| Clone Name | FLbaf69h11 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os02g43050:12002.t03890:unspliced-genomic kinesin heavy chain, putative, expressed| Length = 5111 Score = 34.1 bits (68), Expect(2) = 0.025 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +1 / +1 Query: 7 FTACYFLLPPSQNKCLNFVLALV 75 FT Y LLPPSQNKC + L L+ Sbjct: 1180 FTQIYELLPPSQNKCSHGFLCLL 1248 Score = 25.4 bits (49), Expect(2) = 0.025 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +2 / +3 Query: 98 QLFWDGGST 124 +LFWDGGST Sbjct: 1398 RLFWDGGST 1424
>LOC_Os02g43130:12002.t03898:unspliced-genomic kinesin heavy chain, putative, expressed| Length = 6434 Score = 32.2 bits (64), Expect(2) = 0.10 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = +1 / +2 Query: 7 FTACYFLLPPSQNKC 51 FT Y LLPPSQNKC Sbjct: 2435 FTQIYELLPPSQNKC 2479 Score = 25.4 bits (49), Expect(2) = 0.10 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +2 / +1 Query: 98 QLFWDGGST 124 +LFWDGGST Sbjct: 2668 RLFWDGGST 2694
>LOC_Os09g21689:12009.t003522:unspliced-genomic expressed protein| Length = 6679 Score = 29.9 bits (59), Expect(2) = 0.25 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 / +1 Query: 99 SYFGTEGVHASLSRVLSFCLL*SITLV 179 +Y+GTEGV + S+C + +IT+V Sbjct: 4009 NYYGTEGVFIKIMLKKSYCTIFTITIV 4089 Score = 26.3 bits (51), Expect(2) = 0.25 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 / +3 Query: 19 YFLLPPSQNKCLN 57 Y LLPPS N C++ Sbjct: 3741 YLLLPPSHNNCIS 3779
>LOC_Os11g17650:12011.t01543:unspliced-genomic hypothetical protein| Length = 1557 Score = 29.0 bits (57), Expect(2) = 0.32 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 / +1 Query: 22 FLLPPSQNKC 51 FLLPPSQNKC Sbjct: 745 FLLPPSQNKC 774 Score = 24.9 bits (48), Expect(2) = 0.32 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / +1 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 970 LFWDGGST 993
>LOC_Os11g16280:12011.t01408:unspliced-genomic F-box-like protein, putative, expressed| Length = 4624 Score = 29.0 bits (57), Expect(3) = 0.32 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +1 / +2 Query: 16 CYFLLPPSQNKC 51 C FLLPPSQN C Sbjct: 1061 C*FLLPPSQNSC 1096 Score = 22.1 bits (42), Expect(3) = 0.32 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +3 / +1 Query: 96 DSYFGTEGVHAS 131 D+Y GTEGV +S Sbjct: 1288 DNYCGTEGVFSS 1323 Score = 22.1 bits (42), Expect(3) = 0.32 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = +3 / +1 Query: 195 IFLCNNFVLIVC 230 I+ CN++ L++C Sbjct: 4183 IWFCNHYALLIC 4218
>LOC_Os09g13600:12009.t01149:unspliced-genomic expressed protein| Length = 2540 Score = 29.0 bits (57), Expect(2) = 0.49 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +1 / -1 Query: 7 FTACYFLLPPSQNKC 51 F Y +LPPSQNKC Sbjct: 1943 FHYAYHILPPSQNKC 1899 Score = 24.9 bits (48), Expect(2) = 0.49 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / -3 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 1704 LFWDGGST 1681
