| Clone Name | FLbaf70g18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P20721:CYSPL_SOLLC Low-temperature-induced cysteine proteinase p... | 34 | 0.83 | 2 | Q827G1:GLPK2_STRAW Glycerol kinase 2 - Streptomyces avermitilis | 31 | 5.4 | 3 | Q9QYY8:SPAST_MOUSE Spastin - Mus musculus (Mouse) | 31 | 7.1 | 4 | Q63003:5E5_RAT 5E5 antigen - Rattus norvegicus (Rat) | 26 | 7.3 |
|---|
>P20721:CYSPL_SOLLC Low-temperature-induced cysteine proteinase precursor - Solanum| lycopersicum (Tomato) (Lycopersicon esculentum) Length = 346 Score = 33.9 bits (76), Expect = 0.83 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -1 Query: 183 PPRPTGAPRSPAKPSPDVGGFFSCRVGSPFLAGLCFLRRVLCW 55 PP+P +P SP KP + + C VG+ L F R W Sbjct: 239 PPKPAPSPPSPVKPPTECDEYSQCAVGTTCCCILQFRRSCFSW 281
>Q827G1:GLPK2_STRAW Glycerol kinase 2 - Streptomyces avermitilis| Length = 507 Score = 31.2 bits (69), Expect = 5.4 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 2/75 (2%) Frame = -3 Query: 556 SWKA-ETGKARPRPAGVRKTILVPEGLMTISEMVTQMSSSLLLTPVMLCIRPR-STTAVT 383 SW+ E A + +GVR T L +G MT + ++ Q + +L PV IRPR S T Sbjct: 389 SWQTREVVDAMYQDSGVRITTLKVDGGMTKNNLLMQHQADVLGVPV---IRPRVSETTCL 445 Query: 382 SGAYQTCLPMASKVW 338 AY L A+ VW Sbjct: 446 GAAYAAGL--ATGVW 458
>Q9QYY8:SPAST_MOUSE Spastin - Mus musculus (Mouse)| Length = 614 Score = 30.8 bits (68), Expect = 7.1 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = -1 Query: 195 SPCAPPRPTGAPRSPAKPSPDVGG---FFSCRVGSPFLAGLCFLRRVLCWRRSVAAFMC 28 +P PP P P A P+P G SP + G LR + C + A++C Sbjct: 19 APARPPPPAAVPAPAAGPAPAAGSPPKRNPSSFSSPLVVGFALLRLLACHLGLLFAWLC 77
>Q63003:5E5_RAT 5E5 antigen - Rattus norvegicus (Rat)| Length = 825 Score = 25.8 bits (55), Expect(2) = 7.3 Identities = 12/21 (57%), Positives = 12/21 (57%), Gaps = 2/21 (9%) Frame = -1 Query: 192 PCAPPRPT--GAPRSPAKPSP 136 P APP P GAPR P P P Sbjct: 157 PRAPPEPPDPGAPRPPPDPGP 177 Score = 23.5 bits (49), Expect(2) = 7.3 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 Query: 127 GFLLLPGWFSFPCWALFLATRSLLEEIGGC 38 G L LPG P + + ++T LL GGC Sbjct: 176 GPLPLPGSQEKPTFVVQVSTEQLLMSTGGC 205 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 127,873,266 Number of extensions: 2665252 Number of successful extensions: 12183 Number of sequences better than 10.0: 4 Number of HSP's gapped: 12136 Number of HSP's successfully gapped: 5 Length of query: 282 Length of database: 100,686,439 Length adjustment: 112 Effective length of query: 170 Effective length of database: 69,965,399 Effective search space: 11894117830 Effective search space used: 11894117830 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)