHGWQWRVWRWRWRWSWRWCWCWIRKRRGCRCRWWSQG 431 Score = 28.6 bits (56), Expect(2) = 4.6 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGWYAWR 1129 W+ PWR WY WR Sbjct: 1116 WKRVRRRPWRRWWYRWR 1166 Score = 22.1 bits (42), Expect(2) = 4.6 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +2 / +3 Query: 1049 RHGWNAWWLPWR 1084 RH W W WR Sbjct: 960 RHWWRCQWWLWR 995 Score = 27.6 bits (54), Expect(2) = 8.3 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 W+ WW R W W++ W R W GW Sbjct: 615 WSWWWGRTRRRWNGWWQWVWRWCRWWVWCRRGCGW 719 Score = 22.1 bits (42), Expect(2) = 8.3 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +2 / +3 Query: 1049 RHGWNAWW 1072 R WN WW Sbjct: 564 RRRWNGWW 587
>LOC_Os12g01210:12012.t00020:unspliced-genomic HCF152, putative, expressed| Length = 2464 Score = 39.6 bits (80), Expect(2) = 2e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 / +2 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCS 1300 RR RW R R R RR W GRW R R A RCS Sbjct: 1853 RRGSRWRGGRGRRCCCGRR*RRRRWTGRWWRRWRTCACGRRCS 1981 Score = 26.7 bits (52), Expect(2) = 2e-04 Identities = 13/49 (26%), Positives = 17/49 (34%) Frame = +2 / +2 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 RR G +W W + W R W+ GW R RW+ Sbjct: 1652 RRRGSRSWRTRCSMRWRRTRGWQWTGRRGTCWWRRTAGWGCWSRRRRWW 1798
>LOC_Os11g01210:12011.t00021:unspliced-genomic HCF152, putative| Length = 1632 Score = 39.6 bits (80), Expect(2) = 2e-04 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 / +2 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCS 1300 RR RW R R R RR W GRW R R A RCS Sbjct: 1262 RRGSRWRGGRGRRCCCGRR*RRRRWTGRWWRRWRTCACGRRCS 1390 Score = 26.7 bits (52), Expect(2) = 2e-04 Identities = 13/49 (26%), Positives = 17/49 (34%) Frame = +2 / +2 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 RR G +W W + W R W+ GW R RW+ Sbjct: 1061 RRRGSRSWRTRCSMKWRRTRGWRWTGRRGTCWWRRTAGWGCWSRRRRWW 1207
>LOC_Os03g14620:12003.t01251:unspliced-genomic expressed protein| Length = 1470 Score = 36.3 bits (73), Expect(3) = 2e-04 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 / +3 Query: 1127 RNGGWFPWRNGWRYARRNGRWYARRNG 1207 R+G W W + WR R RW+ RR+G Sbjct: 1098 RHGSWGRWLHWWR*RHRRQRWWHRRHG 1178 Score = 23.5 bits (45), Expect(3) = 2e-04 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +2 / +3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAW 1126 W W RRHG L WR W W W Sbjct: 897 WLHWWR*RHRRHGSWGRRLCWRRWRRHRWHGSWGRW 1004 Score = 22.6 bits (43), Expect(3) = 2e-04 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 / +3 Query: 1253 RW*RNGRWYAWSWR 1294 RW R+ RW+ W R Sbjct: 1206 RWRRHRRWWWWHRR 1247 Score = 44.1 bits (90), Expect(2) = 2e-04 Identities = 21/60 (35%), Positives = 28/60 (46%) Frame = +2 / +3 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAW 1285 R+ W+ R+G W W + WR R + RR R R+ RR W+ R GRW W Sbjct: 1224 RWWWWHRRHGSWGRWLHWWR*RHRRHGSWGRRLCWRRWRRHRRRGWWHRRHRSWGRWLHW 1403 Score = 22.1 bits (42), Expect(2) = 2e-04 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWR 1084 RRHG WL WR Sbjct: 1167 RRHGSWGRWLCWR 1205 Score = 34.1 bits (68), Expect(3) = 5e-04 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 / +3 Query: 1130 NGGWFPWRNGWRYARRNGRWYARRNG 1207 +G W W + WR R RW+ RR+G Sbjct: 984 HGSWGRWLHWWR*RHRRRRWWHRRHG 1061 Score = 24.0 bits (46), Expect(3) = 5e-04 Identities = 12/37 (32%), Positives = 13/37 (35%) Frame = +2 / +3 Query: 1028 RWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGG 1138 RWL R WW R + R W WR G Sbjct: 774 RWLCWRRWRRHRRWWWWHRRHGSWGRRLCWRRWRRHG 884 Score = 22.6 bits (43), Expect(3) = 5e-04 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / +3 Query: 1205 GRRYACRNGRRYAWNGRW 1258 GRR R RR+ GRW Sbjct: 1068 GRRLCWRRWRRHGSWGRW 1121 Score = 30.9 bits (61), Expect(3) = 0.001 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 1205 GRRYACRNGRRYAWNGRW*RNGRWY 1279 GRR R RR+ W+G W R W+ Sbjct: 942 GRRLCWRRWRRHRWHGSWGRWLHWW 1016 Score = 26.7 bits (52), Expect(3) = 0.001 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 / +3 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 W R W+ R G + R WR RR+G W Sbjct: 795 WRRHRRWWWWHRRHGSWGRRLCWRRWRRHGSW 890 Score = 22.1 bits (42), Expect(3) = 0.001 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWR 1084 RRHG WL WR Sbjct: 753 RRHGSWGRWLCWR 791 Score = 35.0 bits (70), Expect(2) = 0.052 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 / +3 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 R GW+ R+ W W + WR R W+ RR+ R Sbjct: 1350 RRGWWHRRHRSWGRWLHWWR*RHRRRWWWHRRHRSR 1457 Score = 22.6 bits (43), Expect(2) = 0.052 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 / +3 Query: 1028 RWLPIPRRHGWNAWWLPW 1081 RW RRHG WL W Sbjct: 1224 RWWWWHRRHGSWGRWLHW 1277
>LOC_Os12g13890:12012.t01256:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 1067 Score = 43.2 bits (88), Expect(3) = 2e-04 Identities = 17/60 (28%), Positives = 22/60 (36%) Frame = +2 / +1 Query: 1013 AWWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 ++W W RR W A W W W W + W W + W W W RW+ Sbjct: 451 SFWWRLWTRWWRRRWWRARWWKWIWLWIRVWFWIWSGWWSFWWRLWTRWWWRRWWRTRWW 630 Score = 24.0 bits (46), Expect(3) = 2e-04 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 / +2 Query: 512 GSKGPGNGSNVRRETGRGRRASHQGY 589 G +G G+GS G+G AS GY Sbjct: 275 GGQGGGSGSGYGSGYGQGGGASGGGY 352 Score = 22.1 bits (42), Expect(3) = 2e-04 Identities = 5/7 (71%), Positives = 7/7 (100%) Frame = +2 / +1 Query: 1775 IWWRRRY 1795 +WWRRR+ Sbjct: 778 VWWRRRW 798 Score = 36.8 bits (74), Expect(2) = 0.19 Identities = 16/58 (27%), Positives = 18/58 (31%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 W W RR GW W W W W + W W WR RW+ Sbjct: 340 WRRLWKRWWRRRGWRTGWWGRIRLWIRVWFRLWSR*GSFWWRLWTRWWRRRWWRARWW 513 Score = 23.1 bits (44), Expect(2) = 0.19 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +1 Query: 1004 RRHAWWNARW 1033 RR WW RW Sbjct: 133 RRRWWWRRRW 162 Score = 31.3 bits (62), Expect(2) = 0.24 Identities = 7/16 (43%), Positives = 8/16 (50%) Frame = +2 / +1 Query: 1058 WNAWWLPWRNAWWFPW 1105 W+ WW W WW W Sbjct: 565 WSFWWRLWTRWWWRRW 612 Score = 24.0 bits (46), Expect(2) = 0.24 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / +1 Query: 1007 RHAWWNARW 1033 R WW ARW Sbjct: 484 RRRWWRARW 510
>LOC_Os03g47693:12003.t005802:unspliced-genomic expressed protein| Length = 7177 Score = 47.8 bits (98), Expect = 2e-04 Identities = 20/59 (33%), Positives = 35/59 (59%) Frame = +3 / +2 Query: 576 LTKAILLNPTSAIMYGTRASVFIKMKKPAAAIRDANAALEINPDSAKGYKTRGMANAML 752 L +AI ++PT A +Y R+ ++M + AA+ DA +++ P+ KGY +G A +L Sbjct: 6389 LMQAIEMDPTDATLYSNRSLCHLQMTEAEAALFDAEFCIQLRPEWIKGYYRKGAALMLL 6565
>LOC_Os07g32700:12007.t02952:unspliced-genomic conserved hypothetical protein| Length = 891 Score = 30.4 bits (60), Expect(3) = 3e-04 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +2 / +3 Query: 1175 RNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 R W RRNG+R+ R RR R R W WR R Sbjct: 579 RRCSWRRRRNGQRWRWRVWRRRGQRWRVWRRWCHGRWCWRWRR 707 Score = 29.5 bits (58), Expect(3) = 3e-04 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 / +3 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 W+ WR W W W+ R W+ RR Sbjct: 498 WWFWRRWRWRDWWWRWQGRRVWSWWWCRR 584 Score = 28.6 bits (56), Expect(3) = 3e-04 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 / +3 Query: 1049 RHGWNAWWLPWRNAWWFPWRY 1111 R W W + R WW WR+ Sbjct: 192 RRVWRRWRIQRRRRWWAWWRW 254 Score = 42.8 bits (87), Expect = 0.008 Identities = 23/69 (33%), Positives = 27/69 (39%) Frame = +2 / +3 Query: 1007 RHAWWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGR 1186 R WW RW RR W WR W W + W R W+ R RRNG+ Sbjct: 435 RSRWWCRRWKWYGRRAWRWRRWWFWRRWRWRDWWWRWQGRRVWSWWWCRRCSWRRRRNGQ 614 Query: 1187 WYARRNGRR 1213 + R RR Sbjct: 615 RWRWRVWRR 641 Score = 29.0 bits (57), Expect(2) = 0.59 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWR 1108 RR W WR WW+ WR Sbjct: 666 RRWCHGRWCWRWRRPWWWWWR 728 Score = 24.9 bits (48), Expect(2) = 0.59 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +2 Query: 1121 AWRNGGWFPWRNGWRYARR 1177 AW W+ WR W RR Sbjct: 731 AWWRFRWWSWRRCWSRRRR 787 Score = 28.1 bits (55), Expect(2) = 1.4 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +2 / +3 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRC 1297 RR W+ R RNG+R+ W R RW W C Sbjct: 552 RRVWSWWWCRRCSWRRRRNGQRWRWRVWRRRGQRWRVWRRWC 677 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = +2 / +3 Query: 1082 RNAWWFPWRYGWYAWR 1129 R WW+ W W+ R Sbjct: 396 RRGWWWRWSRRWFRSR 443
>LOC_Os06g21270:12006.t01944:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 991 Score = 46.9 bits (96), Expect = 5e-04 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +2 / +2 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 W W W WW+ WR+ W WR W W W + RR W Sbjct: 476 WWLWIWIWGRKWWWVWRWIWRLWRWIWWRIWWWWWWWRRRRIWW 607 Score = 35.9 bits (72), Expect = 0.93 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 / +2 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPW 1150 W W WR WW W + W+ R W+ W Sbjct: 521 WRWIWRLWRWIWWRIWWWWWWWRRRRIWWIW 613 Score = 34.5 bits (69), Expect = 2.4 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 / +2 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAW 1126 W W+ I R W W WR W WR W+ W Sbjct: 473 WWWLWIWIWGRKWWWVWRWIWRLWRWIWWRIWWWWW 580
>LOC_Os09g29980:12009.t02676:unspliced-genomic RNA recognition motif family protein, expressed| Length = 4509 Score = 33.1 bits (66), Expect(2) = 0.001 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +2 / +1 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 W W++WR W W WR + G+ + G R Sbjct: 985 WELWWWSWRRRRWTGWWRRWRRRWKLGKGWRGYGG*R 1095 Score = 30.4 bits (60), Expect(2) = 0.001 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 / +1 Query: 1055 GWNAWWLPWRNAW 1093 GW WW WR+ W Sbjct: 934 GW*RWWCSWRSGW 972 Score = 30.9 bits (61), Expect(2) = 0.089 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 / +1 Query: 1124 WRNGGWFPWRNGWRYARRNGRW 1189 W +GGW W WR R G W Sbjct: 970 WSSGGWELWWWSWRRRRWTGWW 1035 Score = 25.8 bits (50), Expect(2) = 0.089 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / +1 Query: 1091 WWFPWRYGW 1117 WW WR GW Sbjct: 946 WWCSWRSGW 972 Score = 35.4 bits (71), Expect = 1.3 Identities = 11/33 (33%), Positives = 11/33 (33%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGW 1117 W W GW WW WR W W W Sbjct: 946 WWCSWRSGWSSGGWELWWWSWRRRRWTGWWRRW 1044
>LOC_Os06g03590:12006.t00251:unspliced-genomic conserved hypothetical protein| Length = 525 Score = 39.1 bits (79), Expect(2) = 0.001 Identities = 19/52 (36%), Positives = 21/52 (40%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 WR R R +ARR R+ R GRW R RW W WR R Sbjct: 150 WRRSRRERRERRGRWARRRRWRWWWWRRERQERRGRWARRRRWRWWWWRRER 305 Score = 24.0 bits (46), Expect(2) = 0.001 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWR 1084 RR G WW WR Sbjct: 111 RRRGRGRWWWRWR 149 Score = 30.4 bits (60), Expect(2) = 1.1 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +2 / +3 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 R G RR RW+ R R+ R+ GRW R RW Sbjct: 246 RRGRWARRRRWRWWWWRRERQERRARRGRWQRRGRWARRRRW 371 Score = 22.6 bits (43), Expect(2) = 1.1 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = +2 / +3 Query: 1082 RNAWWFPWRY 1111 R WW+ WR+ Sbjct: 123 RGRWWWRWRW 152
>LOC_Os11g46240:12011.t04148:unspliced-genomic ATP binding protein, putative, expressed| Length = 6759 Score = 37.3 bits (75), Expect(2) = 0.002 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPW 1105 W WW WR +WWF W Sbjct: 5709 WWFWWQRWRKSWWFWW 5756 Score = 25.4 bits (49), Expect(2) = 0.002 Identities = 6/17 (35%), Positives = 8/17 (47%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGW 1141 W PW + W+ W W Sbjct: 5856 WTRPW*FLWWTWWERAW 5906 Score = 37.3 bits (75), Expect = 0.36 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRYGWYAWRNGGWFPW 1150 W W W + W + W WR WF W Sbjct: 5676 W*LWWERWSWTWWFWWQRWRKSWWFWW 5756 Score = 34.1 bits (68), Expect = 3.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAW 1126 W WW W WWF W+ +W Sbjct: 5676 W*LWWERWSWTWWFWWQRWRKSW 5744 Score = 32.7 bits (65), Expect = 8.6 Identities = 9/31 (29%), Positives = 13/31 (41%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNG 1159 WW W W+ + W W+ WR+G Sbjct: 5490 WWTGWPRRLWWSGWPWGFYWSRRSWWLWRSG 5582
>LOC_Os06g21210:12006.t01938:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 1089 Score = 29.5 bits (58), Expect(3) = 0.002 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 W + W+ R GW WR R+ RR RW+ Sbjct: 651 WTWVWWRVRWFGWRIWRWIRRWIRRWIRWW 740 Score = 26.3 bits (51), Expect(3) = 0.002 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 / +3 Query: 965 *GQEEGRIIKPLIRRHAWWNARW 1033 *G + GR I P R WW RW Sbjct: 498 *GSKVGRWILPWWRIWIWWWVRW 566 Score = 23.1 bits (44), Expect(3) = 0.002 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +2 / +3 Query: 1058 WNAWWLPWR 1084 W WW+ WR Sbjct: 582 WVRWWVRWR 608
>LOC_Os12g31800:12012.t02883:unspliced-genomic glycine-rich RNA-binding protein 7, putative, expressed| Length = 3854 Score = 41.4 bits (84), Expect(2) = 0.002 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 / +2 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPW 1105 WW R LP RR W W W+ WW+ W Sbjct: 3257 WWWRRRLPRRRRWLWWQQWRVWQQGWWWRW 3346 Score = 27.2 bits (53), Expect(2) = 0.002 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 / +2 Query: 1262 RNGRWYAWSWRCSR*C 1309 + G W+ W W C R C Sbjct: 3323 QQGWWWRWLWSCRRIC 3370 Score = 27.6 bits (54), Expect(2) = 5.7 Identities = 9/29 (31%), Positives = 12/29 (41%) Frame = +2 / +2 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARR 1177 WW W + + W W+ WR RR Sbjct: 3206 WWLQWWWWLWRWWLQWWWWWRRRLPRRRR 3292 Score = 22.6 bits (43), Expect(2) = 5.7 Identities = 6/16 (37%), Positives = 7/16 (43%) Frame = +2 / +2 Query: 1049 RHGWNAWWLPWRNAWW 1096 R W WW + WW Sbjct: 3182 RRRWRLWWWWLQWWWW 3229
>LOC_Os06g47200:12006.t04406:unspliced-genomic lipid binding protein, putative, expressed| Length = 2875 Score = 44.6 bits (91), Expect = 0.002 Identities = 19/41 (46%), Positives = 20/41 (48%) Frame = +2 / +1 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACR 1225 WR GW W WR+ WR A R R ARR RR CR Sbjct: 124 WRRGWLRRWRPWWRLWRSRWRRAGRRSRRRARRAARRSWCR 246 Score = 29.5 bits (58), Expect(2) = 1.8 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 / +1 Query: 1049 RHGWNAWWLPWRNAWWFPWR 1108 R GW W PW W WR Sbjct: 127 RRGWLRRWRPWWRLWRSRWR 186 Score = 22.6 bits (43), Expect(2) = 1.8 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / +1 Query: 1148 WRNGWRYARRNGRWYARRN 1204 WR R +RR R ARR+ Sbjct: 181 WRRAGRRSRRRARRAARRS 237 Score = 32.7 bits (65), Expect = 8.6 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 / +1 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGR 1186 WR W WR W WR+ R R ARR R Sbjct: 124 WRRGWLRRWRPWWRLWRSRWRRAGRRSRRRARRAAR 231
>LOC_Os05g35460:12005.t03139:unspliced-genomic patellin-1, putative, expressed| Length = 2997 Score = 44.1 bits (90), Expect = 0.003 Identities = 21/56 (37%), Positives = 26/56 (46%) Frame = +2 / +1 Query: 1070 WLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRR 1237 WL R+ P W+ R W+ WR WR+ RR W +RR RR R RR Sbjct: 199 WLRRRSKRPPPPPRWWWWRRPTRWWRWRRPWRWRRRRRSWRSRRRRRRRRRRRRRR 366
>LOC_Os03g01320:12003.t00030:unspliced-genomic NT16 polypeptide, putative, expressed| Length = 1087 Score = 44.1 bits (90), Expect = 0.003 Identities = 19/53 (35%), Positives = 24/53 (45%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRR 1237 WR W + W W WR F WR +R+ R+ R + R RR R RR Sbjct: 210 WRWRWRWRWWRAWRWWRERRRFRWRRRFRWRRKRRRRFRRWRKRRRRRRRKRR 368 Score = 29.9 bits (59), Expect(2) = 0.58 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARR 1177 WR+ W WR W+ R +R+ RR Sbjct: 216 WRWRWRWWRAWRWWRERRRFRWRRR 290 Score = 24.0 bits (46), Expect(2) = 0.58 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 / +3 Query: 1160 WRYARRNGRWYARRNGRR 1213 WR RR R RR GRR Sbjct: 330 WRKRRRRRRRKRRRRGRR 383
>LOC_Os05g44760:12005.t03964:unspliced-genomic hexokinase-2, putative, expressed| Length = 5643 Score = 30.9 bits (61), Expect(2) = 0.004 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 / +1 Query: 1118 YAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACR 1225 + WR GG + WR RR GR RR R ++ R Sbjct: 238 WCWRGGGGGGTWSWWREPRRRGRGRWRR*SRTWSTR 345 Score = 30.4 bits (60), Expect(2) = 0.004 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 / +1 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYG 1114 RR WW P R+ W + WR G Sbjct: 187 RRRWGRRWWWPRRSGWRWCWRGG 255
>LOC_Os01g41120:12001.t03634:unspliced-genomic protein binding protein, putative, expressed| Length = 2099 Score = 28.6 bits (56), Expect(3) = 0.005 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 / -1 Query: 1016 WWNARWLPIPRRHGWNAWWLPWR 1084 WW R R W WW WR Sbjct: 1403 WWRRRRRGRRWRRRWRWWWWRWR 1335 Score = 25.4 bits (49), Expect(3) = 0.005 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 / -1 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGR 1255 WR W RR RW+ R R R R + W R Sbjct: 1361 WRWWWWRWRRR*RWWRRG*RRWRRRRRRRWWRWRRR 1254 Score = 23.1 bits (44), Expect(3) = 0.005 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +2 / -2 Query: 1274 WYAWSWRCS 1300 W W+W CS Sbjct: 1207 WVFWNWHCS 1181 Score = 37.7 bits (76), Expect(2) = 0.15 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 / -1 Query: 1004 RRHAWWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNG 1135 RR WW RW RR W WW+ WR WR G Sbjct: 1439 RRWRWWRRRWRWWWRRRRRGRRWRRRWRWWWWRWRRR*RWWRRG 1308 Score = 23.5 bits (45), Expect(2) = 0.15 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 / -3 Query: 1160 WRYARRNGRWYARRNGRRYACRNG 1231 WR ARR R R G CR G Sbjct: 507 WRGARRGRRAGRARRGGGPPCRRG 436 Score = 29.5 bits (58), Expect(2) = 1.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / -1 Query: 1232 RRYAWNGRW*RNGRWYAWSWR 1294 RR RW R RW+ W WR Sbjct: 1397 RRRRRGRRWRRRWRWWWWRWR 1335 Score = 23.1 bits (44), Expect(2) = 1.4 Identities = 7/17 (41%), Positives = 8/17 (47%) Frame = +2 / -1 Query: 1079 WRNAWWFPWRYGWYAWR 1129 WR W WR+ WR Sbjct: 1457 WRRRRWRRWRWWRRRWR 1407