>LOC_Os03g32270:12003.t02820:unspliced-genomic sigma factor sigB regulation protein rsbQ, putative, expressed| Length = 5317 Score = 31.3 bits (62), Expect(2) = 0.70 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 / -2 Query: 16 CYFLLPPSQNKC 51 C F+LPPSQNKC Sbjct: 2151 CIFVLPPSQNKC 2116 Score = 23.1 bits (44), Expect(2) = 0.70 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 / -3 Query: 101 LFWDGGST 124 LFWDGGS+ Sbjct: 1919 LFWDGGSS 1896 Score = 26.3 bits (51), Expect(2) = 5.5 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / +1 Query: 25 LLPPSQNKC 51 LLPPSQNKC Sbjct: 1897 LLPPSQNKC 1923 Score = 24.9 bits (48), Expect(2) = 5.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / +2 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 2120 LFWDGGST 2143
>LOC_Os12g12514:12012.t01120:unspliced-genomic NADP-dependent oxidoreductase P1, putative| Length = 6618 Score = 29.5 bits (58), Expect(2) = 0.85 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 / -2 Query: 4 EFTACYFLLPPSQNKC 51 E C LLPPSQNKC Sbjct: 4301 ELLPCCQLLPPSQNKC 4254 Score = 24.9 bits (48), Expect(2) = 0.85 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / -2 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 4058 LFWDGGST 4035
>LOC_Os01g36930:12001.t03242:unspliced-genomic ubiquitin carboxyl-terminal hydrolase 6, putative, expressed| Length = 7969 Score = 27.2 bits (53), Expect(2) = 0.86 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +2 / -2 Query: 98 QLFWDGGST 124 QLFWDGGST Sbjct: 2742 QLFWDGGST 2716 Score = 23.1 bits (44), Expect(2) = 0.86 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 / -1 Query: 22 FLLPPSQNKC 51 ++LPPSQ KC Sbjct: 2803 YILPPSQYKC 2774
>LOC_Os02g04970:12002.t00395:unspliced-genomic expressed protein| Length = 13809 Score = 29.5 bits (58), Expect(2) = 0.88 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +2 / +3 Query: 95 RQLFWDGGSTC 127 RQL+WDGGS C Sbjct: 4551 RQLYWDGGSIC 4583 Score = 25.8 bits (50), Expect(2) = 0.88 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 / +2 Query: 25 LLPPSQNKCLNFVLALVQ 78 LLPPSQN+C ++ L Q Sbjct: 4343 LLPPSQNRCRCWIQNLSQ 4396
>LOC_Os08g23810:12008.t02152:unspliced-genomic enoyl-[acyl-carrier-protein] reductase [NADH], chloroplast precursor,| expressed Length = 4661 Score = 27.6 bits (54), Expect(2) = 0.89 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +1 / -3 Query: 19 YFLLPPSQNKC 51 +++LPPSQNKC Sbjct: 3633 WYILPPSQNKC 3601 Score = 22.6 bits (43), Expect(2) = 0.89 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 / -3 Query: 101 LFWDGGS 121 LFWDGGS Sbjct: 3564 LFWDGGS 3544 Score = 24.4 bits (47), Expect(2) = 7.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 / +2 Query: 28 LPPSQNKC 51 LPPSQNKC Sbjct: 3545 LPPSQNKC 3568 Score = 22.6 bits (43), Expect(2) = 7.0 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 / +2 Query: 101 LFWDGGS 121 LFWDGGS Sbjct: 3605 LFWDGGS 3625
>LOC_Os10g03690:12010.t00258:unspliced-genomic F-box domain containing protein, expressed| Length = 3089 Score = 32.7 bits (65), Expect = 1.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 / +3 Query: 10 TACYFLLPPSQNKCLNFVLALVQSCTKLETVI 105 TACY P + C F++ L+QSC L ++ Sbjct: 2958 TACYMFEYPIWDSCFFFLIVLLQSCDLLSILV 3053
>LOC_Os03g51000:12003.t04431:unspliced-genomic 3,4-dihydroxy-2-butanone kinase, putative, expressed| Length = 7888 Score = 29.0 bits (57), Expect(2) = 1.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 / +1 Query: 22 FLLPPSQNKC 51 FLLPPSQNKC Sbjct: 3625 FLLPPSQNKC 3654 Score = 24.9 bits (48), Expect(2) = 1.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / +1 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 3850 LFWDGGST 3873
