| Clone Name | FLbaf62h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P20863:GDF1_MOUSE Embryonic growth/differentiation factor 1 prec... | 31 | 6.8 | 2 | O74419:YQ52_SCHPO Uncharacterized protein C162.02c - Schizosacch... | 30 | 8.8 | 3 | Q8BTI8:SRRM2_MOUSE Serine/arginine repetitive matrix protein 2 -... | 30 | 8.8 |
|---|
>P20863:GDF1_MOUSE Embryonic growth/differentiation factor 1 precursor - Mus musculus| (Mouse) Length = 357 Score = 30.8 bits (68), Expect = 6.8 Identities = 26/85 (30%), Positives = 30/85 (35%), Gaps = 15/85 (17%) Frame = +2 Query: 218 ESGRRGRCRGR--HTSSPSKGWEEIRRGWTPAPRG-------------ATSRAPEGMTAR 352 E G G CR R H S GW W APRG T R P G A Sbjct: 244 EVGPVGTCRTRRLHVSFREVGWHR----WVIAPRGFLANFCQGTCALPETLRGPGGPPAL 299 Query: 353 SRSMQWLNRQARRPSSGDWQPGCTP 427 + ++ A P+ G P C P Sbjct: 300 NHAVLRALMHAAAPTPGAGSPCCVP 324
>O74419:YQ52_SCHPO Uncharacterized protein C162.02c - Schizosaccharomyces pombe| (Fission yeast) Length = 981 Score = 30.4 bits (67), Expect = 8.8 Identities = 21/66 (31%), Positives = 31/66 (46%) Frame = +1 Query: 10 SIVYRRPAHTSSKRAQREVEEDTDARGEMGSRLDARTLKDEVASMDRRPLLDLGHPLLNR 189 S++ + + S Q+EVE D D + S L VA + R + DLGHPL+ Sbjct: 761 SVMGPKALYFISGGGQQEVELDDDTQSAKAS---GYALSKYVAELLCRKISDLGHPLIYV 817 Query: 190 VADSFI 207 + FI Sbjct: 818 IRPGFI 823
>Q8BTI8:SRRM2_MOUSE Serine/arginine repetitive matrix protein 2 - Mus musculus (Mouse)| Length = 2703 Score = 30.4 bits (67), Expect = 8.8 Identities = 33/104 (31%), Positives = 43/104 (41%), Gaps = 11/104 (10%) Frame = +2 Query: 221 SGRRGRCRGRH--TSSPSKGWEEIRRGW----TPAPRGATSRAPEGMTARSRSMQWLNRQ 382 S RRGR R T S+ RRG TPA R + SR P +RSR+ R Sbjct: 553 SARRGRSHSRSPATRGRSRSRTPARRGRSRSRTPARRRSRSRTPARRRSRSRTPARRGRS 612 Query: 383 ARRPSSGDWQPGCTPG*RTA*ERPEGTMTGRT-----AR*QGRS 499 R + +P R + R + +GR+ AR GRS Sbjct: 613 RSRTPTRRRSRTRSPVRRRSRSRSQARRSGRSRSRTPARRSGRS 656 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 125,237,808 Number of extensions: 2678617 Number of successful extensions: 7782 Number of sequences better than 10.0: 3 Number of HSP's gapped: 7772 Number of HSP's successfully gapped: 3 Length of query: 275 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 163 Effective length of database: 69,965,399 Effective search space: 11404360037 Effective search space used: 11404360037 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)