| Clone Name | FLbaf61n17 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os07g47140:12007.t04350:unspliced-genomic CCT motif family protein, expressed| Length = 3050 Score = 30.4 bits (60), Expect(2) = 0.14 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -3 / +2 Query: 613 WSTPFDKYALHISSLISRVAYSSMCFGLN*MWECPTTSNGTNSLFNI 473 WS +++ A + SL + ++ C GL + P+ G+NS F + Sbjct: 587 WSASWEEEAPQVLSLDDIIVPTTSCHGLRPLLTPPSPEVGSNSAFTV 727 Score = 28.1 bits (55), Expect(2) = 0.14 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 / +1 Query: 387 HVVASVWLICSLNCCLCHS 331 H+V V ICS+ C LC+S Sbjct: 1804 HIVLVVIFICSVKCDLCNS 1860
>LOC_Os03g19380:12003.t01704:unspliced-genomic CP12-2, putative, expressed| Length = 977 Score = 33.6 bits (67), Expect = 1.5 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 / -1 Query: 173 GDVLMLEVGPGGGATVGRCW*WIPVRMWIGWVYLVLP 283 G+ + E G GG++ W W P R W+ W++L P Sbjct: 137 GEPVA*EPGAPGGSSEPGRWPWRPRRGWLPWLWLPAP 27
>LOC_Os08g05520:12008.t00446:unspliced-genomic myb-like DNA-binding domain containing protein, expressed| Length = 2851 Score = 32.7 bits (65), Expect = 2.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 / +1 Query: 223 PHCRPPSWSDLQHQHVALE 167 PHC+PP+W D Q LE Sbjct: 1579 PHCQPPAWPDRQRDQELLE 1635
>LOC_Os03g01560:12003.t00051:unspliced-genomic hypothetical protein| Length = 351 Score = 32.7 bits (65), Expect = 2.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 / +1 Query: 360 CSLNCCLCHSRSFIDSSSLGLGFFEFG 280 C + C LCH R ++ + GLGF G Sbjct: 100 CQIYCALCHHRFLVELARSGLGFVGSG 180
>LOC_Os02g12570:12002.t01054:unspliced-genomic pre-mRNA cleavage complex II protein Clp1, putative, expressed| Length = 4377 Score = 32.2 bits (64), Expect = 3.8 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -2 / +3 Query: 275 PDRPTQSTSSPVSITSNAPLSPP 207 P RP+ S SSP S+AP SPP Sbjct: 186 PTRPSASASSPARRRSSAPSSPP 254
>LOC_Os01g29190:12001.t02609:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1385 Score = 32.2 bits (64), Expect = 3.8 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = +3 / +3 Query: 96 NDEGWRRLGEALQVGL 143 NDEGWRR G A+++GL Sbjct: 909 NDEGWRRKGVAIKLGL 956
>LOC_Os07g22430:12007.t01947:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6828 Score = 31.8 bits (63), Expect = 5.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 / +1 Query: 236 WIPVRMWIGWVYLVLPNSKKPRP 304 W+ W+G ++L LP SK P P Sbjct: 3973 WVLANSWVGPLFLGLPRSKTPSP 4041
>LOC_Os07g11240:12007.t00998:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7329 Score = 31.8 bits (63), Expect = 5.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 / +1 Query: 236 WIPVRMWIGWVYLVLPNSKKPRP 304 W+ W+G ++L LP SK P P Sbjct: 4882 WVLANSWVGPLFLGLPRSKTPSP 4950
>LOC_Os01g15934:12001.t01444:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 4579 Score = 31.8 bits (63), Expect = 5.2 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 / -3 Query: 257 IGWVYLVLPNSKKPRPRLLLSMKLRLWQR 343 IG + + L NSK R +LL + K+ LWQR Sbjct: 1397 IGKL*MQLKNSKTNRQKLLKTTKIELWQR 1311
>LOC_Os12g18090:12012.t01660:unspliced-genomic hypothetical protein| Length = 2717 Score = 27.2 bits (53), Expect(2) = 6.1 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 / -2 Query: 360 CSLNCCLCHSRSFI 319 CS +CC+C+ SFI Sbjct: 2317 CSFSCCICNIVSFI 2276 Score = 25.4 bits (49), Expect(2) = 6.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 / -3 Query: 266 PTQSTSSPVSITSNAPLSPP 207 P STSSPV AP+ PP Sbjct: 882 PLSSTSSPVFPQKPAPVWPP 823
>LOC_Os10g36580:12010.t02937:unspliced-genomic expressed protein| Length = 1154 Score = 31.3 bits (62), Expect = 7.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 / -1 Query: 433 ARRLEEDTTCCWSSVSC 383 ARR E TCCW S +C Sbjct: 734 ARRSESSLTCCWYSTAC 684
>LOC_Os09g37920:12009.t03266:unspliced-genomic ATP binding protein, putative, expressed| Length = 7750 Score = 31.3 bits (62), Expect = 7.1 Identities = 15/28 (53%), Positives = 15/28 (53%) Frame = +3 / -1 Query: 105 GWRRLGEALQVGLAEGAIVRGSRATC*C 188 G RR G A G A A RG RATC C Sbjct: 295 GRRRAGHAAGSGAARRARSRGGRATCRC 212