>LOC_Os08g39440:12008.t03676:unspliced-genomic RNA recognition motif family protein, expressed| Length = 8350 Score = 25.8 bits (50), Expect(2) = 1.5 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / +3 Query: 19 YFLLPPSQN 45 YFLLPPSQN Sbjct: 6927 YFLLPPSQN 6953 Score = 23.5 bits (45), Expect(2) = 1.5 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 / +1 Query: 102 YFGTEGVHASLSR 140 YFGTEGV S R Sbjct: 7066 YFGTEGVSLSTER 7104
>LOC_Os01g07400:12001.t00619:unspliced-genomic WD-repeat domain phosphoinositide-interacting protein 3, putative,| expressed Length = 4867 Score = 26.7 bits (52), Expect(2) = 1.6 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +1 / -3 Query: 22 FLLPPSQNKC 51 ++LPPSQNKC Sbjct: 3413 YILPPSQNKC 3384 Score = 26.3 bits (51), Expect(2) = 1.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +2 / -2 Query: 101 LFWDGGSTC 127 LFWDGGS C Sbjct: 3186 LFWDGGSIC 3160
>LOC_Os11g17290:12011.t01507:unspliced-genomic ulp1 protease family, C-terminal catalytic domain containing protein,| expressed Length = 6563 Score = 32.2 bits (64), Expect = 1.6 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +1 / -1 Query: 259 IGRSLLSFHSFVIFI*LSSITEAVIHFNFWSKKKKKI 369 +GR+ LSF +F F LS E+ I W K K+KI Sbjct: 5537 MGRTTLSFIAFRAFSSLSCPNESSISIRLWLKLKQKI 5427
>LOC_Os01g57110:12001.t05119:unspliced-genomic ATP binding protein, putative, expressed| Length = 10173 Score = 32.2 bits (64), Expect = 1.6 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +2 / +1 Query: 95 RQLFWDGGSTC 127 RQ+FWDGGSTC Sbjct: 2044 RQVFWDGGSTC 2076
>LOC_Os08g11340:12008.t01016:unspliced-genomic hypothetical protein| Length = 1667 Score = 26.3 bits (51), Expect(2) = 2.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / +3 Query: 25 LLPPSQNKC 51 LLPPSQNKC Sbjct: 579 LLPPSQNKC 605 Score = 24.9 bits (48), Expect(2) = 2.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / +2 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 800 LFWDGGST 823
>LOC_Os08g11640:12008.t01046:unspliced-genomic hypothetical protein| Length = 1701 Score = 26.3 bits (51), Expect(2) = 2.0 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / +1 Query: 25 LLPPSQNKC 51 LLPPSQNKC Sbjct: 613 LLPPSQNKC 639 Score = 24.9 bits (48), Expect(2) = 2.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / +3 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 834 LFWDGGST 857
>LOC_Os12g39430:12012.t03623:unspliced-genomic hypothetical protein| Length = 6849 Score = 31.8 bits (63), Expect = 2.2 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 / +3 Query: 288 FCNIHLIVVNYRSCDPFQLLVQKKKKN 368 FC +H ++++ S F LL+ +KKKN Sbjct: 5355 FCPVHSSIIHFVSDGQFWLLISEKKKN 5435
>LOC_Os10g02920:12010.t00181:unspliced-genomic cytochrome b561, putative, expressed| Length = 1975 Score = 31.8 bits (63), Expect = 2.2 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -2 / -2 Query: 126 HVLPPSQNNCLKLSTTLY* 70 H+LPPSQNNC + ++Y* Sbjct: 921 HLLPPSQNNCNSMLFSIY* 865 Score = 24.9 bits (48), Expect(2) = 5.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 / -2 Query: 25 LLPPSQNKCLNFVLAL 72 LLPPSQN C + + ++ Sbjct: 918 LLPPSQNNCNSMLFSI 871 Score = 24.9 bits (48), Expect(2) = 5.6 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / -3 Query: 98 QLFWDGGS 121 QLFWDGGS Sbjct: 698 QLFWDGGS 675 Score = 24.9 bits (48), Expect(2) = 7.6 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / +2 Query: 98 QLFWDGGS 121 QLFWDGGS Sbjct: 893 QLFWDGGS 916 Score = 24.4 bits (47), Expect(2) = 7.6 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +1 / +1 Query: 25 LLPPSQNKCLN 57 +LPPSQN C++ Sbjct: 673 ILPPSQNNCIS 705
