| Clone Name | FLbaf61j04 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os11g38920:12011.t03435:unspliced-genomic HVA22-like protein c, putative, expressed| Length = 4461 Score = 54.2 bits (112), Expect(2) = 8e-13 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +1 / +1 Query: 43 LITNGVGVAYPAYASFKALETPEEGDDRQWTTYWIIYGCFSMVEVFADLFVSW 201 ++ V Y YAS KA+ET DD+QW TYW++Y ++ E+ + W Sbjct: 1972 MVNTNVTRCYYRYASVKAIETKSPVDDQQWLTYWVMYSLITLFELTFASIIQW 2130 Score = 42.3 bits (86), Expect(2) = 8e-13 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +1 / +1 Query: 205 PFYFPFKLIFLIALQWPGLNLAGVIYTNYLRPLLKKHE 318 PF+ KLIF+ L P N A +Y NY+RP+ KH+ Sbjct: 3010 PFWPSMKLIFICWLVLPYFNGAAFVYQNYVRPMFVKHQ 3123
>LOC_Os11g30500:12011.t02653:unspliced-genomic HVA22-like protein e, putative, expressed| Length = 1323 Score = 53.8 bits (111), Expect = 8e-07 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +1 / +3 Query: 79 YASFKALETPEEGDDRQWTTYWIIYGCFSMVEVFADLFVSW 201 YAS +A+E+P + DD QW YWI+Y ++VE+ + + W Sbjct: 453 YASVQAMESPSKLDDEQWLAYWILYSFITLVEMLLESLIYW 575 Score = 40.9 bits (83), Expect = 0.006 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = -1 / -2 Query: 180 EHLHHGEAAVDDPVGGPLAVVALLGRLQRLEGRV 79 +HLH G+ V+DPVG PL VV L L L R+ Sbjct: 554 KHLHEGDEGVEDPVGQPLLVVKLRWALHGLHRRI 453
>LOC_Os01g52780:12001.t04704:unspliced-genomic TB2/DP1, HVA22 family protein, expressed| Length = 7151 Score = 51.9 bits (107), Expect = 3e-06 Identities = 16/42 (38%), Positives = 27/42 (64%) Frame = +1 / +1 Query: 79 YASFKALETPEEGDDRQWTTYWIIYGCFSMVEVFADLFVSWF 204 YAS +A+E+P DD+QW TYW++Y ++ E+ + W+ Sbjct: 5311 YASMRAIESPSTLDDQQWLTYWVLYSLITLFELSCWKVLQWY 5436
>LOC_Os06g12220:12006.t01099:unspliced-genomic HVA22-like protein a, putative, expressed| Length = 3614 Score = 48.7 bits (100), Expect(2) = 3e-06 Identities = 16/41 (39%), Positives = 25/41 (60%) Frame = +1 / +2 Query: 79 YASFKALETPEEGDDRQWTTYWIIYGCFSMVEVFADLFVSW 201 YAS +A+ET DD+QW TYW++Y ++ E+ + W Sbjct: 1784 YASVRAIETKSPVDDQQWLTYWVLYSFITLFELTFAPVIEW 1906 Score = 24.9 bits (48), Expect(2) = 3e-06 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +1 / +3 Query: 205 PFYFPFKLIFLIALQWPGLNLAGVIYTNYLRPL 303 PF+ KL F L P + A +Y +++RP+ Sbjct: 2211 PFWSYAKLFFNCWLVLPCFHGAAYVYDHFVRPM 2309
>LOC_Os08g36440:12008.t03384:unspliced-genomic protein HVA22, putative, expressed| Length = 1361 Score = 51.0 bits (105), Expect = 5e-06 Identities = 17/41 (41%), Positives = 27/41 (65%) Frame = +1 / +1 Query: 79 YASFKALETPEEGDDRQWTTYWIIYGCFSMVEVFADLFVSW 201 YAS A+E+P + DD QW YWI+Y +++E+ A+ + W Sbjct: 460 YASICAMESPTKVDDEQWLAYWILYSFITLLEMVAEPVLYW 582 Score = 46.0 bits (94), Expect = 2e-04 Identities = 19/37 (51%), Positives = 25/37 (67%) Frame = -1 / -3 Query: 189 QVGEHLHHGEAAVDDPVGGPLAVVALLGRLQRLEGRV 79 ++G+HL G+ V+DPVG PL VV L L R +GRV Sbjct: 570 RLGDHLQEGDEGVEDPVGQPLLVVNLGRALHRADGRV 460