>LOC_Os03g47650:12003.t04128:unspliced-genomic ankyrin-1, putative, expressed| Length = 7227 Score = 43.2 bits (88), Expect = 0.006 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +3 / +1 Query: 585 AILLNPTSAIMYGTRASVFIKMKKPAAAIRDANAALEINPDSAKGYKTRGMA 740 AI L+PT A ++ R+ ++K + A+ DA + + PD KGY +G A Sbjct: 6235 AIQLDPTDATLHSNRSFCYLKSGEAREALVDAKTCIGLKPDWPKGYYRKGAA 6390
>LOC_Os05g02750:12005.t00174:unspliced-genomic membrane protein, putative, expressed| Length = 1139 Score = 32.7 bits (65), Expect(3) = 0.006 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 WR WR+ARR GR R G R+ R R RW Sbjct: 651 WRRRWRWARRRGRRRRGR*GGRW*SRCRR*STTPRRW 761 Score = 29.0 bits (57), Expect(3) = 0.006 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWW 1072 WW RW R G ++WW Sbjct: 147 WW*IRWTRARRGSGGSSWW 203 Score = 22.6 bits (43), Expect(3) = 0.006 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 / +3 Query: 1432 RRWDPSSPR*W 1464 RRW PSS R W Sbjct: 813 RRWRPSSCRSW 845
>LOC_Os06g51440:12006.t04827:unspliced-genomic expressed protein| Length = 956 Score = 41.8 bits (85), Expect(2) = 0.008 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPW 1150 R HG+ WW W + R+ W +WR G W+ W Sbjct: 351 RWHGFRVWWWLWFRL*LWGPRWRWRSWRRGWWWIW 455 Score = 22.6 bits (43), Expect(2) = 0.008 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = +2 / +3 Query: 1271 RWYAWSWR 1294 RW++W WR Sbjct: 609 RWWSWWWR 632 Score = 38.2 bits (77), Expect(2) = 0.011 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 +W RW RR W PW W+ W + W WR W Sbjct: 93 YWWWRWWVWQRRRRRQWWIRPWLWLWFRIWFWQWRCWRRWLW 218 Score = 25.8 bits (50), Expect(2) = 0.011 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 / +3 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 W++W W WR G R +R R RR+ R Sbjct: 612 WWSWWWRWWCGWRWGRRELQRWNRRIWRRSWLR 710 Score = 25.8 bits (50), Expect(3) = 0.077 Identities = 12/40 (30%), Positives = 15/40 (37%) Frame = +2 / +3 Query: 1139 WFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 WF WR RW +R RR C + W +W Sbjct: 180 WFWQWRCWRRWLWRWRWVWQRRRRRQWCIRPGLWLWFWQW 299 Score = 24.9 bits (48), Expect(3) = 0.077 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 / +3 Query: 1244 WNGRW*RNGRWYAWSWR 1294 W R R G W+ W W+ Sbjct: 414 WRWRSWRRGWWWIWLWQ 464 Score = 22.1 bits (42), Expect(3) = 0.077 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = +2 / +3 Query: 1082 RNAWWFPWRYGWYAWRNGGWFPWR 1153 R W PW + W+ W WR Sbjct: 135 RQWWIRPWLWLWFRIWFWQWRCWR 206 Score = 35.4 bits (71), Expect = 1.3 Identities = 16/57 (28%), Positives = 19/57 (33%) Frame = +2 / +3 Query: 1028 RWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYAR 1198 +W RR W WW W W+ W W + W W R RW R Sbjct: 516 KWRWWQRRWWWRRWWSLRIQVWCRLWQRIWLRWWSWWWRWWCGWRWGRRELQRWNRR 686
>LOC_Os02g03480:12002.t00248:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1096 Score = 30.9 bits (61), Expect(3) = 0.011 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 WR G WR W + RR G ++RR RR Sbjct: 696 WR*GRHRGWRWRWCWRRRRGWRWSRRQSRR 785 Score = 28.6 bits (56), Expect(3) = 0.011 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 / +3 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 RH W WR W + R GW R+ GW Sbjct: 510 RHRGWRWSWRWRWRWCWCRRRGWR*GRHRGW 602 Score = 24.0 bits (46), Expect(3) = 0.011 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 / +2 Query: 514 KQRARQWKQCQKGNWKRPSSISP 582 K +RQW++ +W+R SS P Sbjct: 95 KLSSRQWRR*AGRSWRRCSSSPP 163 Score = 29.0 bits (57), Expect(2) = 0.072 Identities = 16/51 (31%), Positives = 19/51 (37%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 WR G WR WR+ R R + R + RR W R RW Sbjct: 576 WR*GRHRGWRRSWRWRWRRHRGWR*GRHRGWRRSWRRRRGWR*GRHRGWRW 728 Score = 28.1 bits (55), Expect(2) = 0.072 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGW 1141 W WR W + R GW R+ GW Sbjct: 450 WHRSWRWRWCWRRRRGWR*GRHRGW 524 Score = 28.1 bits (55), Expect(2) = 1.4 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 WR + WR + R + R RR R GR W RW Sbjct: 600 WRRSWRWRWRRHRGWR*GRHRGWRRSWRRRRGWR*GRHRGWRWRW 734 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGW 1141 W + WR+ W R GW Sbjct: 528 WSWRWRWRWCWCRRRGW 578 Score = 26.7 bits (52), Expect(3) = 7.4 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 WR + R GWR++RR R R RR Sbjct: 720 WRWRWCWRRRRGWRWSRRQSRRRRRGRRRR 809 Score = 24.0 bits (46), Expect(3) = 7.4 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGW 1117 WR +W + WR+ W Sbjct: 522 WRWSWRWRWRWCW 560 Score = 22.1 bits (42), Expect(3) = 7.4 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = +1 / +3 Query: 526 RQWKQCQKGNWKR 564 R+W+ C + W+R Sbjct: 312 RRWRWCWRRRWRR 350
>LOC_Os06g21240:12006.t01941:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 1443 Score = 42.3 bits (86), Expect = 0.011 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 W+ W + W W WR W+ W W WR W Sbjct: 1110 WSQWRIWWWLRRWLWWRIRWWGWLRWWWRLWRRTW 1214 Score = 38.2 bits (77), Expect = 0.19 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWF 1144 W WL WR WW R+ W WR W+ Sbjct: 1134 WLRRWLWWRIRWWGWLRWWWRLWRRTWWW 1220 Score = 28.6 bits (56), Expect(2) = 1.4 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWF 1099 WW WR WW+ Sbjct: 1188 WWRLWRRTWWW 1220 Score = 24.0 bits (46), Expect(2) = 1.4 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 / +3 Query: 1001 IRRHAWWNARW 1033 +RR WW RW Sbjct: 1137 LRRWLWWRIRW 1169
>LOC_Os05g47940:12005.t04229:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 1838 Score = 42.3 bits (86), Expect = 0.011 Identities = 18/48 (37%), Positives = 21/48 (43%) Frame = +2 / -3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGR 1210 W WR WR WY WR W G+ + RR RW+ R N R Sbjct: 450 WQR*WRRRRGNRWRRRWYGWRRR*HRWWWRGYGWRRR*HRWWRRVNRR 307 Score = 33.1 bits (66), Expect(2) = 0.17 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 / -3 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACR 1225 W WR G WR W+ G R+ RR R + RR G R+ R Sbjct: 534 WRRWRRGHRWWR**HWWWR*RGHRWRRRWQR*WRRRRGNRWRRR 403 Score = 22.6 bits (43), Expect(2) = 0.17 Identities = 7/24 (29%), Positives = 10/24 (41%) Frame = +2 / -3 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGW 1117 RR + WW + WW + W Sbjct: 624 RR*WYYRWWRGCHHWWWRRGEHRW 553
>LOC_Os03g47640:12003.t04127:unspliced-genomic conserved hypothetical protein| Length = 7473 Score = 42.3 bits (86), Expect = 0.011 Identities = 17/59 (28%), Positives = 32/59 (54%) Frame = +3 / +1 Query: 576 LTKAILLNPTSAIMYGTRASVFIKMKKPAAAIRDANAALEINPDSAKGYKTRGMANAML 752 + +A+ L+P A +Y R+ ++ A+ DAN +++ P+ KGY +G A+ L Sbjct: 6838 MMQAMKLDPADATLYSNRSLCHLRSGAAQEALLDANDCIKLKPEWTKGYYRKGCAHMAL 7014
>LOC_Os03g15700:12003.t01356:unspliced-genomic splicing factor 3A subunit 2, putative, expressed| Length = 2898 Score = 36.8 bits (74), Expect(2) = 0.011 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 / -3 Query: 1034 LPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 L R GW+ W R WW R W WRN W Sbjct: 2443 LSTTNRWGWDPWGHTHRCIWWRRRRSLWRGWRNLRW 2336 Score = 23.1 bits (44), Expect(2) = 0.011 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +2 / -3 Query: 1136 GWFPWRNGWRYARRNGRWYARRNGRR 1213 GW R GW + W + R+ RR Sbjct: 2356 GWRNLRWGWAWWTSRSIWQSPRSRRR 2279
>LOC_Os06g21220:12006.t01939:unspliced-genomic glycine-rich cell wall structural protein precursor, putative| Length = 1589 Score = 35.0 bits (70), Expect(2) = 0.012 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / +2 Query: 1067 WWLPWRNAWWFPWRYGWYAWR 1129 W WR W WR W+ WR Sbjct: 1457 WMWVWRRVWRLRWRVWWWVWR 1519 Score = 24.9 bits (48), Expect(2) = 0.012 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 / +2 Query: 974 EEGRIIKPLIRRHAWWNARW 1033 E GR I P R WW RW Sbjct: 1313 EVGRWILPWWRIWIWWWVRW 1372 Score = 32.2 bits (64), Expect(2) = 0.038 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / +2 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 W WW W + W WR + WR W Sbjct: 1325 WILPWWRIWIWWWVRWRIWSSWVWRWVW 1408 Score = 25.8 bits (50), Expect(2) = 0.038 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = +2 / +2 Query: 1235 RYAWNGRW*RNGRWYAWSW 1291 R+ W W RW+ W W Sbjct: 1397 RWVWWRVWLSKVRWWLWRW 1453 Score = 29.0 bits (57), Expect(2) = 0.42 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 / +2 Query: 1058 WNAWWLPWRNAWWFPWRYGWY 1120 W WW+ WR + WR+ W+ Sbjct: 1349 WIWWWVRWRIWSSWVWRWVWW 1411 Score = 25.4 bits (49), Expect(2) = 0.42 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / +2 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYAR 1198 W+ WR + WR WR R W R Sbjct: 1436 WWLWRWIWMWVWRRVWRLRWRVWWWVWR 1519 Score = 35.0 bits (70), Expect = 1.8 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +2 / +2 Query: 1070 WLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRY 1168 W WR W + WR W W+ WR WR+ Sbjct: 1436 WWLWRWIWMWVWRRVWRLRWRVWWWVWRWIWRW 1534
>LOC_Os06g09870:12006.t00865:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 1107 Score = 26.7 bits (52), Expect(3) = 0.013 Identities = 12/41 (29%), Positives = 15/41 (36%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 WR WW + + W W W +RR W RR Sbjct: 267 WRRKWWIWVWFRIWFWVWSSWRIWALWRLCSRRWRWWRRRR 389 Score = 24.9 bits (48), Expect(3) = 0.013 Identities = 6/13 (46%), Positives = 6/13 (46%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWW 1096 W W WR WW Sbjct: 216 WTRWVC*WRRWWW 254 Score = 24.0 bits (46), Expect(3) = 0.013 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 / +3 Query: 1232 RRYAWNGRW*RNGRWYA 1282 R + W+GRW + RW++ Sbjct: 426 RFWLWSGRWIWSLRWWS 476 Score = 29.0 bits (57), Expect(2) = 1.9 Identities = 10/31 (32%), Positives = 12/31 (38%) Frame = +2 / +3 Query: 1004 RRHAWWNARWLPIPRRHGWNAWWLPWRNAWW 1096 RR WW W R W W ++WW Sbjct: 603 RRRRWWRWWWWTKWRVRVWLRLWFRIWSSWW 695 Score = 23.1 bits (44), Expect(2) = 1.9 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWF 1144 WR+ W W WF Sbjct: 741 WRWWWTKWPRR*WF 782 Score = 28.1 bits (55), Expect(2) = 6.3 Identities = 8/24 (33%), Positives = 8/24 (33%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPW 1150 W WW W WR W W Sbjct: 456 WSLRWWSICSRRWRRWRRRWWSKW 527 Score = 22.1 bits (42), Expect(2) = 6.3 Identities = 8/23 (34%), Positives = 9/23 (39%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGRWY 1192 W G W WR R RW+ Sbjct: 552 WLWSGRGIWSIWWRICSRRRRWW 620
>LOC_Os10g31460:12010.t02469:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 8917 Score = 30.4 bits (60), Expect(2) = 0.014 Identities = 11/41 (26%), Positives = 15/41 (36%) Frame = +2 / +2 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 WW WW + ++ W + W WR R G W Sbjct: 362 WWWWRWAEWWIRIWFWFWIWVWTSRWVWTLWWRICSRRGWW 484 Score = 29.0 bits (57), Expect(2) = 0.014 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +2 Query: 1235 RYAWNGRW*RNGRWYAWSW 1291 R W RW R W+ W W Sbjct: 470 RRGWWPRWRRRAEWWIWIW 526 Score = 29.9 bits (59), Expect(2) = 0.12 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 / +2 Query: 1079 WRNAWWFPWRYGWYAWRNGGWF 1144 WR WW+ WR+ + R WF Sbjct: 347 WRRRWWWWWRWAEWWIRIWFWF 412 Score = 26.3 bits (51), Expect(2) = 0.12 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 / +2 Query: 1238 YAWNGRW*RNGRWYAWSWRCS 1300 + W W G W W W CS Sbjct: 530 WLWIWIWSSRGIWAIWWWLCS 592 Score = 38.2 bits (77), Expect = 0.19 Identities = 15/52 (28%), Positives = 21/52 (40%) Frame = +2 / +1 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRN 1204 R W W W W + W + W +WR W R+ R RW+ R+ Sbjct: 8464 RTRWRWWTKWWIRIWVWLWLWVWSSWRVWAVRWWICSGRWPRWRWRWWTERS 8619 Score = 32.2 bits (64), Expect(2) = 5.5 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 / +2 Query: 1061 NAWWLPWRNAWWFPWRYGWYAW 1126 + WW WR WW W W Sbjct: 3713 SGWWPRWRRRWWTEWSRRQRIW 3778 Score = 25.4 bits (49), Expect(2) = 5.5 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 / +1 Query: 1256 W*RNGRWYAWSWR 1294 W +GRW W WR Sbjct: 8563 WICSGRWPRWRWR 8601
>LOC_Os12g29160:12012.t02626:unspliced-genomic fibroin heavy chain precursor, putative| Length = 4576 Score = 30.9 bits (61), Expect(2) = 0.015 Identities = 13/42 (30%), Positives = 16/42 (38%) Frame = +2 / +1 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWY 1192 WW WW P R + W G + W R R N W+ Sbjct: 2662 WWRRNTVRWWHPRRCT*WCWSWSGHWSWFLANRSWRWNPLWW 2787 Score = 28.6 bits (56), Expect(2) = 0.015 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 / +1 Query: 1247 NGRW*RNGRWYAWSWRCSR*C 1309 N RW* N W+ +WRC+ C Sbjct: 2875 NRRW*WNPLWWWCAWRCT*WC 2937 Score = 36.8 bits (74), Expect = 0.49 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = +2 / +1 Query: 1004 RRHAWWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWR 1153 RR W RW R W +W WW+ W W+ W WR Sbjct: 4252 RRWRWNPLRWWRTRRCAWWGWFWWWCGTYWWWRWYCLWWWW*RRRGCTWR 4401 Score = 27.2 bits (53), Expect(2) = 7.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 / +1 Query: 1247 NGRW*RNGRWYAWSWRCSR*C 1309 N RW N W+ +WRC+ C Sbjct: 3661 NRRWRWNPLWWRCTWRCT*WC 3723 Score = 22.6 bits (43), Expect(2) = 7.5 Identities = 8/28 (28%), Positives = 11/28 (39%) Frame = +2 / +1 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 W W +WW+ + AWR W Sbjct: 3544 WCRCWFFISRSWWWNPLWWRCAWRCTRW 3627
>LOC_Os09g01700:12009.t00072:unspliced-genomic conserved hypothetical protein| Length = 2757 Score = 41.8 bits (85), Expect = 0.015 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = +2 / -3 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 R G WR G WR GW+ A GRW++RR R Sbjct: 478 RRGGERWRERGGGWWRAGWKAAAAGGRWWSRRGSWR 371
>LOC_Os08g02210:12008.t00116:unspliced-genomic expressed protein| Length = 1989 Score = 41.8 bits (85), Expect = 0.015 Identities = 24/55 (43%), Positives = 26/55 (47%) Frame = +2 / +3 Query: 1139 WFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 W R WR RR+GR Y + G A R RR R GRW A SW CSR Sbjct: 189 WRRRRCCWRQWRRHGRVYRLQGGGFGARRLRRRRWGRRRSTGTGRWSAPSWGCSR 353
>LOC_Os05g38070:12005.t03349:unspliced-genomic conserved hypothetical protein| Length = 657 Score = 41.8 bits (85), Expect = 0.015 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 / +2 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 R W+ R PW GW AR +GRW +GRR Sbjct: 539 RCSWWTSRRMAATPWSTGWSVARSSGRWSRTSSGRR 646
>LOC_Os03g38970:12003.t03340:unspliced-genomic expressed protein| Length = 12830 Score = 41.8 bits (85), Expect = 0.015 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = +2 / +2 Query: 1127 RNGGWFPWRNGWRYARRNGRWYARRNGRRYACR 1225 R+GGW WR+ WR +R + R AR +GRR + R Sbjct: 452 RSGGWRRWRSRWRRSRSSARGEARCSGRRPSSR 550
>LOC_Os03g64130:12003.t05625:unspliced-genomic expressed protein| Length = 1758 Score = 36.3 bits (73), Expect(2) = 0.015 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 / +3 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 R G W R C R AW+ R R GRW W C R Sbjct: 1212 RWEGSWSGWPRWRTRRCGGRRSEAWSSRGRRRGRWRLRRWWCRR 1343 Score = 23.1 bits (44), Expect(2) = 0.015 Identities = 7/20 (35%), Positives = 7/20 (35%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWRNGW 1162 WR WR G W W Sbjct: 1170 WRRRSRGWRGSGGRRWEGSW 1229
>LOC_Os05g02754:12005.t004759:unspliced-genomic expressed protein| Length = 1870 Score = 32.7 bits (65), Expect(3) = 0.016 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +2 / -2 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 WR WR+ARR GR R G R+ R R RW Sbjct: 993 WRRRWRWARRRGRRRRGR*GGRW*SRCRR*STTPRRW 883 Score = 29.0 bits (57), Expect(3) = 0.016 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 / -2 Query: 1016 WWNARWLPIPRRHGWNAWW 1072 WW RW R G ++WW Sbjct: 1497 WW*IRWTRARRGSGGSSWW 1441 Score = 22.6 bits (43), Expect(3) = 0.016 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +1 / -2 Query: 1432 RRWDPSSPR*W 1464 RRW PSS R W Sbjct: 831 RRWRPSSCRSW 799
>LOC_Os12g13840:12012.t01251:unspliced-genomic glycine-rich cell wall structural protein 1 precursor, putative| Length = 501 Score = 32.7 bits (65), Expect(2) = 0.017 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 RR GW WW W+ W W W R W Sbjct: 114 RRWGWRGWWRQWQW*WIRIWV*LW*RRRTKWW 209 Score = 26.7 bits (52), Expect(2) = 0.017 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGRW 1189 WR G W R WR+ + +W Sbjct: 207 WRTGEWRRRRRRWRWQQWKWKW 272 Score = 30.9 bits (61), Expect(2) = 8.2 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = +2 / +3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 W WW+ R+GW W + W W Sbjct: 90 WWGKWWWRRRWGWRGWWRQWQW*WIRIW 173 Score = 22.1 bits (42), Expect(2) = 8.2 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = +2 / +3 Query: 1262 RNGRWYAWSWRCSR 1303 R RW W W+ R Sbjct: 237 RRWRWQQWKWKWIR 278 Score = 32.7 bits (65), Expect = 8.6 Identities = 20/71 (28%), Positives = 26/71 (36%) Frame = +2 / +3 Query: 1082 RNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW* 1261 R W ++ W R W R W R RW+ RR R + R + W W Sbjct: 231 RRRRWRWQQWKWKWIRLWIWLWPREWWSTRTR*RRWWRRRRRRGRRWKWTR*WIWIWIWV 410 Query: 1262 RNGRWYAWSWR 1294 G W+ W R Sbjct: 411 W*GWWWRWRRR 443
>LOC_Os01g49560:12001.t04395:unspliced-genomic expressed protein| Length = 1105 Score = 32.2 bits (64), Expect(2) = 0.018 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +2 / -1 Query: 1100 PWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAW 1246 P R + R G R WR RR GR RR GR G AW Sbjct: 358 PRRMSCRSARTGRRRARRRRWRCGRRRGRHRPRRRGRARRGGGGAEEAW 212 Score = 31.3 bits (62), Expect(2) = 0.018 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 / -1 Query: 1004 RRHAWWNARWLPIPRRHGWNAWW 1072 +RHA+ N W + RR+ N WW Sbjct: 1015 KRHAYRNGSWSGLRRRNR*NPWW 947