>LOC_Os01g22640:12001.t01996:unspliced-genomic alpha-L-fucosidase 2 precursor, putative, expressed| Length = 4015 Score = 31.8 bits (63), Expect = 2.2 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -2 / +2 Query: 129 LHVLPPSQNNC 97 LH+LPPSQNNC Sbjct: 2039 LHILPPSQNNC 2071
>LOC_Os01g51060:12001.t04540:unspliced-genomic IAA-amino acid hydrolase ILR1-like 4 precursor, putative, expressed| Length = 8107 Score = 28.1 bits (55), Expect(2) = 2.4 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 / +1 Query: 22 FLLPPSQNKC 51 F+LPPSQNKC Sbjct: 2290 FILPPSQNKC 2319 Score = 24.9 bits (48), Expect(2) = 2.4 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 / +3 Query: 99 SYFGTEGVH 125 +YFGTEGVH Sbjct: 2508 TYFGTEGVH 2534
>LOC_Os05g48190:12005.t04253:unspliced-genomic hypothetical protein| Length = 2271 Score = 27.2 bits (53), Expect(2) = 2.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 / +1 Query: 16 CYFLLPPSQNKCLNFVLALVQSCTKLETV 102 C +LPPS N CL+ + L Q+ E + Sbjct: 589 CK*ILPPSHNTCLSSI*KLSQNSCHFEVL 675 Score = 24.0 bits (46), Expect(2) = 2.6 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 / +1 Query: 95 RQLFWDGG 118 RQ+FWDGG Sbjct: 817 RQVFWDGG 840
>LOC_Os01g11900:12001.t01059:unspliced-genomic hhH-GPD superfamily base excision DNA repair protein, expressed| Length = 11757 Score = 24.4 bits (47), Expect(2) = 2.7 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 / +1 Query: 19 YFLLPPSQN 45 Y+LLPPSQN Sbjct: 9631 YYLLPPSQN 9657 Score = 24.0 bits (46), Expect(2) = 2.7 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 / +1 Query: 101 LFWDGGST 124 +FWDGGST Sbjct: 9685 IFWDGGST 9708
>LOC_Os05g51050:12005.t04535:unspliced-genomic acyl-protein thioesterase 2, putative, expressed| Length = 3484 Score = 26.7 bits (52), Expect(2) = 2.8 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +2 / +2 Query: 101 LFWDGGSTCKS 133 LFWDGGS C S Sbjct: 740 LFWDGGSKCFS 772 Score = 24.9 bits (48), Expect(2) = 2.8 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 / +2 Query: 25 LLPPSQNKC 51 +LPPSQNKC Sbjct: 539 VLPPSQNKC 565 Score = 26.3 bits (51), Expect(2) = 3.8 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / -2 Query: 25 LLPPSQNKC 51 LLPPSQNKC Sbjct: 762 LLPPSQNKC 736 Score = 24.9 bits (48), Expect(2) = 3.8 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / -2 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 561 LFWDGGST 538
>LOC_Os02g27220:12002.t02416:unspliced-genomic protein phosphatase 2C containing protein, expressed| Length = 4899 Score = 24.9 bits (48), Expect(2) = 2.9 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +2 / +3 Query: 149 FLSFVKYHFGFSVTCHIS 202 F FVKY FSV C IS Sbjct: 4512 FSPFVKYQSQFSVICCIS 4565 Score = 23.5 bits (45), Expect(2) = 2.9 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +1 / +3 Query: 265 RSLLSFHSFVI 297 RSLLSFH F++ Sbjct: 4626 RSLLSFHHFIL 4658
