| Clone Name | FLbaf70b04 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os08g37580:12008.t03495:unspliced-genomic homeobox-leucine zipper protein ATHB-6, putative, expressed| Length = 2069 Score = 31.3 bits (62), Expect = 1.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 / +1 Query: 78 KQGLF*NFCKSRFYPVLFCQ 137 ++G NFCK + Y VLFCQ Sbjct: 1504 RRGFSANFCKMKLYLVLFCQ 1563
>LOC_Os06g12820:12006.t01158:unspliced-genomic expressed protein| Length = 2781 Score = 30.9 bits (61), Expect = 1.9 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +1 / +3 Query: 64 KISEESRGFSEIFVNLVFIPSFSVKPSPSLG 156 +IS E GF +IFVNLV S SVK S + G Sbjct: 1467 QISPEIFGFLQIFVNLVKFYSNSVKFSNNFG 1559 Score = 28.6 bits (56), Expect = 8.9 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 / -3 Query: 143 EGLTEKDGIKTRFTKISEKPLLSSLI 66 E LTE + TRFTKI +KP +S I Sbjct: 1546 ENLTEFE*NLTRFTKICKKPKISGEI 1469
>LOC_Os12g03340:12012.t00227:unspliced-genomic expressed protein| Length = 8301 Score = 30.4 bits (60), Expect = 2.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 / +3 Query: 144 RGFDRKGRDKNEIYKNFRKAPAFFTNLLFP 55 + ++ R+K + YK K FFTN+LFP Sbjct: 2886 KDLQKEEREKIQNYKGMIKYNNFFTNILFP 2975
>LOC_Os11g07540:12011.t00645:unspliced-genomic hypothetical protein| Length = 1792 Score = 29.5 bits (58), Expect = 4.8 Identities = 16/24 (66%), Positives = 16/24 (66%) Frame = +1 / -3 Query: 67 ISEESRGFSEIFVNLVFIPSFSVK 138 IS GFS IFVNLV I S SVK Sbjct: 1448 ISTRILGFSHIFVNLVKI*SNSVK 1377
>LOC_Os01g09560:12001.t00834:unspliced-genomic mitochondrial-processing peptidase alpha subunit, mitochondrial| precursor, putative, expressed Length = 5361 Score = 29.0 bits (57), Expect = 6.5 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 / -2 Query: 152 SDGEGLTEKDGIKTRFTKISEKPLLSS 72 S+ EG+T + IKT+ ISEK + SS Sbjct: 608 SNNEGMTNPEPIKTQHNPISEKCMPSS 528
>LOC_Os09g29460:12009.t02624:unspliced-genomic homeobox-leucine zipper protein ATHB-6, putative, expressed| Length = 1723 Score = 28.6 bits (56), Expect = 8.9 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 / -1 Query: 107 FTKISEKPLLSSLIFYSPR 51 F KI++K LLS I YSPR Sbjct: 1501 FYKIADKTLLSCRILYSPR 1445
>LOC_Os01g37580:12001.t03300:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 12132 Score = 28.6 bits (56), Expect = 8.9 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 / +1 Query: 98 ISEKPLLSSLIFYSPREVSS 39 +SEKP SS IF+SP +S+ Sbjct: 10840 VSEKPSFSSFIFFSPFFIST 10899
>LOC_Os01g37120:12001.t03260:unspliced-genomic nucleotide binding protein, putative, expressed| Length = 5221 Score = 28.6 bits (56), Expect = 8.9 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 / +1 Query: 122 GIKTRFTKISEKPLLSSLIFYS 57 G TRF + PL+SS++FYS Sbjct: 2638 GFCTRFAAMFNYPLISSVLFYS 2703
>LOC_Os01g53020:12001.t04727:unspliced-genomic electron transporter/ heat shock protein binding protein, putative,| expressed Length = 2613 Score = 28.6 bits (56), Expect = 9.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 / +2 Query: 159 AA*RWRGFDRKGRDKNEIYK 100 AA RWR + RKG DK +K Sbjct: 2234 AARRWREYSRKGADKPPTFK 2293 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 51,322,674 Number of extensions: 424505 Number of successful extensions: 1639 Number of sequences better than 10.0: 9 Length of query: 78 Length of database: 55,613,886 Length adjustment: 44 Effective length of query: 34 Effective length of database: 53,137,654 Effective search space: 1806680236 Effective search space used: 1806680236 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)