>LOC_Os02g37654:12002.t03402:unspliced-genomic 1-O-acylceramide synthase precursor, putative, expressed| Length = 10594 Score = 41.4 bits (84), Expect = 0.021 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 / +2 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYAR 1174 R G WWL W F WR+G W G W N WR R Sbjct: 4505 RGGE*RWWLGLAVEWEFRWRFGEEKWMPGYSMAW*N*WRQRR 4630
>LOC_Os01g69020:12001.t06256:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1375 Score = 35.4 bits (71), Expect(2) = 0.021 Identities = 20/64 (31%), Positives = 27/64 (42%) Frame = +2 / +2 Query: 1118 YAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRC 1297 + W G + W R RR + R R + RR+ W RW R+ RW + RC Sbjct: 572 WRWCEGRRWRWCWRRRRRRRWSSRWHRC*RRCWRWYGRRRWCWRWRWRRSRRWRSRRHRC 751 Query: 1298 SR*C 1309 R C Sbjct: 752 *RRC 763 Score = 23.5 bits (45), Expect(2) = 0.021 Identities = 9/25 (36%), Positives = 9/25 (36%) Frame = +2 / +2 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAW 1093 W RW RR W WR W Sbjct: 476 WRRRWRWCWRRCEGRCWRRRWRWCW 550
>LOC_Os08g41590:12008.t03888:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 1283 Score = 31.8 bits (63), Expect(2) = 0.021 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +2 / +2 Query: 1175 RNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 R GR RR R CR+ RR+ W W R G + + RC R Sbjct: 749 RRGRGGGRR*AGRGWCRSTRRWGWPTCWRRWGCRSSSTARCRR 877 Score = 27.2 bits (53), Expect(2) = 0.021 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / +2 Query: 1103 WRYGWYAWRNGGW 1141 WR W WR GW Sbjct: 707 WRRRWRRWRGAGW 745
>LOC_Os01g49600:12001.t04399:unspliced-genomic expressed protein| Length = 1589 Score = 32.2 bits (64), Expect(2) = 0.025 Identities = 18/49 (36%), Positives = 19/49 (38%) Frame = +2 / -3 Query: 1100 PWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAW 1246 P R + R G R WR RR GR RR GR G AW Sbjct: 468 PRRMSCRSARTGRRRARRRRWRCGRRRGRHRPRRRGRARRGGGGAEEAW 322 Score = 31.3 bits (62), Expect(2) = 0.025 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 / -3 Query: 1004 RRHAWWNARWLPIPRRHGWNAWW 1072 +RHA+ N W + RR+ N WW Sbjct: 1125 KRHAYRNGSWSGLRRRNR*NPWW 1057
>LOC_Os06g47340:12006.t04420:unspliced-genomic glycosyltransferase, putative, expressed| Length = 3609 Score = 32.7 bits (65), Expect(2) = 0.027 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +2 / -2 Query: 1139 WFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAW 1246 W+ + WR ARR R R+ R+ R GRR AW Sbjct: 530 WWSSSSSWRGARRRRRTTRWRSRARWWRRAGRRGAW 423 Score = 25.8 bits (50), Expect(2) = 0.027 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = +2 / -2 Query: 1049 RHGWNAWWLPWRNAWW 1096 R G WW W WW Sbjct: 572 RRG*RCWWWSWWLWWW 525
>LOC_Os01g06460:12001.t00529:unspliced-genomic SAT5, putative, expressed| Length = 2737 Score = 30.9 bits (61), Expect(2) = 0.028 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 / -3 Query: 1043 PRRHGWNAWWLPWRNAWW 1096 PR GW PWR AWW Sbjct: 188 PRGGGWRRRPRPWRVAWW 135 Score = 27.6 bits (54), Expect(2) = 0.028 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 / -3 Query: 1145 PWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 PWR W R ARR R R +Y W RW Sbjct: 155 PWRVAWWRGANETRREARRMRSRRERRARVKYGGESAWRPRRRW 24
>LOC_Os01g08470:12001.t00725:unspliced-genomic protein binding protein, putative, expressed| Length = 2275 Score = 33.1 bits (66), Expect(2) = 0.028 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 / -2 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWRYARRNGR 1186 W+ WR+ W+ R WR GWR RR R Sbjct: 1380 WWRWRWRWW*RRRR*CRRWRWGWRRWRRRRR 1288 Score = 25.4 bits (49), Expect(2) = 0.028 Identities = 9/31 (29%), Positives = 11/31 (35%) Frame = +2 / -2 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRY 1111 W W R W WR W + WR+ Sbjct: 1449 WRGWWRRRRRLRWVEDWCRRWRRWWRWRWRW 1357 Score = 26.3 bits (51), Expect(2) = 4.4 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / -2 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGR 1186 WR+GW WR W W R+ R Sbjct: 1326 WRWGWRRWRRRRR*WWWRRWWRQGRDER 1243 Score = 24.4 bits (47), Expect(2) = 4.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / -1 Query: 1181 GRWYARRNGRRYACRNGRRYA 1243 G W +GRR A R RR A Sbjct: 1165 GGWAGSSSGRRSAARRARRTA 1103
>LOC_Os07g39270:12007.t03588:unspliced-genomic geranylgeranyl pyrophosphate synthetase 1, chloroplast precursor,| putative, expressed Length = 2442 Score = 40.9 bits (83), Expect = 0.028 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 / -2 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRR 1237 W RR GRW +R GRR CR GRR Sbjct: 689 WAPRRRRGRWASRGGGRRRPCRGGRR 612
>LOC_Os10g28520:12010.t02203:unspliced-genomic CAF1 family ribonuclease containing protein| Length = 2243 Score = 26.7 bits (52), Expect(3) = 0.030 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = +2 / -2 Query: 1196 RRNGRRYACRNGRRYAWNGRW 1258 RR GRR A R G R A RW Sbjct: 91 RRLGRRRAWRPGHRLA*RSRW 29 Score = 25.4 bits (49), Expect(3) = 0.030 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / -2 Query: 1076 PWRNAWWFPWRYGWYAWR 1129 PW + W P R G AWR Sbjct: 292 PWCSRGWRPGRPGRRAWR 239 Score = 22.1 bits (42), Expect(3) = 0.030 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 / -2 Query: 1112 GWYAWRNGGWFPWRNGWRYARRNGRWYA 1195 GW R G WR+ RR G W A Sbjct: 199 GWRPGRPGRRRAWRSRG*RPRRPGCWRA 116 Score = 26.3 bits (51), Expect(2) = 1.8 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 / -2 Query: 1223 RNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 R GRR AW R *R R W C R Sbjct: 184 RPGRRRAWRSRG*RPRRPGCWRAWCYR 104 Score = 25.8 bits (50), Expect(2) = 1.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 / -2 Query: 1121 AWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 AW + GW P R R + W R GRR Sbjct: 340 AWCSPGWHPRRPSCRRPWCSRGWRPGRPGRR 248
>LOC_Os07g36150:12007.t03287:unspliced-genomic formin homology 2 domain-containing protein 5, putative, expressed| Length = 5926 Score = 35.9 bits (72), Expect(2) = 0.036 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 / -2 Query: 1223 RNGRRYAWNGRW*RNGRWYAWSWRCS 1300 R + W RW R R++ W WRCS Sbjct: 3522 RTRHGWRWRARWARASRFWWWRWRCS 3445 Score = 22.1 bits (42), Expect(2) = 0.036 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 / -2 Query: 1061 NAWWLPWRNAWWFPWRYGW 1117 +AW WR A + R+GW Sbjct: 3561 SAWLKRWRWACFRRTRHGW 3505 Score = 28.1 bits (55), Expect(2) = 1.7 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 / -2 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWR 1129 W A W WW+ WR +++ R Sbjct: 3501 WRARWARASRFWWWRWRCSFWSRR 3430 Score = 24.0 bits (46), Expect(2) = 1.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / -2 Query: 1160 WRYARRNGRWYARR 1201 WR RN RW+ RR Sbjct: 3363 WRKKLRNWRWHHRR 3322
>LOC_Os05g01350:12005.t00037:unspliced-genomic AFH1, putative, expressed| Length = 4124 Score = 35.4 bits (71), Expect(2) = 0.037 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +2 / -1 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWS 1288 WR R+ R RR R RR AW R GRW W+ Sbjct: 986 WRRRRKRWRERRAERRRRQRERKERRRAWRTGKRRGGRWVGWT 858 Score = 22.6 bits (43), Expect(2) = 0.037 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = +2 / -1 Query: 1097 FPWRYGWYAWR 1129 F W + W+ WR Sbjct: 1013 FGWEWEWWRWR 981
>LOC_Os04g46740:12004.t04203:unspliced-genomic pectinesterase-4 precursor, putative, expressed| Length = 2186 Score = 30.9 bits (61), Expect(2) = 0.038 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 / +2 Query: 1184 RWYARRNGRRYACRNGRRYAWNGRW*RNGRWY 1279 RW ARR RR + R + RW G W+ Sbjct: 218 RWRARRRRRRASARRAGTTSTGSRWACGGSWW 313 Score = 27.2 bits (53), Expect(2) = 0.038 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 / +2 Query: 1130 NGGWFPWRNGWRYARR 1177 +G W+ WR+ WR +RR Sbjct: 158 SGWWW*WRSRWRRSRR 205
>LOC_Os05g47480:12005.t04184:unspliced-genomic transcription initiation factor IIB, putative, expressed| Length = 1493 Score = 34.5 bits (69), Expect(2) = 0.039 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 / -3 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAW 1246 RR+ RW+ RR GR R GRR W Sbjct: 372 RRSRRWWCRRRGRGGRGRRGRRRGW 298 Score = 23.5 bits (45), Expect(2) = 0.039 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +2 / -3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWR 1153 WW P R + PWR + R G P R Sbjct: 564 WWAPRRAS*TPPWRGRGWWRRGRGGRPCR 478
>LOC_Os06g45040:12006.t04191:unspliced-genomic B-box zinc finger family protein| Length = 1657 Score = 40.5 bits (82), Expect = 0.039 Identities = 24/63 (38%), Positives = 26/63 (41%) Frame = +2 / +2 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWR 1294 W A R+G R ARR R ARR R R R G R GRW+ W WR Sbjct: 2 WVARRSGARSVARRRRCTARRTRRSCARRATPRCTGRTSSRRGTTGGGWRPGRWWWWRWR 181 Query: 1295 CSR 1303 R Sbjct: 182 RRR 190
>LOC_Os01g16620:12001.t01511:unspliced-genomic expressed protein| Length = 4200 Score = 40.5 bits (82), Expect = 0.039 Identities = 22/49 (44%), Positives = 24/49 (48%) Frame = +2 / -2 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWR 1294 WR RR R ARR+GRR + RR A GR R G W WS R Sbjct: 482 WRGRRGGRRRPRRGAARRSGRRASRPRRRRRARRGRGPRRG*WRCWSRR 336
>LOC_Os06g28870:12006.t02591:unspliced-genomic hypothetical protein| Length = 1031 Score = 30.9 bits (61), Expect(3) = 0.040 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 / +3 Query: 1154 NGWRYARRNGRWYARRNGRRYACRNGR 1234 +G RR GRW + GRR A R G+ Sbjct: 612 SGLAMERRTGRWPKKGEGRRRAAREGK 692 Score = 26.7 bits (52), Expect(3) = 0.040 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +2 / +1 Query: 533 GSNVRRETGRGRRASHQGYTAESNLGNHVW 622 G VRR+ RGRR + G G W Sbjct: 232 GERVRRQEARGRRGNGPGDALYGRRGGKSW 321 Score = 23.5 bits (45), Expect(3) = 0.040 Identities = 5/11 (45%), Positives = 6/11 (54%) Frame = +2 / +2 Query: 1058 WNAWWLPWRNA 1090 W WW WR + Sbjct: 407 WGIWWRRWRGS 439
>LOC_Os08g08120:12008.t00698:unspliced-genomic transcription factor/ zinc ion binding protein, putative, expressed| Length = 2232 Score = 35.4 bits (71), Expect(2) = 0.051 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 1043 PRRHGWNAWWLPWRNAWWF 1099 P R W WW WR WW+ Sbjct: 279 PPRRWWPWWWRRWRRCWWW 335 Score = 22.1 bits (42), Expect(2) = 0.051 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +2 / +3 Query: 1091 WWFPWRYG 1114 WW PW +G Sbjct: 330 WWRPWWWG 353
>LOC_Os06g12590:12006.t01135:unspliced-genomic ATP binding protein, putative, expressed| Length = 9884 Score = 40.0 bits (81), Expect = 0.053 Identities = 20/53 (37%), Positives = 22/53 (41%) Frame = +2 / +3 Query: 1127 RNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAW 1285 R W R WR R G W +RR RR GR GRW R R +W Sbjct: 339 RTRWWRRRRRRWRRRWR*GGWRSRRRRRRRGGSRGRSR*GRGRWRRRSRRRSW 497
>LOC_Os03g47620:12003.t04125:unspliced-genomic ankyrin-1, putative| Length = 7515 Score = 40.0 bits (81), Expect = 0.053 Identities = 16/59 (27%), Positives = 32/59 (54%) Frame = +3 / +2 Query: 576 LTKAILLNPTSAIMYGTRASVFIKMKKPAAAIRDANAALEINPDSAKGYKTRGMANAML 752 + +A+ L+P A +Y R+ ++ A+ DAN +++ P+ KG+ +G A+ L Sbjct: 6932 MMQAMKLDPADATLYSNRSLCHLRSGAAQEALLDANDCIKLKPEWTKGHYRKGCAHMAL 7108
>LOC_Os01g07640:12001.t00644:unspliced-genomic ankyrin-like protein, putative| Length = 4358 Score = 40.0 bits (81), Expect = 0.053 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +3 / +1 Query: 585 AILLNPTSAIMYGTRASVFIKMKKPAAAIRDANAALEINPDSAKGYKTRGMANAML 752 A+ + T A +Y R++ ++ + A+ DA ++ PD AKGY +GMA ++L Sbjct: 2068 AMKFDNTDAKLYSNRSACWLNLGIGDEALSDAQICSKMQPDWAKGYYRQGMAFSLL 2235
>LOC_Os05g12440:12005.t01072:unspliced-genomic expressed protein| Length = 405 Score = 34.5 bits (69), Expect(2) = 0.056 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 / +2 Query: 1049 RHGWNAWWLPWRNAWWFPWRYG 1114 R W W PW W +PWR G Sbjct: 131 RRTWRRRWAPWSARWPWPWRSG 196 Score = 23.1 bits (44), Expect(2) = 0.056 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 / +2 Query: 1124 WRNGGWFP 1147 WR GGW P Sbjct: 203 WRRGGWTP 226 Score = 35.0 bits (70), Expect = 1.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +2 / +2 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGWRYAR 1174 W W WR W W +PWR+G R+ R Sbjct: 116 WWGRWRRTWRRRWAPWSARWPWPWRSGRRWRR 211
>LOC_Os07g39350:12007.t03596:unspliced-genomic proton myo-inositol cotransporter, putative, expressed| Length = 2484 Score = 37.3 bits (75), Expect(2) = 0.069 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = +2 / -3 Query: 1133 GGWFPWRNGWRYARRNGR 1186 GGW WR GWR RR GR Sbjct: 385 GGWRSWRRGWRRRRRTGR 332 Score = 25.4 bits (49), Expect(2) = 0.069 Identities = 9/27 (33%), Positives = 9/27 (33%) Frame = +2 / -3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWW 1096 W RW RR GW W W Sbjct: 1588 WGQGRWRRRRRRRGWRRCLGRWPKVSW 1508
>LOC_Os12g13860:12012.t01253:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1500 Score = 34.1 bits (68), Expect(2) = 0.070 Identities = 10/24 (41%), Positives = 10/24 (41%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWR 1129 W WW WR WW W WR Sbjct: 1338 WWWWWWRWRTRWWSSC*RLWTRWR 1409 Score = 23.1 bits (44), Expect(2) = 0.070 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / +3 Query: 1007 RHAWWNARW 1033 R WW ARW Sbjct: 1227 RRWWWRARW 1253 Score = 34.1 bits (68), Expect(2) = 1.2 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +2 / +3 Query: 1082 RNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 R W W + W+ WR W W R RW+ RR Sbjct: 1317 RRKLWARWWWWWWRWRTRWWSSC*RLWTRWRGWWRWWPRR 1436 Score = 23.5 bits (45), Expect(2) = 1.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +2 / +1 Query: 512 GSKGPGNGSNVRRETGRGRRASHQGY 589 G +G G+GS G+G AS GY Sbjct: 1135 GGQGGGSGSGYGSG*GKGGGASGVGY 1212
>LOC_Os12g01220:12012.t00021:unspliced-genomic expressed protein| Length = 5741 Score = 39.6 bits (80), Expect = 0.073 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 / -3 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCS 1300 RR RW R R R RR W GRW R R A RCS Sbjct: 5715 RRGSRWRGGRGRRCCCGRR*RRRRWTGRWWRRWRTCACGRRCS 5587
>LOC_Os08g01430:12008.t00042:unspliced-genomic F-box domain containing protein, expressed| Length = 3342 Score = 39.6 bits (80), Expect = 0.073 Identities = 20/45 (44%), Positives = 21/45 (46%) Frame = +2 / -2 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRC 1297 R ARR G+W R G R GR GR R GR W WRC Sbjct: 767 RSARRAGQWRHRGGG*GGRRRRGR*GGGGGRRRRGGRSGRWRWRC 633
>LOC_Os05g12390:12005.t01067:unspliced-genomic conserved hypothetical protein| Length = 1163 Score = 39.6 bits (80), Expect = 0.073 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 / +1 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGG 1138 RR W W PW W +PWR G R GG Sbjct: 898 RRRTWRRRWAPWSARWPWPWRSGRRWRRGGG 990
>LOC_Os06g22050:12006.t02020:unspliced-genomic loricrin, putative| Length = 690 Score = 29.9 bits (59), Expect(3) = 0.082 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 / +2 Query: 1046 RRHGWNAWWLPWRNAWW 1096 RR W + WL WR WW Sbjct: 14 RRRQWWSCWLSWR*WWW 64 Score = 26.3 bits (51), Expect(3) = 0.082 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / +3 Query: 1127 RNGGWFPWRNGWRYARRNGR 1186 R G W+ W WR RR R Sbjct: 315 RRGRWWRWWRWWRRRRRRRR 374 Score = 22.6 bits (43), Expect(3) = 0.082 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = +2 / +1 Query: 1085 NAWWFPWRYGWYAWRNGG 1138 ++W + W +GW GG Sbjct: 235 SSWSYGWGWGWGTDSGGG 288
>LOC_Os03g43390:12003.t03734:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 7582 Score = 28.6 bits (56), Expect(2) = 0.086 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = +2 / +2 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 R RW+ R RR R RR++W G R W Sbjct: 320 RGRWRWWRGRAARRS*RRRRRRWSWAGGPCRGSSW 424 Score = 28.1 bits (55), Expect(2) = 0.086 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +2 / +2 Query: 1082 RNAWWFPWRYGWYAWRNGGWFPWR 1153 R+ WFP R W G W WR Sbjct: 272 RSRGWFPMRMRWDGAGRGRWRWWR 343
>LOC_Os01g25484:12001.t02264:unspliced-genomic ferredoxin--nitrite reductase, chloroplast precursor, putative,| expressed Length = 6554 Score = 31.8 bits (63), Expect(2) = 0.087 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 / -2 Query: 1052 HGWNAWWLPWRNAWW 1096 HGW WW W WW Sbjct: 520 HGWRRWWWWWWWWWW 476 Score = 24.9 bits (48), Expect(2) = 0.087 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 / -3 Query: 1133 GGWFPWRNGWRYARRNGRWYARRNG 1207 GG WR GW + RR + A G Sbjct: 483 GGGALWR*GWTWGRRVWLFIAEEGG 409
>LOC_Os03g10680:12003.t00869:unspliced-genomic actin binding protein, putative, expressed| Length = 4512 Score = 24.4 bits (47), Expect(3) = 0.087 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / -3 Query: 1031 WLPIPRRHGWNAWW 1072 W + RHGW WW Sbjct: 1300 WEIVV*RHGWWWWW 1259 Score = 24.0 bits (46), Expect(3) = 0.087 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +2 / -3 Query: 1058 WNAWWLPWRNAW 1093 W WW WR W Sbjct: 1219 WRWWWGRWRWRW 1184 Score = 24.0 bits (46), Expect(3) = 0.087 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 / -2 Query: 1136 GWFPWRNGWRYARRNGRWYARRNGRRYACRNGR 1234 GW PWR+ A A R RR+ GR Sbjct: 1118 GWSPWRSACAGACGGSARGAGRVARRWQRPGGR 1020