>LOC_Os02g20530:12002.t01845:unspliced-genomic hypothetical protein| Length = 3708 Score = 27.6 bits (54), Expect(2) = 3.0 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 / -2 Query: 1 MEFTACYFLLPPSQNKC 51 M + LLPPSQNKC Sbjct: 3338 MNYVQHILLLPPSQNKC 3288 Score = 24.0 bits (46), Expect(2) = 3.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 / -3 Query: 101 LFWDGGSTCKSE 136 LFWDGG+T + E Sbjct: 3091 LFWDGGNTQQLE 3056
>LOC_Os01g25189:12001.t02237:unspliced-genomic delta(14)-sterol reductase, putative, expressed| Length = 8761 Score = 31.3 bits (62), Expect = 3.0 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 / +2 Query: 3 GIHCLLFSTPSVSK*VSQLCTSSS 74 GIHC L+S PS + + + CTSSS Sbjct: 1022 GIHCKLWSDPSRRQNLIEKCTSSS 1093
>LOC_Os11g23960:12011.t02016:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 9371 Score = 31.3 bits (62), Expect = 3.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 / +1 Query: 274 LSFHSFVIFI*LSSITEAVIHFNFWSKKKK 363 L + SF++FI L FNF SK+KK Sbjct: 3706 LKYFSFILFICLKLFVSVQSRFNFQSKRKK 3795
>LOC_Os04g21110:12004.t01845:unspliced-genomic expressed protein| Length = 18382 Score = 31.3 bits (62), Expect = 3.1 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 / -1 Query: 132 DLHVLPPSQNNCL 94 + H+LPPSQNNC+ Sbjct: 15049 NFHILPPSQNNCI 15011
>LOC_Os03g62070:12003.t05434:unspliced-genomic IAA-amino acid hydrolase ILR1 precursor, putative, expressed| Length = 4326 Score = 28.1 bits (55), Expect(2) = 3.4 Identities = 8/11 (72%), Positives = 11/11 (100%) Frame = +1 / -2 Query: 19 YFLLPPSQNKC 51 +++LPPSQNKC Sbjct: 1076 FYILPPSQNKC 1044 Score = 23.5 bits (45), Expect(2) = 3.4 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +3 / -2 Query: 99 SYFGTEGVH 125 +YFGT+GVH Sbjct: 854 TYFGTDGVH 828
>LOC_Os05g14550:12005.t01229:unspliced-genomic phosphatidylinositol 3-kinase tor2, putative, expressed| Length = 14013 Score = 24.9 bits (48), Expect(2) = 3.6 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +2 / +2 Query: 101 LFWDGGSTCKSE*GLEFLSFVKYHF 175 +FWDGGS G + F+ +F Sbjct: 7166 IFWDGGSIFYKVCGWRLMLFIAMNF 7240 Score = 23.1 bits (44), Expect(2) = 3.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +1 / +1 Query: 7 FTACYFLLPPSQNKCLNFVLALVQSCTKLETVILGRREYM 126 F+ + + SQ + F L+LV + ILG REY+ Sbjct: 7072 FSTYFLISNQSQPPLI*FHLSLVSVKNSRGSYILGWREYI 7191
>LOC_Os03g59550:12003.t05201:unspliced-genomic RNA-binding protein 8A, putative, expressed| Length = 4840 Score = 28.6 bits (56), Expect(2) = 3.7 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = -2 / -3 Query: 150 NSRPYSDLHVLPPSQNNC 97 N+ P ++ ++LPPSQN+C Sbjct: 3680 NTGPSAEKNLLPPSQNSC 3627 Score = 23.1 bits (44), Expect(2) = 3.7 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 / -1 Query: 53 RHLF*DGGSRK 21 RHL *DGGS K Sbjct: 3439 RHLI*DGGSMK 3407
>LOC_Os10g21850:12010.t01668:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 6637 Score = 26.3 bits (51), Expect(2) = 3.7 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / -2 Query: 25 LLPPSQNKC 51 LLPPSQNKC Sbjct: 627 LLPPSQNKC 601 Score = 25.8 bits (50), Expect(2) = 3.7 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = +2 / -1 Query: 101 LFWDGGSTCKS 133 LFWDGGST ++ Sbjct: 406 LFWDGGSTLRN 374
