| Clone Name | FLbaf67a23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q09209:SRA7_CAEEL Serpentine receptor class alpha-7 - Caenorhabd... | 30 | 7.9 |
|---|
>Q09209:SRA7_CAEEL Serpentine receptor class alpha-7 - Caenorhabditis elegans| Length = 329 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = -1 Query: 568 FFFFCVLLIHRRRINQVASSVDGRSNLITARTHELL 461 F +F V ++H++ I Q+++ + NL++A H+LL Sbjct: 37 FSYFAVKIVHQKSIFQLSTKILLFHNLVSANLHQLL 72 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 67,074,741 Number of extensions: 1161643 Number of successful extensions: 2122 Number of sequences better than 10.0: 1 Number of HSP's gapped: 2121 Number of HSP's successfully gapped: 1 Length of query: 191 Length of database: 100,686,439 Length adjustment: 107 Effective length of query: 84 Effective length of database: 71,336,874 Effective search space: 5992297416 Effective search space used: 5992297416 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)