>LOC_Os01g54714:12001.t04887:unspliced-genomic conserved hypothetical protein| Length = 5956 Score = 33.6 bits (67), Expect(2) = 0.088 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = +2 / +1 Query: 1124 WRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 WR WR W R W+ R +GR+ +GRR+ R R RW Sbjct: 5203 WRACNRRRWRRCWTRPRSGWWWWWRVHGRKRWRAHGRRW*GEHRRRRRRRW 5355 Score = 29.5 bits (58), Expect(2) = 0.088 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 / +1 Query: 1121 AWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAW 1246 +WR W R WR R W RR R RR W Sbjct: 5581 SWRRRRWVLRRRWWRVPWRRLWWNNRRRRWRCCWSRRRRCCW 5706 Score = 27.2 bits (53), Expect(2) = 0.088 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = +2 / +1 Query: 1067 WWLPWRNAWWFPWRYGWY 1120 W WR WW W W+ Sbjct: 5428 WGNHWRRRWWKRWWRWWW 5481 Score = 23.1 bits (44), Expect(2) = 0.088 Identities = 7/17 (41%), Positives = 7/17 (41%) Frame = +2 / +1 Query: 1091 WWFPWRYGWYAWRNGGW 1141 WW WR W G W Sbjct: 5155 WWG*WRRRWRVLDLGWW 5205 Score = 34.1 bits (68), Expect = 3.3 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 / +1 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 RR W WW W +W R WR W R R W RR Sbjct: 5443 RRRWWKRWWRWWWWKYWRRHRGVHRRWRTWSWSRRGGNHRRRRWGISWRRRR 5598 Score = 33.6 bits (67), Expect = 4.6 Identities = 16/53 (30%), Positives = 20/53 (37%) Frame = +2 / +1 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACR 1225 WW WR R+ ++W G R W + R RW RR R R Sbjct: 5479 WWKYWRRHRGVHRRWRTWSWSRRGGNHRRRRWGISWRRRRWVLRRRWWRVPWR 5637
>LOC_Os05g12350:12005.t01064:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4681 Score = 31.8 bits (63), Expect(2) = 0.089 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -3 / -2 Query: 1167 YLHPFLQGNHPPFLQAYHPYLQGNHQAFLQGSHQAFHPCLLG 1042 Y +PFL G + +HPYL A L + A HP G Sbjct: 1590 YPYPFLSGADGNYPLRFHPYLSC*QLAILDDRYVADHPAGFG 1465 Score = 24.9 bits (48), Expect(2) = 0.089 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 / -2 Query: 1353 MLTSGQGHSRCHPYQHYREHLQLQAYHLPFL 1261 + SG+ + +PY +Y ++ + Y PFL Sbjct: 1665 VFVSGRKYLYSYPYPNYPRIIRSERYPYPFL 1573
>LOC_Os07g33490:12007.t03028:unspliced-genomic spidroin 1, putative| Length = 1953 Score = 39.1 bits (79), Expect = 0.10 Identities = 19/40 (47%), Positives = 20/40 (50%) Frame = +2 / +3 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYA 1282 R ARR R RR+G R NG R A RW R RW A Sbjct: 1494 RGARRRARGARRRDGARRGSGNGTRAATGRRWRRRQRWRA 1613
>LOC_Os03g48260:12003.t04183:unspliced-genomic expressed protein| Length = 5287 Score = 39.1 bits (79), Expect = 0.10 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 / +1 Query: 1100 PWRYGWYAWRNGGWFPWRNGWRYARRNGRW 1189 P R+ W W G WR+ W + RNGRW Sbjct: 4720 PARWWWSWWWQEGLPEWRSWWTWGARNGRW 4809
>LOC_Os02g48190:12002.t04403:unspliced-genomic expressed protein| Length = 4052 Score = 39.1 bits (79), Expect = 0.10 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 / -2 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNGR 1255 R AR GRW++ R GR R RR+ W GR Sbjct: 1165 RSARSGGRWWSSRRGRAACRRRCRRWGWMGR 1073
>LOC_Os01g03360:12001.t00228:unspliced-genomic Bowman-Birk type bran trypsin inhibitor precursor, putative,| expressed Length = 1149 Score = 39.1 bits (79), Expect = 0.10 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 / -1 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAW 1285 WR +G W RR GRR R GR W W* W W Sbjct: 168 WRRRWGDGWWCRRRRGRRRGRRGGRAGWWK*PW*CCSSWLYW 43
>LOC_Os03g20680:12003.t01824:unspliced-genomic embryonic protein DC-8, putative, expressed| Length = 1411 Score = 36.8 bits (74), Expect(2) = 0.10 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 / -2 Query: 1007 RHAWWNARWLPIPRRHGWNAWWLPWRNAWWFPWR 1108 R W P RR GW WW PW ++ WR Sbjct: 840 RRRGWRPSPWPCRRRSGWCPWWRPWPSSPCRRWR 739 Score = 24.4 bits (47), Expect(2) = 0.10 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 / -2 Query: 1426 PTRRWDPSSP 1455 P RRW PSSP Sbjct: 756 PCRRWRPSSP 727
>LOC_Os11g40450:12011.t03586:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 12498 Score = 28.6 bits (56), Expect(2) = 0.11 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 / +3 Query: 998 LIRRHAWWNARWLPIPRR 1051 L RR WW W P PRR Sbjct: 789 LWRRGWWWRLPWWPSPRR 842 Score = 27.6 bits (54), Expect(2) = 0.11 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 / +2 Query: 1112 GWYAWRNGGWFPWRNGWR 1165 GW +GGW W+ WR Sbjct: 914 GWIGGGSGGWRRWKWWWR 967
>LOC_Os03g06520:12003.t00519:unspliced-genomic sulfate transporter 3.1, putative, expressed| Length = 5761 Score = 32.2 bits (64), Expect(2) = 0.12 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 / -1 Query: 1127 RNGGWFPWRNGWRYARRNGRWYARRNGRRYACR 1225 R GGW WR+ R +W RR GR CR Sbjct: 469 REGGWRAWRS*CPGGWRGWQW*CRR*GRT*GCR 371 Score = 24.0 bits (46), Expect(2) = 0.12 Identities = 8/31 (25%), Positives = 11/31 (35%) Frame = +1 / -2 Query: 988 HQAAHQEACLVECPVASHSQEAWVECLVASL 1080 H HQ H W C++AS+ Sbjct: 618 HHRVHQRRHEARICSQEHMSNTWSSCIIASM 526
>LOC_Os07g07340:12007.t00612:unspliced-genomic glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed| Length = 3421 Score = 30.9 bits (61), Expect(2) = 0.12 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 / +3 Query: 1070 WLPWRNAWWFPWRYGW 1117 W WR WW WR+ W Sbjct: 450 W*QWRGWWW*LWRWPW 497 Score = 25.4 bits (49), Expect(2) = 0.12 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +2 / +3 Query: 1142 FPWRNGWRYARRNGRWYARRNGRRYACRNGR 1234 +PWR G R+ R G RR CR R Sbjct: 489 WPWRRGGRWRRWRGWG*TGGRRRRTRCRPRR 581
>LOC_Os06g35700:12006.t03267:unspliced-genomic reticuline oxidase precursor, putative, expressed| Length = 1973 Score = 30.4 bits (60), Expect(2) = 0.13 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 / -1 Query: 1025 ARWLPIPRRHGWNAWWLPWRNAW 1093 A W+ PR G + W PWR W Sbjct: 206 AGWVCSPRGIGGSCPWRPWRTTW 138 Score = 25.8 bits (50), Expect(2) = 0.13 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 / -1 Query: 1139 WFPWRNGWRYARRNGR 1186 W PWR WR R R Sbjct: 161 WRPWRTTWRQLSRGRR 114
>LOC_Os01g25630:12001.t02278:unspliced-genomic NB-ARC domain containing protein, expressed| Length = 5003 Score = 32.2 bits (64), Expect(2) = 0.13 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 / +3 Query: 1624 APLHASITNQHLHVSGYAKGHFQHLTKVFC 1535 +PLH+ + H SG+ K HF T +FC Sbjct: 2079 SPLHSWLFEFEAHASGFQKTHFPTDTHLFC 2168 Score = 30.4 bits (60), Expect(2) = 0.13 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 / +2 Query: 683 IRITDGSSGLFHFDKHRCSGTIHDCRGWIQQ 591 I+ TDG+ H KH+CS T+ WI Q Sbjct: 2789 IKSTDGNRWKQHMSKHQCSLTLRTFVLWIVQ 2881
>LOC_Os10g31420:12010.t02467:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 934 Score = 30.9 bits (61), Expect(2) = 0.13 Identities = 9/32 (28%), Positives = 13/32 (40%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 WW W WW + + W GW+ + W Sbjct: 378 WWWRWWGKWWVWIWFRIWLWLWSGWWLRSSWW 473 Score = 25.4 bits (49), Expect(2) = 0.13 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWR 1084 WW RW +R W +W+ +R Sbjct: 246 WWRWRWWRWTKRWIWVWFWIWFR 314 Score = 32.7 bits (65), Expect = 8.6 Identities = 16/62 (25%), Positives = 20/62 (32%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYA 1195 W + W I WW W W W + W R + W + R RW Sbjct: 453 WLRSSWWSICSGWRTRWWWWRWIQWWIRLWFWFWIWLRPSWFIRALRWWLCSCRWSRWRR 632 Query: 1196 RR 1201 RR Sbjct: 633 RR 638
>LOC_Os05g35190:12005.t03112:unspliced-genomic expressed protein| Length = 3788 Score = 38.6 bits (78), Expect = 0.14 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 W A GGW WR GWR R W+ RR+ R Sbjct: 181 WRAGGAGGWEIWRRGWRRRRWWWWWWWRRDSER 279
>LOC_Os04g56430:12004.t05113:unspliced-genomic CRK5, putative, expressed| Length = 1068 Score = 38.6 bits (78), Expect = 0.14 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +2 / -2 Query: 1145 PWRNGWRYARRNGRWYARRNGRRYACRNGR 1234 PWR G R R + RW R+ RR CR GR Sbjct: 383 PWRGGTRSRRPSTRWCRSRSRRRGRCRRGR 294
>LOC_Os03g50810:12003.t04416:unspliced-genomic receptor protein kinase TMK1 precursor, putative, expressed| Length = 4102 Score = 38.6 bits (78), Expect = 0.14 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +2 / +1 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 WR+ R W+ RR GRR R W G W R RW Sbjct: 151 WRWRWR*CWWWGRRRGRRRRRTRRRCGRWRGLWARTRRW 267
>LOC_Os02g51730:12002.t04754:unspliced-genomic dnaJ homolog subfamily C member 7, putative, expressed| Length = 4105 Score = 38.6 bits (78), Expect = 0.14 Identities = 19/80 (23%), Positives = 36/80 (45%) Frame = +3 / +1 Query: 495 NRDASQEAKGQAMEAMSEGKLEEAVEHLTKAILLNPTSAIMYGTRASVFIKMKKPAAAIR 674 +R ++ K E EG EAV +AI+++PT + +A+ + + A+ Sbjct: 661 HRTDPEKLKEMGNEEYREGHYAEAVALYDQAIMVDPTRPAYWSNKAAALAALGRLIEAVG 840 Query: 675 DANAALEINPDSAKGYKTRG 734 D A+ I+P + + G Sbjct: 841 DCREAVRIDPSYGRAHHRLG 900
>LOC_Os04g03980:12004.t00286:unspliced-genomic disulfide oxidoreductase/ monooxygenase/ oxidoreductase, putative,| expressed Length = 2124 Score = 37.3 bits (75), Expect(2) = 0.15 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = +2 / -3 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRR 1237 WR RR GR RR RR CR+GRR Sbjct: 1120 WRGRRRRGR*RGRRRARRSPCRSGRR 1043 Score = 24.0 bits (46), Expect(2) = 0.15 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 / -1 Query: 1145 PWRNGWRYARR 1177 PWR WR RR Sbjct: 1392 PWRRAWRRRRR 1360
>LOC_Os04g52540:12004.t04728:unspliced-genomic eukaryotic translation initiation factor 2C 2, putative, expressed| Length = 4249 Score = 31.3 bits (62), Expect(3) = 0.15 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +2 / +3 Query: 1004 RRHAWWNARWLPIPRRHGWNAWWLPW 1081 RR WW W R W +WW W Sbjct: 183 RRRLWWCWWWWCRRARWAWASWWWWW 260 Score = 27.2 bits (53), Expect(3) = 0.15 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 / +2 Query: 1530 AGQKTLVKCWKCPFAYPETCRCW 1598 AG++T W + P TCR W Sbjct: 3662 AGRRTTTAFWTSTASPPTTCRSW 3730 Score = 24.4 bits (47), Expect(3) = 0.15 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / +3 Query: 1262 RNGRWYAWSWRCSR 1303 R RW+ W WR R Sbjct: 300 RRRRWWTWVWRRRR 341
>LOC_Os05g13590:12005.t01137:unspliced-genomic hypothetical protein| Length = 4360 Score = 31.3 bits (62), Expect(2) = 0.15 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 / +3 Query: 509 PGSKGPGNGSNVRRETGRGR 568 PG KG GNG R+E RGR Sbjct: 876 PGEKGKGNGPAQRKEAERGR 935 Score = 30.9 bits (61), Expect(2) = 0.15 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +2 / +1 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGG 1138 W W IP W+A W PWR+G+ R G Sbjct: 3901 WWLEWSEIPSNSHWDAILDVHAEPWPQPWRWGFSRTRGFG 4020
>LOC_Os09g28940:12009.t02572:unspliced-genomic ubiquitin-specific protease 16, putative, expressed| Length = 7984 Score = 30.4 bits (60), Expect(2) = 0.16 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / +2 Query: 1070 WLPWRNAWWFPWRYG 1114 W PWR+ W+ WR G Sbjct: 35 WWPWRSPRWWRWRVG 79 Score = 25.4 bits (49), Expect(2) = 0.16 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +2 / +2 Query: 1139 WFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 W P R G A R R C R R R R WSW+C R Sbjct: 140 WRPRSRSARRTATRGGGAAWRVRRCGRCPRWLRRGRTKRRRRRRRPRRWSWKCRR 304
>LOC_Os10g35030:12010.t02798:unspliced-genomic IAP100, putative, expressed| Length = 5854 Score = 28.1 bits (55), Expect(2) = 0.16 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRR 1237 W R AR RW ARR R A R RR Sbjct: 312 WSGSARGARGPRRWRARRRSGRSASRAPRR 401 Score = 27.6 bits (54), Expect(2) = 0.16 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 / +3 Query: 1007 RHAWWNARWLPIPRRHG 1057 R WW+ RW P RR G Sbjct: 258 RGRWWSWRWWPRRRRRG 308
>LOC_Os08g09350:12008.t00820:unspliced-genomic protein gar2, putative, expressed| Length = 4417 Score = 32.7 bits (65), Expect(2) = 0.16 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +2 / +1 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPW 1150 W WR WW WR W+ R W W Sbjct: 3853 W*QVWRPIWW*VWR*RWWQKRWTWWQRW 3936 Score = 23.1 bits (44), Expect(2) = 0.16 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = +2 / +1 Query: 1139 WFPWRNGWRYARRNGRWYA 1195 W+ R WR++ + WY+ Sbjct: 3934 WWQKRRTWRFSEQAECWYS 3990
>LOC_Os06g42710:12006.t03962:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 3542 Score = 32.7 bits (65), Expect(2) = 0.16 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +2 / +2 Query: 1067 WWLPWRNAWWFPWRYGWYAWR 1129 WW W WW+ W + W WR Sbjct: 3287 WWWWWWW*WWWWWWWWW*RWR 3349 Score = 23.1 bits (44), Expect(2) = 0.16 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 / +2 Query: 1115 WYAWRNGGWFPWRNGWRY 1168 W+ W + WR GWR+ Sbjct: 3383 WWRWCWRWRWRWRWGWRW 3436 Score = 34.1 bits (68), Expect = 3.3 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 / +2 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARR 1177 W WW W WW+ W + + WR + W WR+ R Sbjct: 3284 WWWWWWWW*WWWWWWWWW*RWRWRWRWRWCWW*WWRWCWR 3403 Score = 34.1 bits (68), Expect = 3.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 / +2 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRY 1168 WW+ W + W+ W W WR WR+ Sbjct: 3287 WWWWWWW*WWWWWWWWW*RWRWRWRW 3364
>LOC_Os02g58180:12002.t005566:unspliced-genomic expressed protein| Length = 1886 Score = 30.4 bits (60), Expect(2) = 0.17 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNG 1207 WR+ W R G + R GW R W AR G Sbjct: 1416 WRWSWSGGRKGRRWRRRPGWCRCRWRR*WRARPGG 1520 Score = 25.4 bits (49), Expect(2) = 0.17 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 / +3 Query: 1031 WLPIPRRHGWNAWWLPWRNAWW 1096 W PRR GW W A W Sbjct: 1275 WPGAPRRPGWGRWRRERARAKW 1340
>LOC_Os05g09280:12005.t00804:unspliced-genomic ischemia related factor NYW-1, putative, expressed| Length = 1446 Score = 30.4 bits (60), Expect(2) = 0.17 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -3 Query: 1157 GWRYARRNGRWYARRNGRRYACRNGR 1234 GWR W RR GRR ACR R Sbjct: 532 GWRRGAWCPPWRRRRPGRRRACRTPR 455 Score = 25.4 bits (49), Expect(2) = 0.17 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 / -3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFP 1147 WR A R G WR G W P Sbjct: 574 WRGARGRRRRAGARGWRRGAWCP 506
>LOC_Os01g52260:12001.t04653:unspliced-genomic serine acetyltransferase 3, mitochondrial precursor, putative,| expressed Length = 1412 Score = 30.4 bits (60), Expect(2) = 0.17 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 / -1 Query: 1163 RYARRNGRWYARRNGRRYACRNG 1231 R RR G W ARR GRR R G Sbjct: 461 RSRRRRGPWSARRGGRRRRRRGG 393 Score = 25.4 bits (49), Expect(2) = 0.17 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 / -1 Query: 1208 RRYACRNGRRYAWNGRW*RNGRW 1276 RR R GRR AW W W Sbjct: 383 RRGRRRRGRRGAWRAAWRSRACW 315 Score = 38.2 bits (77), Expect = 0.19 Identities = 19/43 (44%), Positives = 20/43 (46%) Frame = +2 / -1 Query: 1127 RNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGR 1255 R G + R G R RR G W ARR RR R R AW R Sbjct: 452 RRRGPWSARRGGRRRRRRGGWGARRGRRRRGRRGAWRAAWRSR 324
>LOC_Os05g34100:12005.t03005:unspliced-genomic hypothetical protein| Length = 822 Score = 31.8 bits (63), Expect(2) = 0.18 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 / +2 Query: 1091 WWFPWRYGWYAWRNGGW 1141 WW P RYG + WR W Sbjct: 503 WWKPTRYGRWRWRRPWW 553 Score = 24.0 bits (46), Expect(2) = 0.18 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 / +2 Query: 1160 WRYARRNGRWYARRNGR 1210 WR R GRW + GR Sbjct: 665 WRSPMRRGRWQHTKAGR 715
>LOC_Os03g27110:12003.t02391:unspliced-genomic catalytic/ hydrolase, putative, expressed| Length = 1943 Score = 35.0 bits (70), Expect(2) = 0.18 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 / -3 Query: 1199 RNGRRYACRNGRRYAWNGRW*RNGR 1273 R+GRR ACR+ RR GRW R+ R Sbjct: 471 RSGRRRACRSRRRRGGRGRWGRSRR 397 Score = 25.8 bits (50), Expect(2) = 0.18 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / -1 Query: 608 GNHVWYQSICVYQN 649 GN VWY +YQN Sbjct: 1271 GNSVWYACFWIYQN 1230
>LOC_Os02g13620:12002.t01158:unspliced-genomic expressed protein| Length = 573 Score = 28.1 bits (55), Expect(2) = 0.18 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 / +2 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGR 1255 R + RW+ RR+ ACR R GR Sbjct: 182 RSSSRWWRRRSASAAACRRSARRRTPGR 265 Score = 27.6 bits (54), Expect(2) = 0.18 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 / +2 Query: 1067 WWLPWRNAW 1093 WW PWR +W Sbjct: 32 WWPPWRRSW 58
>LOC_Os05g03560:12005.t00253:unspliced-genomic hypothetical protein| Length = 327 Score = 32.7 bits (65), Expect(2) = 0.19 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +2 / +2 Query: 1274 WYAWSWRCSR*C 1309 W+AWSW CSR C Sbjct: 158 WHAWSWSCSRWC 193 Score = 23.1 bits (44), Expect(2) = 0.19 Identities = 8/26 (30%), Positives = 10/26 (38%) Frame = +2 / +3 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWRYA 1171 W WR WR W P W ++ Sbjct: 6 WAMWRSWSPRWRWSRWSPRGRTWSWS 83
>LOC_Os02g19340:12002.t01727:unspliced-genomic conserved hypothetical protein| Length = 312 Score = 36.3 bits (73), Expect(2) = 0.19 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAW 1246 WR+ + R G+W A GRR A GR+ AW Sbjct: 168 WRDRGGWRRSRGQWRAAGRGRRRAAGRGRQGAW 266 Score = 21.7 bits (41), Expect(2) = 0.19 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +2 / +3 Query: 1250 GRW*RNGRWYAWSWR 1294 G W + R AW WR Sbjct: 258 GAWPQAARQGAWRWR 302
>LOC_Os12g44100:12012.t04076:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 4568 Score = 38.2 bits (77), Expect = 0.19 Identities = 22/64 (34%), Positives = 23/64 (35%) Frame = +2 / -2 Query: 1112 GWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSW 1291 G WR G G R RR W + R RR R G W R R G W W Sbjct: 2809 GEMGWRR*G*AQACRGRRRWRRRRGWRSGRGRRRRGRRRGEGRGWRYRRRR*GGWRRRRW 2630 Query: 1292 RCSR 1303 C R Sbjct: 2629 GCGR 2618
>LOC_Os10g30910:12010.t02422:unspliced-genomic expressed protein| Length = 9689 Score = 38.2 bits (77), Expect = 0.19 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +2 / +1 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYA 1195 W WW PWR WR W W GG W R W A Sbjct: 157 WWWWWSPWRRRDGRRWRRRWEWWCGGGGGGRWRWWAAGRSRWWWGA 294