>LOC_Os03g59040:12003.t05154:unspliced-genomic squalene synthetase, putative, expressed| Length = 7170 Score = 28.1 bits (55), Expect(2) = 3.9 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 / -3 Query: 95 RQLFWDGGST 124 RQ+FWDGGST Sbjct: 3265 RQVFWDGGST 3236 Score = 24.0 bits (46), Expect(2) = 3.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 / -2 Query: 25 LLPPSQNKCLNFVLAL 72 LLPPS N C V+ L Sbjct: 3461 LLPPSHNTCPKIVVTL 3414
>LOC_Os12g27340:12012.t02447:unspliced-genomic hypothetical protein| Length = 1488 Score = 30.9 bits (61), Expect = 4.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 / -1 Query: 138 YSDLHVLPPSQNNCLKLSTTL 76 + +HVLPPS NC+ S L Sbjct: 90 FQQMHVLPPSHKNCISSSKAL 28
>LOC_Os05g16280:12005.t01398:unspliced-genomic transposon protein, putative, unclassified| Length = 5931 Score = 26.7 bits (52), Expect(2) = 4.5 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +2 / -1 Query: 98 QLFWDGGSTC 127 QLFWD GS+C Sbjct: 1551 QLFWDSGSSC 1522 Score = 24.9 bits (48), Expect(2) = 4.5 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 / -1 Query: 22 FLLPPSQNKCLN 57 F+LPPS N C++ Sbjct: 1758 FILPPSHNNCIS 1723
>LOC_Os12g32499:12012.t02947:unspliced-genomic expressed protein| Length = 10635 Score = 24.0 bits (46), Expect(2) = 4.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 / +1 Query: 101 LFWDGGST 124 +FWDGGST Sbjct: 8044 IFWDGGST 8067 Score = 23.5 bits (45), Expect(2) = 4.9 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 / +1 Query: 13 ACYFLLPPSQN 45 ACY LLPPS N Sbjct: 7948 ACYQLLPPS*N 7980
>LOC_Os01g42250:12001.t03744:unspliced-genomic expressed protein| Length = 3082 Score = 24.9 bits (48), Expect(2) = 5.4 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / -1 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 940 LFWDGGST 917 Score = 22.6 bits (43), Expect(2) = 5.4 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = +1 / -2 Query: 22 FLLPPSQNK 48 ++LPPSQNK Sbjct: 1011 YILPPSQNK 985 Score = 24.0 bits (46), Expect(2) = 9.7 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 / +3 Query: 19 YFLLPPSQNK 48 Y +LPPSQNK Sbjct: 912 YLVLPPSQNK 941 Score = 22.6 bits (43), Expect(2) = 9.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 / +2 Query: 101 LFWDGGS 121 LFWDGGS Sbjct: 986 LFWDGGS 1006
>LOC_Os01g71300:12001.t06425:unspliced-genomic esterase D, putative, expressed| Length = 21094 Score = 28.1 bits (55), Expect(2) = 5.4 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = +1 / +3 Query: 19 YFLLPPSQNKC 51 Y +LPPSQNKC Sbjct: 9480 YLVLPPSQNKC 9512 Score = 24.9 bits (48), Expect(2) = 5.4 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / +2 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 9704 LFWDGGST 9727
>LOC_Os12g18200:12012.t01670:unspliced-genomic expressed protein| Length = 8974 Score = 30.4 bits (60), Expect = 5.7 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 / +1 Query: 131 TCMYSLRPKITVSSLVQLCT 72 +CMY++RP +SS V LCT Sbjct: 6448 SCMYNIRP*WQISSSVSLCT 6507
>LOC_Os10g25420:12010.t01961:unspliced-genomic esterase precursor, putative, expressed| Length = 2233 Score = 30.4 bits (60), Expect = 5.8 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 / -1 Query: 154 QKLKTLLRLACTPSVPK 104 ++LKTLL CTPS+PK Sbjct: 1546 KQLKTLLTKICTPSIPK 1496