>LOC_Os06g27670:12006.t02472:unspliced-genomic conserved hypothetical protein| Length = 1374 Score = 31.3 bits (62), Expect = 7.1 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -2 / -1 Query: 161 HYRPLR*PDLQCLPQTPP 108 HYRP R*P Q LPQ PP Sbjct: 1074 HYRPGR*PRHQRLPQLPP 1021
>LOC_Os02g43660:12002.t03950:unspliced-genomic blue copper protein precursor, putative, expressed| Length = 1910 Score = 31.3 bits (62), Expect = 7.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -2 / -3 Query: 269 RPTQSTSSPVSITSNAPLSPPLL 201 RPT TS P++ ++ PL+PP+L Sbjct: 1698 RPTAPTSRPITERASLPLAPPVL 1630
>LOC_Os02g28400:12002.t02534:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 9765 Score = 31.3 bits (62), Expect = 7.1 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 / -2 Query: 257 IGWVYLVLPNSKKPRPRLLLSMKLRLWQR 343 +G Y+ L NSK R +LL S K+ WQR Sbjct: 1508 LGKPYMQLDNSKTNR*KLLKSTKIEPWQR 1422
>LOC_Os10g17724:12010.t01329:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6460 Score = 27.6 bits (54), Expect(2) = 7.1 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 / -3 Query: 492 PIPYSTFQVSNFN*HIKGK 436 P+PY TFQ SNF+ GK Sbjct: 4094 PLPYHTFQRSNFDLSNHGK 4038 Score = 25.8 bits (50), Expect(2) = 7.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 / -2 Query: 396 RRFHVVASVWLICSLNCCLCHSRSFIDSSSL 304 R F S+W I SL+C + + S + S L Sbjct: 2082 RSFFFSGSLWSITSLHCSVSFTTSVVGSGLL 1990
>LOC_Os02g22800:12002.t02067:unspliced-genomic conserved hypothetical protein| Length = 6553 Score = 27.6 bits (54), Expect(2) = 9.6 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 / +1 Query: 613 WSTPFDKYALHISSLISRVAYSSMCFG 533 +++P Y LHIS + YSS C G Sbjct: 2701 YNSPTTSYILHISFIKFNTPYSSTCNG 2781 Score = 25.4 bits (49), Expect(2) = 9.6 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -2 / +3 Query: 275 PDRPTQSTSSPVSITSNAPLS 213 PDRPT S SP ++ PLS Sbjct: 2787 PDRPTLSLPSPPLSHASPPLS 2849
>LOC_Os11g14280:12011.t01259:unspliced-genomic transposon protein, putative, unclassified| Length = 6360 Score = 30.9 bits (61), Expect = 9.8 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 / -2 Query: 652 FPKRVPGKS*PYKWSTPFDKYALHISSLIS 563 FP G *P W P DKY+L +SL+S Sbjct: 434 FPINFCGYL*PIGWHGPLDKYSLLTASLMS 345
>LOC_Os11g14270:12011.t01258:unspliced-genomic transposon protein, putative, unclassified| Length = 4331 Score = 30.9 bits (61), Expect = 9.8 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 / -3 Query: 652 FPKRVPGKS*PYKWSTPFDKYALHISSLIS 563 FP G *P W P DKY+L +SL+S Sbjct: 1956 FPINFCGYL*PIGWHGPLDKYSLLTASLMS 1867
>LOC_Os08g33830:12008.t03124:unspliced-genomic polypyrimidine tract-binding protein homolog 1, putative, expressed| Length = 5783 Score = 30.9 bits (61), Expect = 9.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 / -2 Query: 278 LPNSKKPRPRLLLSMKLRLWQRQQFSEQ 361 LP+ P P ++L LWQRQ+++E+ Sbjct: 1741 LPSDLDPDPSCCCLLQLNLWQRQRWTER 1658
>LOC_Os08g02904:12008.t04333:unspliced-genomic expressed protein| Length = 9396 Score = 30.9 bits (61), Expect = 9.8 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 / -2 Query: 596 QICPSHFISNF*SCI 552 QICP HFISNF S I Sbjct: 4010 QICPPHFISNFRSII 3966
>LOC_Os02g45750:12002.t04162:unspliced-genomic protein kinase, putative, expressed| Length = 3602 Score = 30.9 bits (61), Expect = 9.8 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 / -1 Query: 272 LVLPNSKKPRPRLLLSMKLRLWQRQQFSEQINQTE 376 LVL +SK P+ L+ S+ +L R QFS +I + E Sbjct: 1430 LVLVSSKTPKQLLIRSVSSKLAIRSQFSGKIQEKE 1326
>LOC_Os07g47580:12007.t04591:unspliced-genomic TGF-beta-inducible nuclear protein 1, putative, expressed| Length = 2648 Score = 30.9 bits (61), Expect = 9.8 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -1 / +2 Query: 384 VVASVWLICSLNCCLCHS 331 ++ +WL+CS++ C+C S Sbjct: 1301 ILVDIWLVCSVHSCICTS 1354 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 247,028,250 Number of extensions: 3653675 Number of successful extensions: 15280 Number of sequences better than 10.0: 23 Length of query: 229 Length of database: 55,613,886 Length adjustment: 49 Effective length of query: 180 Effective length of database: 52,856,264 Effective search space: 9514127520 Effective search space used: 9514127520 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)