>LOC_Os07g03060:12007.t00196:unspliced-genomic expressed protein| Length = 3567 Score = 38.2 bits (77), Expect = 0.19 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 / -3 Query: 1019 WNARWLPIPRRHGWNAWWLPWRNAWWFPW 1105 + R +PI RR G W WR WW PW Sbjct: 100 FGGRAIPIWRRRGPVRPWRQWRARWWLPW 14
>LOC_Os05g01310:12005.t00034:unspliced-genomic ankyrin-1, putative, expressed| Length = 3914 Score = 38.2 bits (77), Expect = 0.19 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +3 / +2 Query: 582 KAILLNPTSAIMYGTRASVFIKMKKPAAAIRDANAALEINPDSAKGYKTRGMANAML 752 +AI LNP A ++ R+ +++ + A+ DA A + PD AK G A +L Sbjct: 3068 QAIELNPNDATLHSNRSLCWLRAGQAERALEDARACRALRPDWAKACYREGAALRLL 3238
>LOC_Os04g33400:12004.t03021:unspliced-genomic F-box domain containing protein, expressed| Length = 1911 Score = 38.2 bits (77), Expect = 0.19 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +2 / -3 Query: 1157 GWRYARRNGRWYARRNGRRYACRNGRRYAWNGR 1255 GWR RR W RR G CR GRR GR Sbjct: 148 GWRPTRRGSGWRGRRCGPPRRCRGGRRSRRGGR 50
>LOC_Os02g15360:12002.t01329:unspliced-genomic expressed protein| Length = 4561 Score = 38.2 bits (77), Expect = 0.19 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +2 / -2 Query: 1175 RNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 R G W R G A R G R W GRW R W Sbjct: 234 RGGGWSRRGGGGGAATRGGHRRRWRGRWCRRPGW 133
>LOC_Os12g06820:12012.t00567:unspliced-genomic neurofilament protein H form H2, putative, expressed| Length = 2235 Score = 33.6 bits (67), Expect(2) = 0.21 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +2 / +2 Query: 1082 RNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 R+ W W G WR G W+ G R+ RW +G R Sbjct: 794 RSRWRRRWSGGASGWRTGRWWRGSAGCSTCRQASRWGGSPSGSR 925 Score = 27.2 bits (53), Expect(2) = 0.21 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 / +2 Query: 1193 ARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 +R RR R RR+ W RW RW Sbjct: 1211 SRSRSRRATWRWRRRWQWRRRWRWRRRW 1294
>LOC_Os06g21310:12006.t01948:unspliced-genomic glycine-rich cell wall structural protein precursor, putative| Length = 1017 Score = 29.5 bits (58), Expect(3) = 0.22 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = +2 / +1 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGW 1162 W WW WR W WY GG+ + G+ Sbjct: 790 WWIWWWLWRVCTWSWLVTTWYGGGYGGYPGYGGGY 894 Score = 27.2 bits (53), Expect(3) = 0.22 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 / +3 Query: 1557 WKCPFAYPETCRCWL 1601 W+C + CRCWL Sbjct: 903 WRCTVCWRIWCRCWL 947 Score = 21.7 bits (41), Expect(3) = 0.22 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +1 Query: 1004 RRHAWWNARW 1033 RR WW RW Sbjct: 763 RRWLWWWVRW 792
>LOC_Os04g25490:12004.t02257:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative, expressed| Length = 2559 Score = 29.5 bits (58), Expect(2) = 0.23 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +2 / -3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNG 1252 WR W RR ARR RR R R AW G Sbjct: 442 WRRPWCCRRRRR*RAARRRRRRRHRRRPPRRAWRG 338 Score = 25.8 bits (50), Expect(2) = 0.23 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 / -3 Query: 1121 AWRNGGWFPWRNGWR 1165 AWR+GG R GWR Sbjct: 481 AWRSGGRARARRGWR 437
>LOC_Os02g51510:12002.t04734:unspliced-genomic hypothetical protein| Length = 684 Score = 32.7 bits (65), Expect(2) = 0.23 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 / -3 Query: 1382 SRCDEQPCQLGQAPGQPEGGTHHRQDDGQDER 1477 SRC + PC +PG+P + R+ G+ R Sbjct: 172 SRCTDPPCSSSSSPGEPRRSSASRRGRGRSPR 77 Score = 26.3 bits (51), Expect(2) = 0.23 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 / -1 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYA 1243 WR R+ RR + R Y CR RR A Sbjct: 594 WRRWRRWRRRRRLLHVARIAFSYGCRRCRRVA 499
>LOC_Os06g44260:12006.t04114:unspliced-genomic GDP-L-fucose synthase 2, putative, expressed| Length = 1081 Score = 28.1 bits (55), Expect(2) = 0.24 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 / +3 Query: 1112 GWYAWRNGGWFPWRNGWRYARRNGRWYARRNGR 1210 GW+ G WR GW A G W R R Sbjct: 909 GWWRGTRRGRRGWRGGWWTAGG*GSWGGSRGWR 1007 Score = 27.2 bits (53), Expect(2) = 0.24 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWR 1108 RR G + W R WW WR Sbjct: 750 RRRGSSPTWTTSRRRWWC*WR 812
>LOC_Os01g68840:12001.t06239:unspliced-genomic expressed protein| Length = 973 Score = 30.4 bits (60), Expect(2) = 0.24 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = +2 / +3 Query: 1127 RNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYA 1243 R W W WR A + RW + R G + + R+A Sbjct: 396 RRWRWRGWCRWWRGAGGSARWCSTRRGGGWGASSSARHA 512 Score = 24.9 bits (48), Expect(2) = 0.24 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWW 1072 WW A IP ++WW Sbjct: 318 WWGASGFVIPSCDSSSSWW 374
>LOC_Os12g41720:12012.t03848:unspliced-genomic patatin-like phospholipase family protein, expressed| Length = 1916 Score = 34.1 bits (68), Expect(2) = 0.24 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 / -3 Query: 1076 PWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGR 1186 P A W W + W+ WR W P R RR R Sbjct: 1680 PPATACWRRWSWRWWRWRTTWWSPTRGAPASRRRRRR 1570 Score = 26.3 bits (51), Expect(2) = 0.24 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 / -1 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 RR+ + RR GRR R G GR * RW Sbjct: 953 RRSRSRWRRRGGRRRRRRGGTPACCGGRG*WRRRW 849 Score = 29.9 bits (59), Expect(2) = 6.4 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 / -3 Query: 1058 WNAWWLPWRNAWWFPWR 1108 W+ W WR WW P R Sbjct: 1653 WSWRWWRWRTTWWSPTR 1603 Score = 25.4 bits (49), Expect(2) = 6.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 / -1 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRR 1237 WR RR RR G +CR+ RR Sbjct: 776 WRRPRRRTSRRRRRGGGSRSCRSRRR 699
>LOC_Os12g43740:12012.t04042:unspliced-genomic expressed protein| Length = 909 Score = 37.7 bits (76), Expect = 0.26 Identities = 17/50 (34%), Positives = 18/50 (36%) Frame = +2 / +2 Query: 1085 NAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGR 1234 + W PWR W G W W W RR G R RR R R Sbjct: 371 SGWCAPWRRTWRRGVPGAW*TWAAWWARRRRRGPAPTARRRRRCTRRRTR 520
>LOC_Os12g16030:12012.t01456:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3910 Score = 37.7 bits (76), Expect = 0.26 Identities = 19/46 (41%), Positives = 22/46 (47%) Frame = +2 / +2 Query: 1145 PWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYA 1282 P + R ARR R RR+G R +G R A RW R RW A Sbjct: 71 PGSSAARGARRRARGARRRDGARRGSGDGTRAATGRRWQRRQRWRA 208
>LOC_Os10g38040:12010.t03058:unspliced-genomic lysM domain containing protein, expressed| Length = 1203 Score = 37.7 bits (76), Expect = 0.26 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 W WR AWW +G + R W+ GWR R R+ R GRR Sbjct: 102 WRGAWRWAWWRCCWWGRWRRRRRWWWCAGRGWRRRGRARRYTWWRKGRR 248
>LOC_Os07g49250:12007.t04553:unspliced-genomic pyruvate decarboxylase isozyme 3, putative, expressed| Length = 2163 Score = 37.7 bits (76), Expect = 0.26 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +2 / -1 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYAC 1222 R GW R GGW WR R +R GR GRR C Sbjct: 726 RRGWRRARRGGWPGWRASGRGSRAPGRGRRWGGGRRGGC 610
>LOC_Os07g31650:12007.t02852:unspliced-genomic expressed protein| Length = 5222 Score = 37.7 bits (76), Expect = 0.26 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +2 / -3 Query: 1076 PWRNAWWFPWRYGWYAWRNGGWFP 1147 PWR AW PWR AW W P Sbjct: 126 PWRAAWRMPWRGPSMAWSRAAWRP 55
>LOC_Os07g07920:12007.t00671:unspliced-genomic lipid binding protein, putative, expressed| Length = 1519 Score = 37.7 bits (76), Expect = 0.26 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 / +1 Query: 1118 YAWRNGGWFPWRNGWRYARRNGRWYARRNGR 1210 + WR W PW WR RR RW R R Sbjct: 121 WPWRRRRWSPWWQWWRRRRRGRRWRRRARRR 213
>LOC_Os06g49290:12006.t04613:unspliced-genomic acanthoscurrin-2 precursor, putative, expressed| Length = 598 Score = 37.7 bits (76), Expect = 0.26 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = +2 / +3 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGR 1273 R GWR RR W+ RR R+ R RR+ RW R R Sbjct: 63 RQGWRRRRRRQGWWWRRWRRQRRWRRQRRWGQERRWRRRRR 185 Score = 29.9 bits (59), Expect(2) = 1.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYAR 1198 WW WR R W R R RR GRW R Sbjct: 102 WWRRWRRQRRWRRQRRWGQERRWRRRRRRKGRWRRR 209 Score = 22.6 bits (43), Expect(2) = 1.5 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +3 Query: 1004 RRHAWWNARW 1033 RR WW RW Sbjct: 87 RRQGWWWRRW 116
>LOC_Os06g43060:12006.t03996:unspliced-genomic expressed protein| Length = 610 Score = 37.7 bits (76), Expect = 0.26 Identities = 20/60 (33%), Positives = 25/60 (41%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRR 1237 W W R W+ R+ W R G + R+ WR RR RW + G A R RR Sbjct: 42 WWYIWRRARRRGWWWRRWRW*CCRGGRRWWGRSRWRRRRRRSRWGSAAPGSPSASRAPRR 221 Score = 32.7 bits (65), Expect = 8.6 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 W Y W R GW+ R W R RW+ R RR Sbjct: 42 WWYIWRRARRRGWWWRRWRW*CCRGGRRWWGRSRWRR 152
>LOC_Os04g59400:12004.t05397:unspliced-genomic expressed protein| Length = 7349 Score = 37.7 bits (76), Expect = 0.26 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +2 / -3 Query: 1127 RNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWR 1294 R G PW R ARR RR A R GRW GR +W WR Sbjct: 633 RCSGMTPWATR*RAARRPASRRTSARERRSAAAVSRASGGGGRWTWRGRLSSWWWR 466
>LOC_Os02g17860:12002.t01580:unspliced-genomic expressed protein| Length = 5462 Score = 28.6 bits (56), Expect(2) = 0.29 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 / +2 Query: 1055 GWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNG 1183 GW A W W WR+ WR + W R++ R G Sbjct: 3830 GWRAQRRWWCGGWRARWRW*GARWRTR*RWRWWLAIRWSYRRG 3958 Score = 26.3 bits (51), Expect(2) = 0.29 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 / +2 Query: 1223 RNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 R RR W G W RW WR R Sbjct: 3953 RGTRRRWWCGGWRARWRW*GARWRTRR 4033
>LOC_Os07g35260:12007.t03201:unspliced-genomic serine/threonine kinase-like protein, putative, expressed| Length = 5452 Score = 30.9 bits (61), Expect(2) = 0.29 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 / -2 Query: 1196 RRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 RR R C GR A G R R W WRC R Sbjct: 393 RRRRRWRPCCRGRAAARPGTRRRRSRRRRWRWRCRR 286 Score = 24.0 bits (46), Expect(2) = 0.29 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / -2 Query: 1103 WRYGWYAWRNGGWFPWRNGWR 1165 WR G WR+G R WR Sbjct: 435 WRRGSSGWRSGARRRRRRRWR 373
>LOC_Os03g55470:12003.t04811:unspliced-genomic expressed protein| Length = 4418 Score = 32.2 bits (64), Expect(2) = 0.29 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 / -3 Query: 1088 AWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGR 1186 AW WR+ W + + W+ R WR+ R GR Sbjct: 456 AWRPRWRWSWRSPTSWWWWWRRRRWRWIWRRGR 358 Score = 22.6 bits (43), Expect(2) = 0.29 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 / -3 Query: 1229 GRRYAWNGRW*RNGRWYAWSWR 1294 GR Y W R R W WR Sbjct: 342 GRPYPWASRRRRRRPWRRRHWR 277
>LOC_Os03g30800:12003.t02686:unspliced-genomic fumarylacetoacetate hydrolase family protein| Length = 2398 Score = 35.4 bits (71), Expect(2) = 0.30 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 / +1 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNG 1270 W A R GRW ARR G R GR GR R G Sbjct: 2134 WLCAARRGRWLARRQGGGGCARRGRGGGGRGRRGRAG 2244 Score = 24.9 bits (48), Expect(2) = 0.30 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +2 / +2 Query: 932 SPSCRGAGCL 961 SPS RGAGCL Sbjct: 170 SPSSRGAGCL 199
>LOC_Os07g09420:12007.t00817:unspliced-genomic ATPase 2, putative, expressed| Length = 1753 Score = 35.9 bits (72), Expect(2) = 0.30 Identities = 22/56 (39%), Positives = 22/56 (39%) Frame = +2 / -2 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGR 1273 R GW G PWR G R R G RR GR R GR GR R R Sbjct: 687 RRGW*RACAAGS*PWRRGPRGGRGGGTRRGRRRGRAPGKRGGRTAGRRGRRGRPSR 520 Score = 24.0 bits (46), Expect(2) = 0.30 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +2 / -2 Query: 1076 PWRNAWW 1096 PWR +WW Sbjct: 930 PWRRSWW 910
>LOC_Os04g30810:12004.t02766:unspliced-genomic F-box domain containing protein| Length = 1644 Score = 29.0 bits (57), Expect(2) = 0.31 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +2 / +2 Query: 1250 GRW*RNGRWYAWSWRCSR*C 1309 GRW G W+ +WRC C Sbjct: 1361 GRWGS*GTWWRRAWRCGASC 1420 Score = 25.8 bits (50), Expect(2) = 0.31 Identities = 13/35 (37%), Positives = 14/35 (40%) Frame = +2 / +2 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 RR R Y R R R + W G R GRW Sbjct: 1265 RRRRRRYHGRRRRARGTSASRSWRWWGSPRRGGRW 1369
>LOC_Os09g06660:12009.t00462:unspliced-genomic hypothetical protein| Length = 1226 Score = 28.6 bits (56), Expect(2) = 0.32 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 / -2 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYAR 1174 W YGW+ R+ GW R R R Sbjct: 292 WAYGWWR*RSSGWGSCRGRSRRGR 221 Score = 26.3 bits (51), Expect(2) = 0.32 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / -2 Query: 1172 RRNGRWYARRNGRRYACRNGRR 1237 R G+W R+ ACR GRR Sbjct: 181 RSAGKWRGRKPRGASACRRGRR 116
>LOC_Os03g05160:12003.t00389:unspliced-genomic GATA zinc finger family protein, expressed| Length = 1108 Score = 29.9 bits (59), Expect(2) = 0.32 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNG 1135 RR W+ + R+ W PWR W R G Sbjct: 300 RRRSWSGFRTRTRSRRWTPWRRRWSRRRPG 389 Score = 24.9 bits (48), Expect(2) = 0.32 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 / +3 Query: 1184 RWYARRNGRRYACRNGR 1234 RW RR GRR A R GR Sbjct: 366 RWSRRRPGRRRARRWGR 416
>LOC_Os12g02530:12012.t00149:unspliced-genomic RPT2-like protein, putative, expressed| Length = 2378 Score = 37.3 bits (75), Expect = 0.36 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 / -2 Query: 1376 GPSRCDEQPCQLGQAPGQPEGGTHHRQDDGQDEREPVKAP 1495 GPSRC P APG P G R + R P AP Sbjct: 1735 GPSRCTPSPSPSPPAPGAPSGRCRRRGTGSRASRAPPSAP 1616
>LOC_Os11g02610:12011.t00154:unspliced-genomic RPT2-like protein, putative, expressed| Length = 2412 Score = 37.3 bits (75), Expect = 0.36 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +2 / -3 Query: 1376 GPSRCDEQPCQLGQAPGQPEGGTHHRQDDGQDEREPVKAP 1495 GPSRC P APG P G R + R P AP Sbjct: 1741 GPSRCTPSPSPSPPAPGAPSGRCRRRGTGSRASRAPPSAP 1622
>LOC_Os09g35760:12009.t03054:unspliced-genomic OCL3 protein, putative, expressed| Length = 6344 Score = 37.3 bits (75), Expect = 0.36 Identities = 18/43 (41%), Positives = 20/43 (46%) Frame = +2 / -1 Query: 1145 PWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGR 1273 PW G R GRW RR RR R GR+ G W R+ R Sbjct: 1370 PWPRGRAPGARRGRWRRRRPPRRAWRRRGRQCPRVGAWRRSPR 1242
>LOC_Os08g09720:12008.t00857:unspliced-genomic F-box domain containing protein, expressed| Length = 3015 Score = 37.3 bits (75), Expect = 0.36 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = -3 / -1 Query: 1275 HLPFLYHRPFQAYRLPFLQAYRLPFLRAYHLPFLRAYLHPFLQGNHPPFLQAYHPYLQGN 1096 H +Y+RP+ +Y Q + L + + L R Y H HPP L A + N Sbjct: 1155 HQDQIYYRPYFSYHQSHYQLHCLSYHQGPQL*VQRNYHHNQTHRCHPPTLAADSHHSSEN 976 Query: 1095 HQA 1087 HQA Sbjct: 975 HQA 967
>LOC_Os06g11980:12006.t01075:unspliced-genomic expressed protein| Length = 1819 Score = 37.3 bits (75), Expect = 0.36 Identities = 19/48 (39%), Positives = 22/48 (45%) Frame = +2 / +2 Query: 1100 PWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYA 1243 PW+ W G R G R A R RW RR+ R + R GRR A Sbjct: 80 PWKEA*RRWGRGTGTTARCGGRRACRGSRWRRRRSSRGGSRRRGRRGA 223
>LOC_Os03g62300:12003.t05456:unspliced-genomic hypothetical protein| Length = 8052 Score = 27.6 bits (54), Expect(2) = 0.38 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 / +3 Query: 1139 WFPWRNGWRYARRNGRWYA 1195 W WR WR++RR+ R +A Sbjct: 411 WRSWRACWRWSRRSPRAHA 467 Score = 26.7 bits (52), Expect(2) = 0.38 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 / +1 Query: 1280 AWSWRCSR*C 1309 AWSW CSR C Sbjct: 574 AWSWSCSRWC 603
>LOC_Os12g44300:12012.t04096:unspliced-genomic monovalent cation proton antiporter, putative, expressed| Length = 2749 Score = 29.5 bits (58), Expect(3) = 0.40 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 / +2 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYG 1114 WW R P R GW W P W P + G Sbjct: 755 WWRRRCAGSPPRCGWT*TWRPSWWGWRSPAKGG 853 Score = 25.8 bits (50), Expect(3) = 0.40 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 / +2 Query: 1363 QRLWRPFKM**ATLPTWPSTRPTRRWDPSS 1452 +R W +T TWP+ RP+ W +S Sbjct: 2123 RRRWTTSSSRSSTGSTWPAARPSGTWRSTS 2212 Score = 24.9 bits (48), Expect(3) = 0.40 Identities = 14/51 (27%), Positives = 18/51 (35%) Frame = +2 / +2 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCS 1300 WR + R R + + R R R + W R R G W CS Sbjct: 1178 WRRSRPASSRTSRSWPSSSWWR*TWRRRRWWGWRSRRGRGGACSGG*WGCS 1330 Score = 30.4 bits (60), Expect(2) = 1.3 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 / -1 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 WR G RR R R GRR GR W W R WR R Sbjct: 472 WRGG*GPGRRCWRGRRRGRGRRGGSSRGRCRRWGA*WGRGRA*RGRRWRRCR 317 Score = 22.1 bits (42), Expect(2) = 1.3 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 / -1 Query: 1079 WRNAWWFPWRYGWYAWRNGG 1138 WR AWW R R GG Sbjct: 562 WR*AWW*ACRRRCLRRRRGG 503
>LOC_Os12g42900:12012.t03963:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 1658 Score = 27.6 bits (54), Expect(2) = 0.42 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 / -3 Query: 1232 RRYAWNGRW*RNGRWY 1279 RR+ W RW R RW+ Sbjct: 690 RRWTWRRRWRRRRRWW 643 Score = 26.7 bits (52), Expect(2) = 0.42 Identities = 11/33 (33%), Positives = 12/33 (36%) Frame = +2 / -3 Query: 1040 IPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGG 1138 +PR W R WW W W NGG Sbjct: 888 VPRSSWWYCRRRRRRRWWWQCWWRLWLRLHNGG 790