>LOC_Os08g12630:12008.t01142:unspliced-genomic hypothetical protein| Length = 1036 Score = 30.4 bits (60), Expect = 5.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 / -3 Query: 4 EFTACYFLLPPSQNKCLNFVLAL 72 E+ C FLLPPS + CL + L L Sbjct: 575 EWVYCIFLLPPS*SNCLTYGLFL 507
>LOC_Os01g35850:12001.t03137:unspliced-genomic rac-like GTP-binding protein 2, putative| Length = 2595 Score = 30.4 bits (60), Expect = 5.8 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = +1 / -2 Query: 19 YFLLPPSQNKCLN 57 ++LLPPSQNKC N Sbjct: 938 WYLLPPSQNKCSN 900
>LOC_Os06g41930:12006.t03885:unspliced-genomic expressed protein| Length = 6328 Score = 26.3 bits (51), Expect(2) = 6.4 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / -1 Query: 25 LLPPSQNKC 51 LLPPSQNKC Sbjct: 2197 LLPPSQNKC 2171 Score = 24.9 bits (48), Expect(2) = 6.4 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / -3 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 1976 LFWDGGST 1953
>LOC_Os03g58060:12003.t05067:unspliced-genomic XRN4, putative, expressed| Length = 11089 Score = 23.5 bits (45), Expect(2) = 6.4 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +1 / +3 Query: 10 TACYFLLPPSQN 45 T C +LPPSQN Sbjct: 5919 TPCCLVLPPSQN 5954 Score = 23.5 bits (45), Expect(2) = 6.4 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 / +1 Query: 102 YFGTEGVHASLSRVLSFCLL 161 YFGTEGV + S + C L Sbjct: 6046 YFGTEGVVSICSYLKRLCRL 6105
>LOC_Os08g05030:12008.t00397:unspliced-genomic expressed protein| Length = 5161 Score = 27.6 bits (54), Expect(2) = 7.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 / -2 Query: 49 CLNFVLALVQSCTKLETVILGRR 117 CLNF L LVQ+C+ E + R+ Sbjct: 2391 CLNFGLFLVQTCSSEENIWCWRK 2323 Score = 23.1 bits (44), Expect(2) = 7.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 / -2 Query: 288 FCNIHLIVVNYRSCDPFQLLVQKKK 362 F +H+ ++ YRS LLV +K+ Sbjct: 1707 FAYVHMHLLGYRSVSTGMLLVLQKQ 1633
>LOC_Os12g33960:12012.t03085:unspliced-genomic translation initiation factor IF-1 family protein| Length = 2560 Score = 25.8 bits (50), Expect(2) = 7.1 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 / -1 Query: 286 SFVIFI*LSSITEAVIHFNFW 348 SF + + + S+ A+ HF+FW Sbjct: 481 SFTLLVRVVSLLAAIPHFSFW 419 Score = 24.0 bits (46), Expect(2) = 7.1 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 / -1 Query: 235 SRNNNSIPIGRSLLSFHSFVIF 300 SR +IP+GR+ ++ S VIF Sbjct: 1894 SRRTRNIPLGRASITKPSKVIF 1829
>LOC_Os06g13200:12006.t01195:unspliced-genomic amino acid permease/ transporter, putative| Length = 4037 Score = 24.0 bits (46), Expect(2) = 7.1 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 / -3 Query: 101 LFWDGGST 124 +FWDGGST Sbjct: 828 IFWDGGST 805 Score = 23.1 bits (44), Expect(2) = 7.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 / -1 Query: 19 YFLLPPSQNKCLNFVLAL 72 YFLLPP CL+ ++ L Sbjct: 911 YFLLPPI*TYCLSRLVVL 858
>LOC_Os09g39700:12009.t03434:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 4978 Score = 29.9 bits (59), Expect = 7.9 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = -3 / -1 Query: 194 GRSH*NQSDTLQKTKTQDPTQTCMYSLRPKITVSSLVQLCTRASTKLRH 48 GR+H NQSD P C S R +S ++ C + +H Sbjct: 4858 GRTHFNQSDACLIDMESSPFWLCQVSQRFAYLISPIMHSCMHLRHRSKH 4712