>LOC_Os05g32070:12005.t02803:unspliced-genomic LRP1, putative, expressed| Length = 1337 Score = 27.6 bits (54), Expect(2) = 0.43 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 / -2 Query: 1097 FPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 F WR A R G + GWR R W+ R Sbjct: 691 FVWRRAIAAMRRGRVLTYLGGWRRCRSCEEWWRWR 587 Score = 26.7 bits (52), Expect(2) = 0.43 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +2 / -2 Query: 1274 WYAWSWRCSR 1303 W+ W WRC R Sbjct: 601 WWRWRWRCGR 572
>LOC_Os02g43540:12002.t03939:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 979 Score = 29.5 bits (58), Expect(2) = 0.44 Identities = 15/57 (26%), Positives = 20/57 (35%) Frame = +2 / +1 Query: 1031 WLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 W+ +R W W R W W + WR WR RR W+ +R Sbjct: 343 WVRWQQRRRWRRRWRRRRRKRSSIWFRWRIRWPPRRLWRWRWRWRRRRRPQLWWRQR 513 Score = 24.9 bits (48), Expect(2) = 0.44 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 / +1 Query: 1244 WNGRW*RNGRWYAWSWRCSR*C 1309 W G W RW+ W R C Sbjct: 562 WRGWWRSRRRWWIWRGLWRRRC 627 Score = 26.3 bits (51), Expect(2) = 8.5 Identities = 10/25 (40%), Positives = 10/25 (40%) Frame = +2 / +1 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRW 1189 W W W WR WR RR W Sbjct: 529 WQLWWWL*WGTWRGWWRSRRRWWIW 603 Score = 23.5 bits (45), Expect(2) = 8.5 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 / +1 Query: 1082 RNAWWFPWRYGWYAWRNGGW 1141 R++ WF WR W R W Sbjct: 403 RSSIWFRWRIRWPPRRLWRW 462
>LOC_Os03g07640:12003.t00625:unspliced-genomic sulfated surface glycoprotein 185 precursor, putative| Length = 630 Score = 29.9 bits (59), Expect(2) = 0.45 Identities = 18/60 (30%), Positives = 20/60 (33%) Frame = +2 / -1 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNG 1270 WW + WR R WR R R RR G R R W RW +G Sbjct: 252 WWRACDRRRWRWRRHQRAGRRRWWRACNRRWRRKRRRAGLRRWRRRACLCLWAWRWRGSG 73 Score = 24.4 bits (47), Expect(2) = 0.45 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = +2 / -1 Query: 1046 RRHGWNAWWLPWRNAWWF 1099 RR WW W WW+ Sbjct: 303 RRRAGRRWWWWWW*WWWW 250 Score = 26.3 bits (51), Expect(2) = 8.8 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 / -1 Query: 1028 RWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAW 1126 RW + RR W WW R + W + + W Sbjct: 351 RWRALNRRRRWR*WWRRRRAGRRWWWWWW*WWW 253 Score = 23.5 bits (45), Expect(2) = 8.8 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +2 / -1 Query: 1223 RNGRRYAWNGRW*RNGRWYAWSWR 1294 R RR A RW R W+WR Sbjct: 159 RRKRRRAGLRRWRRRACLCLWAWR 88
>LOC_Os03g52300:12003.t04556:unspliced-genomic conserved hypothetical protein| Length = 2764 Score = 33.6 bits (67), Expect(2) = 0.46 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 / +2 Query: 1121 AWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGR 1234 +WR R+GWR W RR GRR + R GR Sbjct: 182 SWRRTTRRGRRSGWRRCGGAATWRRRRRGRRRSSRAGR 295 Score = 26.3 bits (51), Expect(2) = 0.46 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 / +2 Query: 556 WKRPSSISPRLYC*IQPRQS 615 W R +S SPRL C +PR++ Sbjct: 32 WPRRASSSPRLRCGRRPRRA 91
>LOC_Os07g43190:12007.t03966:unspliced-genomic conserved hypothetical protein| Length = 411 Score = 28.1 bits (55), Expect(2) = 0.46 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 / +2 Query: 1220 CRNGRRYAWNGRW*RNGRWYAWSWR 1294 CR R RW R G+W WS R Sbjct: 248 CRRRWRRREAARWCRRGQWRRWSRR 322 Score = 26.3 bits (51), Expect(2) = 0.46 Identities = 9/32 (28%), Positives = 10/32 (31%) Frame = +2 / +2 Query: 1004 RRHAWWNARWLPIPRRHGWNAWWLPWRNAWWF 1099 R W RW R WW W W+ Sbjct: 119 RSRRWCRRRWRRRARARWRRRWWRRWCRRRWW 214 Score = 27.2 bits (53), Expect(2) = 9.1 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +2 / +2 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 R +RR R RR CR G+ W+ RW R W Sbjct: 230 RRSRRWCRRRWRRREAARWCRRGQWRRWSRRWWRRRCW 343 Score = 22.6 bits (43), Expect(2) = 9.1 Identities = 5/9 (55%), Positives = 5/9 (55%) Frame = +2 / +2 Query: 1079 WRNAWWFPW 1105 WR WW W Sbjct: 170 WRRRWWRRW 196
>LOC_Os12g06870:12012.t00572:unspliced-genomic nucleoporin autopeptidase family protein, expressed| Length = 6281 Score = 36.8 bits (74), Expect = 0.49 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = +2 / -2 Query: 1082 RNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACR 1225 R+ W G A R GW +G R A+R RW A+ +G R A R Sbjct: 973 RSGWLAKGSGGH*AKRRSGWLAKGSGRRRAKRRSRWLAKGSGGRRAKR 830 Score = 33.6 bits (67), Expect = 4.6 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 / -2 Query: 1121 AWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGR 1234 A R GW +G A+R W A+ +GRR A R R Sbjct: 982 AKRRSGWLAKGSGGH*AKRRSGWLAKGSGRRRAKRRSR 869
>LOC_Os11g38410:12011.t03383:unspliced-genomic hypothetical protein| Length = 435 Score = 36.8 bits (74), Expect = 0.49 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 / +2 Query: 1004 RRHAWWNARWLPIPRRHGWNA 1066 R+H WW RWL + R+ W++ Sbjct: 251 RQHPWWQRRWLTVQRQRSWSS 313 Score = 35.9 bits (72), Expect = 0.93 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +2 / -1 Query: 626 QSICVYQNEKARCCHP*CECCSRDQPRL 709 Q +C+ RC H C CC R QPRL Sbjct: 306 QDLCLCTVSHRRCHHGCCRCCLRPQPRL 223
>LOC_Os09g39930:12009.t03457:unspliced-genomic serine/threonine-protein kinase NAK, putative, expressed| Length = 1897 Score = 36.8 bits (74), Expect = 0.49 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 / -3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFPWRNGWRYAR 1174 W+ AWW P W WR G PW R AR Sbjct: 1586 WQGAWWRPPGGTWRRWRGPGRGPWWGRRRGAR 1491
>LOC_Os06g40020:12006.t03699:unspliced-genomic ATP-dependent RNA helicase ded-1, putative, expressed| Length = 5143 Score = 36.8 bits (74), Expect = 0.49 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 / +2 Query: 1028 RWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWR 1153 RW R W W L W WW R+ W+ R W WR Sbjct: 4448 RWWWWRRLLRWWWWLLRWWPWWWLLTRWPWWLLRRRRWRWWR 4573 Score = 33.1 bits (66), Expect = 6.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 / +2 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWR 1129 W WWL R WW R W WR Sbjct: 4502 WPWWWLLTRWPWWLLRRRRWRWWR 4573
>LOC_Os04g57860:12004.t05251:unspliced-genomic endoglucanase precursor, putative, expressed| Length = 3780 Score = 36.8 bits (74), Expect = 0.49 Identities = 17/48 (35%), Positives = 19/48 (39%) Frame = +2 / -3 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWR 1294 R WR RR GR R R C R + RW RW W+ R Sbjct: 2941 RRRWRRGRRRGRRGGRWGRRSCCCSTCRSFPCTRRWRSWRRWTGWTRR 2798
>LOC_Os04g16950:12004.t01449:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 9658 Score = 36.8 bits (74), Expect = 0.49 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +2 / +3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGW 1117 WW RWL R+ W+ W+ WW + W Sbjct: 183 WWWERWLQQQRQQQLQLRWMRWQLRWWLWRSWPW 284
>LOC_Os04g32460:12004.t02925:unspliced-genomic transport inhibitor response 1 protein, putative, expressed| Length = 4496 Score = 30.4 bits (60), Expect(2) = 0.53 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 / -2 Query: 1217 ACRNGRRYAWNGRW*RNGRWYAWSWR 1294 A R GRR R R G W+ W WR Sbjct: 88 ARRGGRRRRRRRRRRRRGEWWWWGWR 11 Score = 23.5 bits (45), Expect(2) = 0.53 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 / -1 Query: 1139 WFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYA 1243 W W+ G RNG R R + R RR A Sbjct: 173 WRTWKRGGNQPTRNGGSTGRAPRRGRSDREKRRTA 69
>LOC_Os04g42100:12004.t03764:unspliced-genomic peroxidase 18 precursor, putative, expressed| Length = 4319 Score = 31.8 bits (63), Expect(2) = 0.53 Identities = 21/63 (33%), Positives = 24/63 (38%) Frame = +2 / -3 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWR 1294 W R WF R R+ R R RR+ R+ R RR R R RW WR Sbjct: 924 WSRRRRRRWFRCRCRRRWRWRPRRKRRRRSRSRWRGRWRRRLCGRRRRRRRRRWLRRGWR 745 Query: 1295 CSR 1303 R Sbjct: 744 RRR 736 Score = 22.1 bits (42), Expect(2) = 0.53 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +2 / -2 Query: 1016 WWNARWLP 1039 WWN W P Sbjct: 1066 WWNPMWRP 1043 Score = 33.1 bits (66), Expect = 6.3 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +2 / -3 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGR 1273 RR RW RR R + CR RR+ W R R R Sbjct: 939 RRGIRWSRRRRRRWFRCRCRRRWRWRPRRKRRRR 838
>LOC_Os11g47900:12011.t04282:unspliced-genomic chitin-inducible gibberellin-responsive protein 2, putative,| expressed Length = 2285 Score = 27.2 bits (53), Expect(2) = 0.56 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 / -2 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNG 1207 W WR+ R GGW R RR R RR G Sbjct: 499 WGKSWRWPPRHRRRGGWAGHRRRRTTTRRRRRRRGRRRG 383 Score = 26.7 bits (52), Expect(2) = 0.56 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 / -1 Query: 1220 CRNGRRYAWNGRW*RNGRWYAWSWR 1294 C RR W+G W*+ W + S R Sbjct: 368 CWARRRAGWSGYW*KKWSWTSSSMR 294
>LOC_Os11g33050:12011.t02901:unspliced-genomic expressed protein| Length = 1120 Score = 25.4 bits (49), Expect(3) = 0.56 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 / -2 Query: 1139 WFPWRNGWRYARRNGR 1186 W+ WR WR RR R Sbjct: 777 WWRWRRRWRCHRRRRR 730 Score = 22.1 bits (42), Expect(3) = 0.56 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / -2 Query: 1046 RRHGWNAWW 1072 RR GW WW Sbjct: 885 RRRGWWWWW 859 Score = 22.1 bits (42), Expect(3) = 0.56 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / -2 Query: 1181 GRWYARRNGRR 1213 G W+ RR GRR Sbjct: 624 GGWWRRRRGRR 592
>LOC_Os08g31200:12008.t02869:unspliced-genomic cytokinin-O-glucosyltransferase 2, putative| Length = 2089 Score = 28.1 bits (55), Expect(2) = 0.56 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +2 / -1 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNG 1252 WR W RR ARR RR R R W G Sbjct: 442 WRRPWCCRRRRR*RAARRRRRRRHRRRPPRQVWRG 338 Score = 25.8 bits (50), Expect(2) = 0.56 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +2 / -1 Query: 1121 AWRNGGWFPWRNGWR 1165 AWR+GG R GWR Sbjct: 481 AWRSGGRARARRGWR 437
>LOC_Os12g43140:12012.t03986:unspliced-genomic late embryogenesis abundant protein D-34, putative, expressed| Length = 675 Score = 27.6 bits (54), Expect(3) = 0.58 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +2 / +2 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSW 1291 R W R W R G R AW RW R R W Sbjct: 365 RTWWPPGRTPTEWRPPRRGTRPGAAAAAGRAWRRRWRRRRR*TRGGW 505 Score = 25.8 bits (50), Expect(3) = 0.58 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +2 / +2 Query: 1031 WLPIPRRHGWNAWWLPWR 1084 W PRR WW P R Sbjct: 335 WWAAPRRRSRRTWWPPGR 388 Score = 22.1 bits (42), Expect(3) = 0.58 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +3 Query: 545 RRETGRGRRASHQG 586 RR G GRR +H G Sbjct: 165 RRRGGAGRRDAHHG 206
>LOC_Os03g01960:12003.t00089:unspliced-genomic expressed protein| Length = 1041 Score = 31.8 bits (63), Expect(2) = 0.62 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +2 / -3 Query: 1124 WRNGGWFPWRNGWRYARRNGRWYARRNGRRYA 1219 W G W W GW + RR R A GRR A Sbjct: 235 WW*GEWGCWGRGWAWRRRRRR*GASGRGRRGA 140 Score = 26.3 bits (51), Expect(2) = 0.62 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 / -1 Query: 1418 APGQPEGGTHHRQDDGQDE 1474 APG G HR DDG++E Sbjct: 144 APGCRGGEEEHRGDDGEEE 88
>LOC_Os12g01820:12012.t00080:unspliced-genomic ATCHX15, putative, expressed| Length = 3047 Score = 36.3 bits (73), Expect = 0.68 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +2 / +1 Query: 1142 FPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAW 1246 F W WR A R W A R G CR+GR W Sbjct: 1093 FVWSCSWRCAWRARWWGASRRGSSSPCRSGRPPCW 1197
>LOC_Os07g15320:12007.t01395:unspliced-genomic expressed protein| Length = 2172 Score = 36.3 bits (73), Expect = 0.68 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 / +2 Query: 1151 RNGWRYARRNGRWYARRNGRR 1213 R+GWR RR W+ARR GRR Sbjct: 1478 RSGWRTGRRWSGWWARRGGRR 1540
>LOC_Os03g57880:12003.t05049:unspliced-genomic glucan endo-1,3-beta-glucosidase 5 precursor, putative, expressed| Length = 2436 Score = 36.3 bits (73), Expect = 0.68 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 / -2 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRR 1237 WR+ RW +R RR+ACR GRR Sbjct: 1574 WRWRACRRRWASRPRRRRWACRRGRR 1497
>LOC_Os03g30280:12003.t02640:unspliced-genomic hypothetical protein| Length = 617 Score = 36.3 bits (73), Expect = 0.68 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNG 1231 WR+GWR+ R G RR G R A R+G Sbjct: 54 WRSGWRWRRGFGGGLGRRGGGRGAARDG 137
>LOC_Os03g21850:12003.t01938:unspliced-genomic expressed protein| Length = 7262 Score = 36.3 bits (73), Expect = 0.68 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 / +2 Query: 1181 GRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 GRW R GRR R RR W R R RW Sbjct: 152 GRWRRRWRGRRRGRRRSRRGRWRARRRRRARW 247
>LOC_Os01g63280:12001.t05697:unspliced-genomic receptor protein kinase TMK1 precursor, putative, expressed| Length = 3446 Score = 27.2 bits (53), Expect(2) = 0.73 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = +2 / +3 Query: 1031 WLPIPRRHGWNAWWLPWRNAW 1093 W P G WW PWR W Sbjct: 2874 WRWTPGCGGPARWWRPWRK*W 2936 Score = 26.3 bits (51), Expect(2) = 0.73 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 1139 WFPWRNGWRYARRNGRWYARR 1201 W PWR WR+ R ARR Sbjct: 2913 WRPWRK*WRWRPSAPRRTARR 2975
>LOC_Os10g41200:12010.t03356:unspliced-genomic ZmMybst1, putative, expressed| Length = 3231 Score = 29.0 bits (57), Expect(2) = 0.73 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +2 / -1 Query: 1148 WRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWR 1294 WR R R RR GRR R GRR W R R G + WR Sbjct: 435 WRRRSPGRSRRRRSRRRRWGRRRGRRRGRRRRWWIRRRRRGGRGSPCWR 289 Score = 24.4 bits (47), Expect(2) = 0.73 Identities = 10/30 (33%), Positives = 12/30 (40%) Frame = +2 / -1 Query: 1358 *PRGYGGPSRCDEQPCQLGQAPGQPEGGTH 1447 *PRG+G + C C A P H Sbjct: 246 *PRGWGTSASCARCGCSASTASSSPPPSLH 157
>LOC_Os01g64060:12001.t05774:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1269 Score = 29.9 bits (59), Expect(2) = 0.75 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / +3 Query: 509 PGSKGPGNGSNVRRETGRGR 568 PG +G GNG R+E RGR Sbjct: 156 PGERGKGNGPAQRKEAERGR 215 Score = 28.1 bits (55), Expect(2) = 0.75 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 / +1 Query: 693 EINPDSAKGYKTRGMANAMLGKWEEA 770 +INP S+KG+K +A KW EA Sbjct: 535 DINPPSSKGHKFILVATDYFTKWVEA 612
>LOC_Os10g09990:12010.t00810:unspliced-genomic cytokinin-O-glucosyltransferase 3, putative, expressed| Length = 1766 Score = 29.9 bits (59), Expect(2) = 0.76 Identities = 15/50 (30%), Positives = 18/50 (36%) Frame = +2 / +2 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNG 1252 W W + W+ WR A R RW RR+ R R R G Sbjct: 77 WCRWWRRATSSLWWTWRASSPAAARASRWSPRRSTPRATGRPSRERGGEG 226 Score = 23.5 bits (45), Expect(2) = 0.76 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 / +2 Query: 1363 QRLWRPFKM**ATLPTWPSTRPTRRWDPSSPR 1458 +R WR + + TW S+RP W S R Sbjct: 278 RRAWRTWTSWWTSPCTWLSSRPCGTWRRRSRR 373
>LOC_Os06g04870:12006.t00376:unspliced-genomic homeobox-leucine zipper protein HAT1, putative, expressed| Length = 1646 Score = 27.6 bits (54), Expect(2) = 0.77 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 / -1 Query: 1055 GWNAWWLPWRNA 1090 GW+ WWL W A Sbjct: 1052 GWHCWWLGWCGA 1017 Score = 25.8 bits (50), Expect(2) = 0.77 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +2 / -2 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRNGR 1234 R WR R G W A R RR A R Sbjct: 1018 RRRWRRGGRRGTW*AWRRRRRRAASRTR 935
>LOC_Os05g09150:12005.t00792:unspliced-genomic conserved hypothetical protein| Length = 1452 Score = 30.4 bits (60), Expect(2) = 0.77 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 / -3 Query: 1157 GWRYARRNGRWYARRNGRRYACRNGR 1234 GWR W RR GRR ACR R Sbjct: 532 GWRSGAWCPPWRRRRPGRRRACRTPR 455 Score = 23.1 bits (44), Expect(2) = 0.77 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +2 / -3 Query: 1079 WRNAWWFPWRYGWYAWRNGGWFP 1147 WR A R WR+G W P Sbjct: 574 WRGARGRRRRAAARGWRSGAWCP 506
>LOC_Os10g31320:12010.t02458:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 929 Score = 28.1 bits (55), Expect(3) = 0.77 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 / +3 Query: 1031 WLPIPRRHGWNAWWLPWRNAWW 1096 WL I R W WW W WW Sbjct: 453 WLWIWIRCRWC*WWWRWTWWWW 518 Score = 24.9 bits (48), Expect(3) = 0.77 Identities = 7/24 (29%), Positives = 11/24 (45%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGGWFPWRNGW 1162 WW+ R W+ W + W+ W Sbjct: 510 WWWRRRSRWWVW*RLRLWIWQGIW 581 Score = 23.1 bits (44), Expect(3) = 0.77 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +3 Query: 1004 RRHAWWNARW 1033 RR WW RW Sbjct: 153 RRWRWWRRRW 182 Score = 27.6 bits (54), Expect(2) = 1.9 Identities = 8/24 (33%), Positives = 11/24 (45%) Frame = +2 / +3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWR 1129 W WW R+ WW R + W+ Sbjct: 501 WTWWWWRRRSRWWVW*RLRLWIWQ 572 Score = 24.4 bits (47), Expect(2) = 1.9 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +2 / +3 Query: 1133 GGWFPWRNGWRYARRNGRWYARRNGRR 1213 G W WR W + W+ RR RR Sbjct: 573 GIWSRWRCLWWRICKRWWWWRRRRPRR 653 Score = 28.1 bits (55), Expect(2) = 4.7 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = +2 / +3 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWR 1153 RR W WW R +W + + W W+ W+ Sbjct: 288 RRRRW*RWWFWLRVWFWTRFWIRIWLWCFWSWWLWK 395 Score = 22.6 bits (43), Expect(2) = 4.7 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRW 1189 WR W + RR RW Sbjct: 495 WRWTWWWWRRRSRW 536
>LOC_Os08g39590:12008.t03691:unspliced-genomic ATP binding protein, putative, expressed| Length = 2661 Score = 31.8 bits (63), Expect(2) = 0.80 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 / +2 Query: 1025 ARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWR 1129 ++W + R W WW W +AW + R WR Sbjct: 89 SQWRQLRGRRRWRWWWWWWCSAWRWRLR*TRTGWR 193 Score = 27.2 bits (53), Expect(2) = 0.80 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +2 / +2 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGR 1255 R G R ARR RR G +A R GRR GR Sbjct: 1769 RRGVRAARRGRGAGVRRAGAPHARRRGRRGDAEGR 1873