>LOC_Os02g43280:12002.t03913:unspliced-genomic aldehyde dehydrogenase 3B1, putative, expressed| Length = 5776 Score = 29.9 bits (59), Expect = 7.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 / -1 Query: 285 QFCNIHLIVVNYRSCDPFQLLV 350 QF +H+ V+YRSC P L + Sbjct: 4612 QFLGVHVTTVHYRSCHPIILQI 4547
>LOC_Os11g39590:12011.t03501:unspliced-genomic NB-ARC domain containing protein| Length = 4772 Score = 29.9 bits (59), Expect = 8.0 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 / +2 Query: 13 ACYFLLPPSQN 45 AC+FLLPPSQN Sbjct: 1937 ACFFLLPPSQN 1969
>LOC_Os11g39550:12011.t03497:unspliced-genomic NB-ARC domain containing protein| Length = 10254 Score = 29.9 bits (59), Expect = 8.0 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +1 / +3 Query: 13 ACYFLLPPSQN 45 AC+FLLPPSQN Sbjct: 6813 ACFFLLPPSQN 6845
>LOC_Os04g35380:12004.t03209:unspliced-genomic expressed protein| Length = 5563 Score = 29.9 bits (59), Expect = 8.0 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 / -3 Query: 16 CYFLLPPSQN 45 CYFLLPPSQN Sbjct: 1436 CYFLLPPSQN 1407
>LOC_Os03g59264:12003.t05174:unspliced-genomic calreticulin family protein, expressed| Length = 6084 Score = 25.4 bits (49), Expect(2) = 8.2 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 / -1 Query: 25 LLPPSQNKC 51 +LPPSQNKC Sbjct: 3807 ILPPSQNKC 3781 Score = 25.4 bits (49), Expect(2) = 8.2 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 / -2 Query: 104 FWDGGSTCKS 133 FWDGGS C++ Sbjct: 3581 FWDGGSICEN 3552
>LOC_Os04g44230:12004.t03963:unspliced-genomic cytokinin dehydrogenase 5 precursor, putative| Length = 4505 Score = 25.4 bits (49), Expect(2) = 8.6 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +1 / -3 Query: 25 LLPPSQNKC 51 +LPPSQNKC Sbjct: 3501 ILPPSQNKC 3475 Score = 24.9 bits (48), Expect(2) = 8.6 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 / -1 Query: 101 LFWDGGST 124 LFWDGGST Sbjct: 3284 LFWDGGST 3261
>LOC_Os01g46290:12001.t04080:unspliced-genomic triacylglycerol lipase, putative, expressed| Length = 3428 Score = 26.3 bits (51), Expect(2) = 9.1 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / +2 Query: 25 LLPPSQNKC 51 LLPPSQNKC Sbjct: 1409 LLPPSQNKC 1435 Score = 23.5 bits (45), Expect(2) = 9.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +2 / +1 Query: 101 LFWDGGSTCK 130 LFWDGGS K Sbjct: 1627 LFWDGGSNNK 1656
>LOC_Os12g19260:12012.t01773:unspliced-genomic pentatricopeptide repeat protein PPR868-14, putative, expressed| Length = 3519 Score = 23.5 bits (45), Expect(2) = 9.5 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 / +3 Query: 102 YFGTEGVHASLS 137 YFGTEGV+ S S Sbjct: 2532 YFGTEGVYDSSS 2567 Score = 23.1 bits (44), Expect(2) = 9.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 / +2 Query: 16 CYFLLPPSQN 45 C LLPPSQN Sbjct: 2465 CKLLLPPSQN 2494 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 139,576,785 Number of extensions: 2065611 Number of successful extensions: 8551 Number of sequences better than 10.0: 59 Length of query: 123 Length of database: 55,613,886 Length adjustment: 46 Effective length of query: 77 Effective length of database: 53,025,098 Effective search space: 4082932546 Effective search space used: 4082932546 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)