>LOC_Os08g01210:12008.t00021:unspliced-genomic YLS9, putative, expressed| Length = 567 Score = 30.4 bits (60), Expect(2) = 0.82 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 / -3 Query: 1157 GWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGR 1273 GW + RR GR GR + RR W+G R GR Sbjct: 280 GWCWWRRAGRSQGGGRGRSAGRGSRRRRRWSGSGGRGGR 164 Score = 23.1 bits (44), Expect(2) = 0.82 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = +2 / -2 Query: 1088 AWWFPWRYG 1114 +WW PW+ G Sbjct: 314 SWWRPWKEG 288
>LOC_Os08g14109:12008.t01286:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass, expressed| Length = 8597 Score = 28.1 bits (55), Expect(2) = 0.92 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 / -2 Query: 1163 RYARRNGRWYARRNGRRYACRNG 1231 R R G W+ RR GRR+ R G Sbjct: 4480 RGGARRGCWWRRRGGRRWR*RGG 4412 Score = 24.9 bits (48), Expect(2) = 0.92 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 / -1 Query: 1115 WYAWRNGGWFPWRNGWRYAR 1174 W R GGW WR AR Sbjct: 4616 WRCSRTGGWIRRAAAWRGAR 4557
>LOC_Os05g05660:12005.t00456:unspliced-genomic PWWP domain containing protein, expressed| Length = 7963 Score = 29.0 bits (57), Expect(2) = 0.93 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 / -3 Query: 1154 NGWRYARRNGRWYARRNGRRYACRNGRRYAWNG 1252 +GW R G R G R+ C GR W G Sbjct: 6869 SGWVTGGRGGCCAGRAGGCRWGCCAGRAGGWRG 6771 Score = 24.0 bits (46), Expect(2) = 0.93 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 / -3 Query: 1109 YGWYAWRNGG 1138 YGW WR GG Sbjct: 6905 YGWC*WRGGG 6876
>LOC_Os11g05320:12011.t00425:unspliced-genomic protein kinase PVPK-1, putative, expressed| Length = 4772 Score = 35.9 bits (72), Expect = 0.93 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 / -2 Query: 1046 RRHGWNAWWLPWRNAWWFPWR 1108 RR G AWW W WW+ WR Sbjct: 160 RRRGGAAWWWWWWWRWWWRWR 98
>LOC_Os09g16950:12009.t01482:unspliced-genomic protein kinase, putative, expressed| Length = 3209 Score = 35.9 bits (72), Expect = 0.93 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 / -3 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAW 1126 W RW P R W WW W+ W + WR+ + W Sbjct: 450 WCLWRWR**PWR*KWIWWWWRWQWRWRWRWRWL*WTW 340 Score = 26.3 bits (51), Expect(2) = 1.8 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +2 / -3 Query: 1238 YAWNGRW*RNGRWYAWSW 1291 + W RW RW W+W Sbjct: 393 WRWQWRWRWRWRWL*WTW 340 Score = 25.8 bits (50), Expect(2) = 1.8 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 / -3 Query: 1067 WWLPWRNAWWFPWRYGWYAWR 1129 WW WW WR+ WR Sbjct: 477 WWRRQNLWWWCLWRWR**PWR 415
>LOC_Os06g34830:12006.t03180:unspliced-genomic cationic amino acid transporter 4, putative, expressed| Length = 2491 Score = 35.9 bits (72), Expect = 0.93 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = +2 / -1 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRN 1228 R GWR ARR R RR RR+ACR+ Sbjct: 1609 RRGWRRARRRRRRA*RRRWRRWACRS 1532
>LOC_Os01g54700:12001.t04886:unspliced-genomic receptor protein kinase PERK1, putative, expressed| Length = 3703 Score = 35.9 bits (72), Expect = 0.93 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +2 / -2 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRY 1216 WR GW R R GWR+ RR GR + R RR+ Sbjct: 567 WRGGWDIGRRRACDRRRRGWRHRRRWGRRHRRWGRRRW 454 Score = 34.5 bits (69), Expect = 2.4 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 / -2 Query: 1127 RNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAW 1285 R G WR GW RR RR R R W R R RW+ W Sbjct: 588 RRGVVTRWRGGWDIGRRRACDRRRRGWRHRRRWGRRHRRWGRRRWRR*RWHWW 430
>LOC_Os01g40860:12001.t03607:unspliced-genomic retinal dehydrogenase 1, putative, expressed| Length = 9046 Score = 35.9 bits (72), Expect = 0.93 Identities = 17/30 (56%), Positives = 18/30 (60%) Frame = +2 / -1 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNG 1252 R+ R GR ARR GRR A R GRR A G Sbjct: 7315 RWGRSRGRR*ARRRGRRQAWRGGRRRARRG 7226 Score = 26.7 bits (52), Expect(2) = 9.5 Identities = 10/31 (32%), Positives = 12/31 (38%) Frame = +2 / -2 Query: 1139 WFPWRNGWRYARRNGRWYARRNGRRYACRNG 1231 W P + WR RW R+ CR G Sbjct: 2649 WSPGASPWRGGSSRPRWRLGVGARQPGCRRG 2557 Score = 22.6 bits (43), Expect(2) = 9.5 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 / -1 Query: 1220 CRNGRRYAWNGRW*RNGRWYAW 1285 CR+G RW G W W Sbjct: 2509 CRSGAAAPPAARWQSKGSWRWW 2444
>LOC_Os01g10420:12001.t00916:unspliced-genomic hypothetical protein| Length = 738 Score = 35.9 bits (72), Expect = 0.93 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 / +1 Query: 1067 WWLPWRNAWWFPWRYGWYAWRNGG 1138 WWL NAW + WR WR G Sbjct: 496 WWLKGGNAWMWSWRDDGLCWREAG 567
>LOC_Os07g40510:12007.t03709:unspliced-genomic formin-2, putative, expressed| Length = 6892 Score = 30.9 bits (61), Expect(2) = 0.94 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / -3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWRNGGW 1141 W W W W + WR+ WR G W Sbjct: 593 WWRRWRTWTCTWRWWWRWRARGWRWGRW 510 Score = 22.1 bits (42), Expect(2) = 0.94 Identities = 8/30 (26%), Positives = 14/30 (46%) Frame = +2 / -3 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARRN 1204 W++ R W WR W + + W+ R+ Sbjct: 392 WWSIRV*DWRWWRRRWNGS*QGRWWWRWRS 303 Score = 29.0 bits (57), Expect(2) = 1.3 Identities = 8/24 (33%), Positives = 9/24 (37%) Frame = +2 / -3 Query: 1058 WNAWWLPWRNAWWFPWRYGWYAWR 1129 W+ WR W W W WR Sbjct: 695 WSTCTATWRRKRWSTWTTTWRGWR 624 Score = 23.5 bits (45), Expect(2) = 1.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / -3 Query: 1148 WRNGWRYARRNGRW 1189 WR WR+ R RW Sbjct: 560 WRWWWRWRARGWRW 519 Score = 26.7 bits (52), Expect(2) = 3.0 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +2 / -3 Query: 1118 YAWRNGGWFPWRNGWRYARRNGR 1186 +AW WF W W RN R Sbjct: 236 WAWSTRTWFQWWRRWWRRWRNSR 168 Score = 24.4 bits (47), Expect(2) = 3.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 / -3 Query: 1070 WLPWRNAWWFPWRYGW 1117 W R W + WR+GW Sbjct: 281 WG*GRGRWRWRWRWGW 234 Score = 25.4 bits (49), Expect(2) = 5.4 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = +2 / -3 Query: 1067 WWLPWRNAWWFPWRYGWY 1120 WW WR+ W++ W+ Sbjct: 443 WWGRWRSIKACSWKWRWW 390 Score = 24.9 bits (48), Expect(2) = 5.4 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +2 / -3 Query: 1112 GWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRY 1216 GW R + WR GW ++ R + RR RR+ Sbjct: 284 GWG*GRGRWRWRWRWGWAWSTRTWFQWWRRWWRRW 180 Score = 26.3 bits (51), Expect(2) = 9.7 Identities = 8/24 (33%), Positives = 8/24 (33%) Frame = +2 / -3 Query: 1094 WFPWRYGWYAWRNGGWFPWRNGWR 1165 W W WR W W WR Sbjct: 704 WRRWSTCTATWRRKRWSTWTTTWR 633 Score = 23.1 bits (44), Expect(2) = 9.7 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 / -3 Query: 1244 WNGRW*RNGRWYAWSWRCSR*C 1309 W W RW A WR R C Sbjct: 572 WTCTWRWWWRWRARGWRWGRWC 507
>LOC_Os07g10250:12007.t00899:unspliced-genomic ATP-dependent RNA helicase DED1, putative, expressed| Length = 6296 Score = 28.1 bits (55), Expect(2) = 0.94 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +2 Query: 1067 WWLPWRNAWW 1096 WW WR WW Sbjct: 5759 WWWRWRRLWW 5788 Score = 24.9 bits (48), Expect(2) = 0.94 Identities = 8/23 (34%), Positives = 9/23 (39%) Frame = +2 / +2 Query: 1004 RRHAWWNARWLPIPRRHGWNAWW 1072 R+ WW W R W WW Sbjct: 5693 RQRQWWWRVWWWRWRLWRWRIWW 5761 Score = 32.7 bits (65), Expect(2) = 1.3 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +2 / +2 Query: 1082 RNAWWFPWRYGWYAWRNGGWFPWR 1153 R WW W + W WR W+ WR Sbjct: 5699 RQWWWRVWWWRWRLWRWRIWWWWR 5770 Score = 30.4 bits (60), Expect(2) = 1.3 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 / +2 Query: 1067 WWLPWRNAWWFPWRYGWYAW 1126 W+ P WW WR W+ W Sbjct: 773 WFSPGLWCWWPRWRRWWWRW 832 Score = 29.0 bits (57), Expect(2) = 1.3 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 / +2 Query: 1103 WRYGWYAWRNGGWFPWRNGW 1162 WR+ + WR W+ WR W Sbjct: 5726 WRWRLWRWRIWWWWRWRRLW 5785 Score = 26.7 bits (52), Expect(2) = 1.3 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / +2 Query: 1067 WWLPWRNAWW 1096 WW WR WW Sbjct: 797 WWPRWRRWWW 826
>LOC_Os04g49080:12004.t04424:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative| Length = 904 Score = 29.0 bits (57), Expect(3) = 0.98 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +2 / +2 Query: 1172 RRNGRWYARRNGRRYACRNGRR 1237 RR RW RR G+R R GRR Sbjct: 440 RRGRRWRRRRRGQRRWWRRGRR 505 Score = 23.5 bits (45), Expect(3) = 0.98 Identities = 10/27 (37%), Positives = 11/27 (40%) Frame = +2 / +2 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNG 1183 WR+ W R R WR RR G Sbjct: 248 WRWRWRGRRRSRE*VRRRRWRRRRRRG 328 Score = 23.1 bits (44), Expect(3) = 0.98 Identities = 6/17 (35%), Positives = 12/17 (70%) Frame = +1 / +3 Query: 514 KQRARQWKQCQKGNWKR 564 ++R R+W+Q + W+R Sbjct: 165 RRRGRRWRQRGQRRWRR 215 Score = 33.6 bits (67), Expect = 4.6 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGR 1255 RR RW RR GRR+ R RR+ GR Sbjct: 141 RRGRRWRRRRRGRRWRQRGQRRWRRRGR 224
>LOC_Os03g10650:12003.t00866:unspliced-genomic cyclin delta-3, putative, expressed| Length = 2517 Score = 30.9 bits (61), Expect(2) = 1.0 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 / -2 Query: 127 DGSIAIARVRVSPSFLPSSLDWVRERERE 41 +G++ + R + S LDW RERERE Sbjct: 125 EGNLQLERESEGKGWTDSGLDWNRERERE 39 Score = 22.1 bits (42), Expect(2) = 1.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 / -3 Query: 58 RERERESGGSTTKW 17 RERERE G +W Sbjct: 46 RERERERGVCVEEW 5
>LOC_Os05g20010:12005.t01764:unspliced-genomic hypothetical protein| Length = 919 Score = 23.1 bits (44), Expect(3) = 1.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / +3 Query: 1100 PWRYGWYAWRNGGWFPWR 1153 P R GW A +GG WR Sbjct: 105 PGRSGWLAAGDGGG*RWR 158 Score = 23.1 bits (44), Expect(3) = 1.0 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / +2 Query: 1217 ACRNGRRYAWNGRW 1258 A GRR+ W RW Sbjct: 182 AAGRGRRWRWQWRW 223 Score = 22.6 bits (43), Expect(3) = 1.0 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +2 / +2 Query: 1271 RWYAWSWR 1294 RW+ W WR Sbjct: 272 RWWLWRWR 295
>LOC_Os01g73110:12001.t06593:unspliced-genomic expressed protein| Length = 1289 Score = 29.0 bits (57), Expect(2) = 1.0 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 / +3 Query: 1112 GWYAWRNGGWFPWRNGWRYARRNGRWYARRNG 1207 GW+ G W W RRN W +RR G Sbjct: 255 GWWGRCRGRWRGWCGRTGSWRRNWAWRSRRAG 350 Score = 28.6 bits (56), Expect(2) = 1.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +3 Query: 1253 RW*RNGRWYAWSWR 1294 RW G W AW+WR Sbjct: 774 RWRGGGAWSAWAWR 815
>LOC_Os09g35600:12009.t03038:unspliced-genomic antiporter/ drug transporter/ transporter, putative, expressed| Length = 2009 Score = 29.9 bits (59), Expect(2) = 1.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 / +1 Query: 1163 RYARRNGRWYARRNGRRYACRNGR 1234 R RR GR + RR + ACRNG+ Sbjct: 1603 RRLRRRGRRHCRRRQSQAACRNGQ 1674 Score = 23.1 bits (44), Expect(2) = 1.0 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 / +3 Query: 1091 WWFPWRYGWYAWRNGG 1138 W + WR G W +GG Sbjct: 1440 WRWRWRSGPRGWTSGG 1487
>LOC_Os10g39150:12010.t03158:unspliced-genomic thylakoid membrane phosphoprotein 14 kda, chloroplast precursor,| putative, expressed Length = 1721 Score = 28.1 bits (55), Expect(2) = 1.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 / +1 Query: 1133 GGWFPWRNGWRYARRN 1180 G W+PWR G R RR+ Sbjct: 547 GTWWPWRRGRRRRRRS 594 Score = 24.9 bits (48), Expect(2) = 1.0 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = +2 / +1 Query: 1028 RWLPIPRRHGWNAWWLPWR 1084 +W + GW W PWR Sbjct: 511 KWRFNLQARGWRGTWWPWR 567
>LOC_Os10g31510:12010.t02474:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 792 Score = 31.3 bits (62), Expect(3) = 1.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 / +1 Query: 1139 WFPWRNGWRYARRNGRW 1189 W+ WR W +ARR RW Sbjct: 373 WWRWRRQWWWARRRHRW 423 Score = 22.1 bits (42), Expect(3) = 1.0 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +2 / +1 Query: 1271 RWYAWSWRC 1297 RW+ W W C Sbjct: 580 RWWIWLW*C 606 Score = 21.7 bits (41), Expect(3) = 1.0 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 1082 RNAWWFPWRYGW 1117 R WW+ +GW Sbjct: 148 RGEWWWVSEWGW 183
>LOC_Os10g35050:12010.t02800:unspliced-genomic aquaporin TIP3.1, putative, expressed| Length = 1430 Score = 27.6 bits (54), Expect(2) = 1.0 Identities = 7/17 (41%), Positives = 9/17 (52%) Frame = +2 / +1 Query: 1067 WWLPWRNAWWFPWRYGW 1117 W WR W + WR+ W Sbjct: 469 WRCRWRTRWRWRWRWRW 519 Score = 25.4 bits (49), Expect(2) = 1.0 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = +2 / +1 Query: 977 EGRIIKPLIRRHAWWNARW 1033 +G + RR WW RW Sbjct: 427 QGSCTRT*ARREGWWRCRW 483
>LOC_Os09g11880:12009.t00977:unspliced-genomic glycine-rich cell wall structural protein precursor, putative| Length = 1084 Score = 28.6 bits (56), Expect(2) = 1.1 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +2 / +1 Query: 1052 HGWNAWWLPWRNAWWFPWRYGW 1117 H W W R +WW+ W+ W Sbjct: 730 HYW*RWRPRPRGSWWWRWQTRW 795 Score = 24.4 bits (47), Expect(2) = 1.1 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 / +1 Query: 1106 RYGWYAWRNGGWFPWRNGWR 1165 R W++ R W WR WR Sbjct: 904 RSWWWSRRQPSWRWWRPWWR 963 Score = 34.1 bits (68), Expect = 3.3 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +2 / +1 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFP 1147 R GW W W +WW+ R + W W P Sbjct: 868 RRGWPWWRQCWGRSWWWSRRQPSWRWWRPWWRP 966 Score = 33.6 bits (67), Expect = 4.6 Identities = 14/45 (31%), Positives = 16/45 (35%) Frame = +2 / +1 Query: 1016 WWNARWLPIPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPW 1150 WW R P R+ +WW R W WR W W W Sbjct: 859 WWVRRGWPWWRQCWGRSWWWSRRQPSWRWWRPWWRPLWTRPWQRW 993
>LOC_Os07g41630:12007.t03818:unspliced-genomic expressed protein| Length = 861 Score = 30.4 bits (60), Expect(2) = 1.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 / +1 Query: 1208 RRYACRNGRRYAWNGRW*RNGRWY 1279 RR+ CR RR RW R RW+ Sbjct: 409 RRWRCRRRRRPGRRRRWGRRARWW 480 Score = 22.6 bits (43), Expect(2) = 1.1 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / +1 Query: 1271 RWYAWSWRCSR 1303 RW + SW CSR Sbjct: 550 RWRSPSWSCSR 582
>LOC_Os11g11480:12011.t01035:unspliced-genomic hypothetical protein| Length = 715 Score = 28.6 bits (56), Expect(2) = 1.1 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 / +3 Query: 1037 PIPRRHGWNAWWLPWRNAWWFPWRYGWY 1120 P RR W A W+P R WR W+ Sbjct: 429 PRQRRQPWRARWMPGRCRRGGGWRRCWW 512 Score = 24.4 bits (47), Expect(2) = 1.1 Identities = 7/23 (30%), Positives = 9/23 (39%) Frame = +2 / +3 Query: 1148 WRNGWRYARRNGRWYARRNGRRY 1216 W GWR RW G ++ Sbjct: 510 WTGGWRAVATTARWRQEAEGGQW 578
>LOC_Os10g34270:12010.t02725:unspliced-genomic expressed protein| Length = 1005 Score = 31.3 bits (62), Expect(2) = 1.1 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 / -2 Query: 1070 WLPWRNAWWFPWRYGWYAW 1126 W WR W +PW + W W Sbjct: 395 WRWWRLGWAWPWPWTWARW 339 Score = 25.8 bits (50), Expect(2) = 1.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 / -3 Query: 1423 RPTRRWDPSSPR*WPR*TGTGESPMSPRDR 1512 R RRW PR R GTGE P R R Sbjct: 262 RRRRRWGWGWPRRRRRKCGTGEPPRRGRRR 173
>LOC_Os06g14640:12006.t01339:unspliced-genomic ring-H2 zinc finger protein, putative| Length = 477 Score = 27.2 bits (53), Expect(2) = 1.1 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 / +2 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYA 1282 WR R + W R+ RR RR R R RW A Sbjct: 167 WRRPRASSEWRRRQRRRRCPTSRTRRPRAGRRRRRRRRWCA 289 Score = 25.8 bits (50), Expect(2) = 1.1 Identities = 7/21 (33%), Positives = 9/21 (42%) Frame = +2 / +2 Query: 1094 WFPWRYGWYAWRNGGWFPWRN 1156 W W W WR+ WR+ Sbjct: 14 WGRWLCSWLTWRSSCALSWRS 76
>LOC_Os04g52140:12004.t04690:unspliced-genomic protein kinase domain containing protein, expressed| Length = 5738 Score = 31.3 bits (62), Expect(2) = 1.2 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 / +1 Query: 1187 WYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR*C 1309 W R R A R RW R+GRW A S RC R C Sbjct: 1420 WGWTRTCGRCATLRRRTAGGCRRWWRSGRWTAASRRCWRWC 1542 Score = 28.1 bits (55), Expect(2) = 1.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 / +1 Query: 1548 VKCWKCPFAYPETCRCWLV 1604 +KC +C AY T CWLV Sbjct: 3109 LKCSRCAVAYDLTELCWLV 3165
>LOC_Os07g48229:12007.t04455:unspliced-genomic vacuolar sorting receptor 1 precursor, putative, expressed| Length = 10235 Score = 26.7 bits (52), Expect(2) = 1.2 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +2 / +2 Query: 1067 WWLPWRNAWWFPWR 1108 W +P + WW PWR Sbjct: 206 WGVPCCSWWWRPWR 247 Score = 25.8 bits (50), Expect(2) = 1.2 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = +2 / +2 Query: 1148 WRNGWRYARRNGRWYAR 1198 W WR RR G W+ R Sbjct: 230 WWRPWRGRRRGGSWWRR 280
>LOC_Os01g40094:12001.t03535:unspliced-genomic protein phosphatase 2C ABI2, putative, expressed| Length = 6348 Score = 28.1 bits (55), Expect(2) = 1.3 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +2 Query: 1136 GWFPWRNGWRYARRNGRWY 1192 GW WR WR RR W+ Sbjct: 128 GW*SWRLWWRVRRRRWWWW 184 Score = 24.4 bits (47), Expect(2) = 1.3 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / +2 Query: 1232 RRYAWNGRW*RNGRWYAWSWR 1294 RR+ W G R W W WR Sbjct: 167 RRWWWWGWGRRGLGWRTWRWR 229
>LOC_Os11g34870:12011.t03037:unspliced-genomic tubulin alpha-6 chain, putative, expressed| Length = 3718 Score = 35.4 bits (71), Expect = 1.3 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 / -2 Query: 1121 AWRNGGWFPWRNGWRYARRNGRW 1189 AWR G + W GWR R GRW Sbjct: 2499 AWRRGSFGWWAGGWRARRCAGRW 2431
>LOC_Os08g41980:12008.t03927:unspliced-genomic conserved hypothetical protein| Length = 222 Score = 35.4 bits (71), Expect = 1.3 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 / +2 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 WR + R GR R+ +CRN RR GRW Sbjct: 2 WRRSCRGGRRRGGRSAASRSCRNARRRRGRGRW 100
>LOC_Os07g35810:12007.t03255:unspliced-genomic serine/threonine kinase-like protein, putative, expressed| Length = 3639 Score = 35.4 bits (71), Expect = 1.3 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 / -3 Query: 1136 GWFPWRNGWRYARRNGRWYARRNGRRYACRNGR 1234 GW PW R + RW R+ RR +CR GR Sbjct: 376 GWRPWCGCRLAPRPSRRWCRSRSSRRGSCRRGR 278
>LOC_Os06g36590:12006.t03355:unspliced-genomic inner membrane protein ybaL, putative, expressed| Length = 8117 Score = 35.4 bits (71), Expect = 1.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 / +3 Query: 1109 YGWYAWRNGGWFPWRNGWRYARRNGRWYARR 1201 +GW+ R GW R WR + RW+ RR Sbjct: 210 WGWWRRRRCGWARRRRRWRAGKGTTRWWRRR 302
>LOC_Os06g12530:12006.t01129:unspliced-genomic nuclear migration protein nudC, putative, expressed| Length = 2848 Score = 35.4 bits (71), Expect = 1.3 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 / +1 Query: 1163 RYARRNGRWYARRNGRRYACRNGRR 1237 R+ RR GRW+ RR GRR R RR Sbjct: 322 RWRRRRGRWWRRRRGRRGRPRGRRR 396
>LOC_Os03g04110:12003.t00292:unspliced-genomic receptor-like GPI-anchored protein 2, putative, expressed| Length = 2849 Score = 35.4 bits (71), Expect = 1.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +2 / -1 Query: 1184 RWYARRNGRRYACRNGRRYAWNGR 1255 RW RR GRR ACR G R+ GR Sbjct: 365 RWNWRRRGRRKACRRGGRWRRGGR 294
>LOC_Os02g42470:12002.t03832:unspliced-genomic expressed protein| Length = 246 Score = 35.4 bits (71), Expect = 1.3 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 / +2 Query: 1091 WWFPWRYGWYAWRNGG 1138 WW WR GW WR GG Sbjct: 11 WWRRWRRGWSRWRAGG 58
>LOC_Os01g62570:12001.t05632:unspliced-genomic ATP binding protein, putative| Length = 6235 Score = 35.4 bits (71), Expect = 1.3 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +2 / -2 Query: 1115 WYAWRNGGWFPWRNGWRYARRNGRWYARRNGRR 1213 W WR + W G R +RR G W A R GRR Sbjct: 213 WRTWRRCRRW*WGCGRRSSRRGGGWGAVRGGRR 115
>LOC_Os01g23180:12001.t02045:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2530 Score = 35.4 bits (71), Expect = 1.3 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = +2 / +3 Query: 1169 ARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYA 1282 A R R RR+G R +G R A RW R RW+A Sbjct: 246 AARRARGARRRDGARRGSGDGTRAATGRRWRRRQRWFA 359
>LOC_Os09g25460:12009.t02225:unspliced-genomic anthranilate N-benzoyltransferase protein 1, putative, expressed| Length = 4440 Score = 30.4 bits (60), Expect(2) = 1.3 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = +2 / +3 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRW 1276 R RR RR R + R G W GRW R+ RW Sbjct: 210 RPRRRRRMRGRRRRRRGSSHRRGCGRRWRGRWCRSTRW 323 Score = 22.1 bits (42), Expect(2) = 1.3 Identities = 5/9 (55%), Positives = 5/9 (55%) Frame = +2 / +3 Query: 1070 WLPWRNAWW 1096 W WR WW Sbjct: 87 WRWWRRRWW 113
>LOC_Os01g68130:12001.t06169:unspliced-genomic expressed protein| Length = 3981 Score = 29.5 bits (58), Expect(2) = 1.3 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +2 / -3 Query: 1160 WRYARRNGRWYARRNGRRYACRNGRRYAWNGR 1255 WR R W +R GRR + RR GR Sbjct: 1450 WRRRRGRSSWTSRMGGRRSRAQRRRRAGGGGR 1355 Score = 23.1 bits (44), Expect(2) = 1.3 Identities = 6/14 (42%), Positives = 8/14 (57%) Frame = +2 / -2 Query: 1109 YGWYAWRNGGWFPW 1150 +G + W N GW W Sbjct: 1505 WGRFNWSNWGWIWW 1464
>LOC_Os02g26160:12002.t02310:unspliced-genomic carbohydrate binding protein, putative, expressed| Length = 3953 Score = 27.6 bits (54), Expect(2) = 1.3 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +2 / -2 Query: 1046 RRHGWNAWWLPWRNAWWFPWRYGW 1117 R HGW W + WR+GW Sbjct: 79 RSHGWRGHARRWSSRNRREWRWGW 8 Score = 24.9 bits (48), Expect(2) = 1.3 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = +2 / -1 Query: 995 PLIRRHAWWNARWLPIPRRHGWNAW 1069 P RH ARW R+ W AW Sbjct: 134 PTAWRHGDGAARWSHCVRKKPWMAW 60
>LOC_Os07g35740:12007.t03248:unspliced-genomic protein kinase, putative, expressed| Length = 3784 Score = 27.2 bits (53), Expect(2) = 1.3 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +2 / -3 Query: 1100 PWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGR 1234 P R G GW PW R W R+ RR + R GR Sbjct: 413 PPRSGCSTGCRRGWRPWCGCTPGRRPGRPWCRSRSSRRSSRRRGR 279 Score = 25.4 bits (49), Expect(2) = 1.3 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = +2 / -3 Query: 1016 WWNARWLPIPRRHGW 1060 W A W +PR GW Sbjct: 575 WRTASWCSLPRTSGW 531
>LOC_Os07g32020:12007.t02887:unspliced-genomic anthocyanidin 3-O-glucosyltransferase, putative, expressed| Length = 2402 Score = 31.8 bits (63), Expect(2) = 1.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 / +3 Query: 1151 RNGWRYARRNGRWYARRNGRRYACRNGRRYA 1243 R G A R RW R GRR CR +R A Sbjct: 1704 RGGTPAAARGARWATWRRGRRRRCRRSQRGA 1796 Score = 26.3 bits (51), Expect(2) = 1.3 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +2 / +1 Query: 1082 RNAWWFPWRYGW 1117 R+ WW PW + W Sbjct: 1219 RSRWWPPWAWPW 1254
>LOC_Os03g61280:12003.t05361:unspliced-genomic expressed protein| Length = 3355 Score = 29.0 bits (57), Expect(2) = 1.3 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / -3 Query: 1028 RWLPIPRRHGWNAWW 1072 RW PI RR G WW Sbjct: 2624 RWSPIARRPGRGGWW 2580 Score = 23.5 bits (45), Expect(2) = 1.3 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +2 / -3 Query: 1100 PWRYGWYAWRNGGWFPWRNGWRYAR 1174 P R GW+ R WR W +R Sbjct: 2600 PGRGGWWRSRRRRCGAWRRSWCRSR 2526
>LOC_Os10g35850:12010.t02875:unspliced-genomic membrane steroid-binding protein 1, putative, expressed| Length = 2488 Score = 32.7 bits (65), Expect(2) = 1.4 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 / +3 Query: 1405 PTWPSTRPTRRWDPSSPR*WPR*TGTGESP 1494 P WP R + RW P S R R G G SP Sbjct: 351 PRWPERRWSTRWGPVSSRRLLRRRGPGRSP 440 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = +2 / +3 Query: 1040 IPRRHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARR 1177 +P R W + L W +PW++ R G WR R+ R Sbjct: 231 VPPRLAWGFFSLGKI*RWPWPWQWRSCGRRRGARRRWR*SPRWPER 368
>LOC_Os01g64840:12001.t05850:unspliced-genomic aspartic proteinase nepenthesin-1 precursor, putative, expressed| Length = 1849 Score = 28.1 bits (55), Expect(2) = 1.4 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 / -1 Query: 1157 GWRYARRNGRWYARRNGRRYACRNGRR 1237 GWR + W RR G CR RR Sbjct: 805 GWRGCGWSAAWRRRRRG*SSGCRRSRR 725 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +2 / -1 Query: 1112 GWYAWRNGGW 1141 GW WR GW Sbjct: 829 GWRRWRGAGW 800
>LOC_Os01g12640:12001.t01130:unspliced-genomic expressed protein| Length = 1729 Score = 30.4 bits (60), Expect(2) = 1.4 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +2 / +1 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNG 1270 R R+ GR + R R RR+ W RW R G Sbjct: 133 RGCRQQGRRRGGHHHSRVGVRGRRRWGWGWRWRRGG 240 Score = 22.1 bits (42), Expect(2) = 1.4 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 / +3 Query: 1250 GRW*RNGRWYAWSWRC 1297 GRW R WS RC Sbjct: 234 GRWMTTRRSLTWSSRC 281
>LOC_Os08g43500:12008.t04075:unspliced-genomic armadillo/beta-catenin-like repeat family protein, expressed| Length = 2540 Score = 30.4 bits (60), Expect(2) = 1.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / -2 Query: 1094 WFPWRYGWYAWRNGG 1138 W PWR+ W+ WR G Sbjct: 1222 WPPWRWWWWWWRRRG 1178 Score = 27.6 bits (54), Expect(2) = 1.4 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 / -2 Query: 1172 RRNGRWYARRNGRRYACRNGRRYAWNGRW 1258 RR R GRR A R GR +A +GRW Sbjct: 700 RRRAPPGCRCRGRRSAPR*GRGWARSGRW 614
>LOC_Os10g34370:12010.t02735:unspliced-genomic expressed protein| Length = 1492 Score = 28.6 bits (56), Expect(2) = 1.4 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 / -1 Query: 1046 RRHGWNAWWLPWRNAWW 1096 RR G W WR WW Sbjct: 166 RRAGGRGWGSAWRRGWW 116 Score = 24.0 bits (46), Expect(2) = 1.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 / -1 Query: 1121 AWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNG 1231 AWR G W R RR R GRR A G Sbjct: 136 AWRRGWWGSRRAAAGDRRRGARRSGGGGGRRGAGGGG 26 Score = 33.1 bits (66), Expect = 6.3 Identities = 19/49 (38%), Positives = 20/49 (40%) Frame = +2 / -1 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNG 1252 R G A G WR GW +RR RR RR GRR A G Sbjct: 175 RRGRRAGGRGWGSAWRRGWWGSRRAAAGDRRRGARRSGGGGGRRGAGGG 29
>LOC_Os11g36110:12011.t03158:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5088 Score = 33.1 bits (66), Expect(2) = 1.4 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +2 / +2 Query: 1031 WLPIPRRHGWNAWWLPWRNAWWFPWRYGW 1117 W I R W W WR WWF + W Sbjct: 1601 W*GIDSRRAWWNSWWIWRRPWWFWGKSWW 1687 Score = 25.8 bits (50), Expect(2) = 1.4 Identities = 14/45 (31%), Positives = 18/45 (40%) Frame = +3 / +3 Query: 1494 HEPS*PTVLRSAAGQKTLVKCWKCPFAYPETCRCWLVILACRGAC 1628 +E S TV+ A Q + W C F CW V +C C Sbjct: 2949 YEVSCRTVIG*ARVQGSSKGVWLCLFCARSPTFCWQVRSSCSKVC 3083
>LOC_Os02g18750:12002.t01668:unspliced-genomic expressed protein| Length = 959 Score = 30.4 bits (60), Expect(2) = 1.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 / -2 Query: 1136 GWFPWRNGWRYARR 1177 GW PWR GW RR Sbjct: 352 GWRPWRGGWTARRR 311 Score = 22.1 bits (42), Expect(2) = 1.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 / -1 Query: 1025 ARWLPIPRR 1051 ARW P PRR Sbjct: 512 ARWCPAPRR 486
>LOC_Os05g40710:12005.t03610:unspliced-genomic DELLA protein GAI, putative| Length = 1482 Score = 33.6 bits (67), Expect(2) = 1.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 / +2 Query: 1100 PWRYGWYAWRNGGWFPWR 1153 PWR GW+ + W PWR Sbjct: 491 PWRRGWWGRGSASWRPWR 544 Score = 23.5 bits (45), Expect(2) = 1.6 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 / +2 Query: 1405 PTWPSTRPTRRWDPSS 1452 PTW +TRP+ R +S Sbjct: 617 PTWRATRPSSRRSTAS 664
>LOC_Os10g06730:12010.t00540:unspliced-genomic spidroin 1, putative| Length = 792 Score = 31.3 bits (62), Expect(2) = 1.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 / +1 Query: 1196 RRNGRRYACRNGRRYAWNGRW*RNGRWYA 1282 RR+G R+ +G R A RW R RW A Sbjct: 304 RRDGARHGSGDGTRAATGRRWRRRQRWRA 390 Score = 24.9 bits (48), Expect(2) = 1.6 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +1 / +2 Query: 514 KQRARQWKQCQKGNW 558 ++R R+W +KG+W Sbjct: 176 RERRREWSGVEKGDW 220
>LOC_Os06g02970:12006.t00190:unspliced-genomic conserved hypothetical protein| Length = 588 Score = 31.8 bits (63), Expect(2) = 1.6 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = +2 / +3 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWS 1288 R RR GR R RRY R+ GR R RW WS Sbjct: 321 RRCRRQGRPRRGRRPRRYRWPRRGRWLRRGRRPRQERWPRWS 446 Score = 24.0 bits (46), Expect(2) = 1.6 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 / +3 Query: 1100 PWRYGWYAWRNGGWFPWR 1153 P R W R W+PWR Sbjct: 57 PTRRTWPTGRARPWWPWR 110
>LOC_Os01g56000:12001.t05009:unspliced-genomic RNA recognition motif family protein, expressed| Length = 9554 Score = 29.9 bits (59), Expect(2) = 1.6 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 / -1 Query: 1091 WWFPWRYGWYAWRNGGW 1141 WW+ W +GWY + W Sbjct: 6437 WWWRWWWGWYILTSKWW 6387 Score = 22.1 bits (42), Expect(2) = 1.6 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +2 / -1 Query: 1016 WWNARWL 1036 WW+ RWL Sbjct: 6470 WWHRRWL 6450
>LOC_Os03g58230:12003.t05083:unspliced-genomic plant-specific domain TIGR01615 family protein, expressed| Length = 2266 Score = 34.1 bits (68), Expect(2) = 1.7 Identities = 17/39 (43%), Positives = 19/39 (48%) Frame = +2 / +2 Query: 1184 RWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCS 1300 RW ARR G + +GR W GR R GR RCS Sbjct: 1133 RWSARR*GSLWRWTSGRSSRWRGRPRRTGRRCRRCRRCS 1249 Score = 23.5 bits (45), Expect(2) = 1.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 / +1 Query: 1094 WFPWRYGWYAWRNGGW 1141 W P R+G AW + W Sbjct: 496 WRPGRWGSTAWCSASW 543
>LOC_Os02g25960:12002.t02290:unspliced-genomic protein binding protein, putative, expressed| Length = 5678 Score = 28.1 bits (55), Expect(2) = 1.7 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 / +1 Query: 1100 PWRYGWYAWRNGGWFPWRNGWR 1165 P W G W PWR WR Sbjct: 184 PLSVSWRLPYGGTW*PWRRAWR 249 Score = 24.0 bits (46), Expect(2) = 1.7 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 / +2 Query: 1205 GRRYACRNGRRY 1240 GRR CR+GRR+ Sbjct: 248 GRRRRCRSGRRH 283
>LOC_Os01g07070:12001.t00587:unspliced-genomic loricrin, putative, expressed| Length = 5483 Score = 28.1 bits (55), Expect(2) = 1.7 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +2 / +1 Query: 1079 WRNAWWFPWRYGWYAWRNGGW 1141 WR + W + W WR GW Sbjct: 361 WRRRERWGWGWRWPRWRREGW 423 Score = 24.0 bits (46), Expect(2) = 1.7 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 / +1 Query: 977 EGRIIKPLIRRHAWWNARWLPIPRRHGWNAW 1069 EGR + R WW RW+ R W W Sbjct: 211 EGRWRRRRGRIWWWWCGRWIWWWWRRIWRRW 303 Score = 34.1 bits (68), Expect = 3.3 Identities = 24/67 (35%), Positives = 27/67 (40%) Frame = +2 / +1 Query: 1106 RYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAW 1285 R W+ W+ WR WR RR R + R RR R RR G R RW Sbjct: 238 RIWWWWCGRWIWWWWRRIWRRWRRVRRRW*RWRWRRRLRRRWRRRERWGWGWRWPRWRRE 417 Query: 1286 SWRCSR* 1306 WR R* Sbjct: 418 GWRT*R* 438
>LOC_Os09g36220:12009.t03098:unspliced-genomic two-component response regulator-like PRR95, putative, expressed| Length = 4673 Score = 27.2 bits (53), Expect(2) = 1.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 / +3 Query: 1067 WWLPWRNAWWFPWRYG 1114 W + WR W+ WR G Sbjct: 189 WGVEWRRGRWWTWRTG 236 Score = 24.9 bits (48), Expect(2) = 1.7 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 / +3 Query: 1163 RYARRNGRWYARRNGRRYACRNGR 1234 R R RW R GRR CR R Sbjct: 243 RKGRMRRRWRRGRAGRRGCCRGCR 314 Score = 33.1 bits (66), Expect = 6.3 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +2 / +3 Query: 1124 WRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRR 1237 WR G W+ WR G R R + R R C G R Sbjct: 201 WRRGRWWTWRTGTGRKGRMRRRWRRGRAGRRGCCRGCR 314
>LOC_Os09g17110:12009.t01498:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass, expressed| Length = 4653 Score = 29.9 bits (59), Expect(2) = 1.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 / -3 Query: 1244 WNGRW*RNGRWYAWSWRCSR 1303 WN RW R+ R +WRC R Sbjct: 2674 WNSRWRRSLRCRGRTWRCRR 2615 Score = 22.1 bits (42), Expect(2) = 1.7 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +2 / -3 Query: 1124 WRNGGWFPWRNGWRYARRNGRW 1189 WR W WR R R RW Sbjct: 2782 WRCHVWCRWRCRRRLRCRGRRW 2717
>LOC_Os12g06060:12012.t00492:unspliced-genomic high-affinity cationic amino acid transporter 1, putative, expressed| Length = 6504 Score = 35.0 bits (70), Expect = 1.8 Identities = 18/54 (33%), Positives = 22/54 (40%) Frame = +2 / +2 Query: 1049 RHGWNAWWLPWRNAWWFPWRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGR 1210 R W + W + W WR R W R +RR+GRW RR GR Sbjct: 6116 RSCWPSPWWRSASRWCGSWRRAAGPGRGCWWRAARRPPPPSRRSGRWCRRRGGR 6277
>LOC_Os11g03620:12011.t00253:unspliced-genomic expressed protein| Length = 1882 Score = 35.0 bits (70), Expect = 1.8 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +2 / +3 Query: 1103 WRYGWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNG 1231 W +WR+GG P + WR RR R R G + R G Sbjct: 105 WNREGISWRSGGQSPSLSRWRPRRRRRRRRRRMGGEQLVVRTG 233
>LOC_Os08g39550:12008.t03687:unspliced-genomic polygalacturonase inhibitor 2 precursor, putative, expressed| Length = 1673 Score = 35.0 bits (70), Expect = 1.8 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = -3 / +3 Query: 1791 RLLHQIINRELLSHRLRKTLKHPQTVGHR 1705 RLLHQ++ REL SH + HP G R Sbjct: 231 RLLHQLVRRELRSHHRPRRRPHPPRRGRR 317
>LOC_Os08g33440:12008.t03085:unspliced-genomic dihydrolipoyllysine-residue acetyltransferase component of| pyruvatedehydrogenase complex, putative, expressed Length = 3536 Score = 35.0 bits (70), Expect = 1.8 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +2 / -2 Query: 1112 GWYAWRNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNG 1231 G + R GG R R+ RR GR + R GRR CR G Sbjct: 490 GPWRGRPGGRPRTRRAARWGRRRGRTHRRGRGRRRRCRRG 371
>LOC_Os07g24150:12007.t02112:unspliced-genomic hypothetical protein| Length = 717 Score = 35.0 bits (70), Expect = 1.8 Identities = 19/47 (40%), Positives = 20/47 (42%) Frame = +2 / -3 Query: 1163 RYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGRWYAWSWRCSR 1303 R RR R ARR R C RR W G R G W A W +R Sbjct: 328 RRRRRRSRGCARRR*RPP*CAGRRRSPWRGPGGRAGGWSAGPWGPAR 188
>LOC_Os07g13310:12007.t01198:unspliced-genomic hypothetical protein| Length = 1046 Score = 35.0 bits (70), Expect = 1.8 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 / +3 Query: 1145 PWRNGWRYARRNGRWYARRNGRRYACRNGRRYAWNGRW*RNGR 1273 P R+ + GRW+A R R C R + WN R +GR Sbjct: 42 PCRSPCPHHHPGGRWWATRRLHRLRCHEQRPHPWNSRVQPSGR 170
>LOC_Os07g03260:12007.t00216:unspliced-genomic CSLC10 - cellulose synthase-like family C| Length = 2721 Score = 35.0 bits (70), Expect = 1.8 Identities = 18/39 (46%), Positives = 20/39 (51%) Frame = +2 / -3 Query: 1127 RNGGWFPWRNGWRYARRNGRWYARRNGRRYACRNGRRYA 1243 R G P R+G RR GR + R GRR R GRR A Sbjct: 484 RRRGSAPTRSGTSRRRRRGRVHGRWRGRRARRRGGRRTA 368 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 582,645,619 Number of extensions: 10450355 Number of successful extensions: 72090 Number of sequences better than 10.0: 506 Length of query: 614 Length of database: 55,613,886 Length adjustment: 51 Effective length of query: 563 Effective length of database: 52,743,708 Effective search space: 29694707604 Effective search space used: 29694707604 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