>LOC_Os07g38100:12007.t03478:unspliced-genomic receptor expression-enhancing protein 6, putative, expressed| Length = 4747 Score = 38.2 bits (77), Expect(3) = 1e-05 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +1 / +1 Query: 37 SALITNGVGVAYPAYASFKALETPEEGDDRQWTTYW 144 S + +GV P Y++F+A+E ++ + +W YW Sbjct: 1582 SCFCSCAIGVGLPVYSTFRAIEKKDQKEKERWLLYW 1689 Score = 29.9 bits (59), Expect(3) = 1e-05 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 / +3 Query: 277 IYTNYLRPLLKKHEAEIDQ 333 +Y Y+RP KH+A+ID+ Sbjct: 3678 VYRRYMRPFFLKHQAKIDR 3734 Score = 23.5 bits (45), Expect(3) = 1e-05 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 / +2 Query: 205 PFYFPFKLIFLIALQWP 255 PFY+ K L+ LQ+P Sbjct: 2891 PFYYHVKFAILVWLQFP 2941
>LOC_Os02g51290:12002.t04713:unspliced-genomic HVA22-like protein a, putative, expressed| Length = 2441 Score = 50.1 bits (103), Expect = 1e-05 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +1 / +1 Query: 79 YASFKALETPEEGDDRQWTTYWIIYGCFSMVEVFADLFVSWFPFY 213 YAS +A+ET DD+QW TYW++Y ++ E+ + W F+ Sbjct: 1204 YASVRAIETKSAVDDQQWLTYWVLYSFITLFELTFSPVLEW*RFF 1338
>LOC_Os09g27730:12009.t02451:unspliced-genomic protein HVA22, putative, expressed| Length = 799 Score = 37.3 bits (75), Expect = 0.075 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 / +1 Query: 97 LETPEEGDDRQWTTYWIIYGCFSMVEVFADLFVSW 201 +E+ + DD QW YWI+Y +++E+ + W Sbjct: 1 MESTSKVDDEQWLVYWILYSLITLMEMALHKVLYW 105
>LOC_Os02g02920:12002.t00192:unspliced-genomic receptor expression-enhancing protein 3, putative, expressed| Length = 4657 Score = 33.6 bits (67), Expect = 0.95 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +1 / +2 Query: 277 IYTNYLRPLLKKHEAEIDQNI 339 +Y ++ +P + KHEAEID+N+ Sbjct: 1490 VYESFFKPYIGKHEAEIDRNL 1552
>LOC_Os11g43200:12011.t03850:unspliced-genomic tropinone reductase 2, putative| Length = 1575 Score = 25.5 bits (50), Expect(2) = 2.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 315 RGRNRPEHLPGGPG 356 R + RP+H+PGG G Sbjct: 370 RQQRRPDHVPGGGG 411 Score = 24.0 bits (46), Expect(2) = 2.3 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 / +1 Query: 437 RVLAPPRPSKRLAPKKKK 490 RVL PP P++ AP +++ Sbjct: 454 RVLLPPLPARAPAPARRR 507
>LOC_Os11g43360:12011.t03866:unspliced-genomic tropinone reductase 2, putative| Length = 1292 Score = 25.5 bits (50), Expect(2) = 2.4 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 / +1 Query: 315 RGRNRPEHLPGGPG 356 R + RP+H+PGG G Sbjct: 376 RQQRRPDHVPGGGG 417 Score = 24.0 bits (46), Expect(2) = 2.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 / +1 Query: 437 RVLAPPRPSKRLAPKKKK 490 RVL PP P++ AP +++ Sbjct: 460 RVLLPPLPARAPAPARRR 513
>LOC_Os11g32430:12011.t02839:unspliced-genomic hypothetical protein| Length = 1811 Score = 32.2 bits (64), Expect = 2.5 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -1 / -2 Query: 183 GEHLHHGEAAVDDPVGGPLAVVALLGRLQRLEGRVRGVGH 64 GEH G AV+DP+ L +V +LG ++RL V H Sbjct: 298 GEHGGGGSDAVEDPLELELPLVEVLGHVRRLAELVHADDH 179
>LOC_Os10g27080:12010.t02115:unspliced-genomic hypothetical protein| Length = 1118 Score = 31.8 bits (63), Expect = 3.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 / -1 Query: 187 LFVSWFPFYFPFKLIFLIALQWPGL 261 L SW Y+P IFL +QWP L Sbjct: 1118 LHSSWIVLYYPLGHIFLNRIQWPTL 1044
>LOC_Os01g08710:12001.t00749:unspliced-genomic OsWRKY79 - Superfamily of rice TFs having WRKY and zinc finger| domains, expressed Length = 15620 Score = 31.8 bits (63), Expect = 3.4 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = +1 / +2 Query: 142 WIIYGCFSMVEVFADLFVSWFPFYFPFKLIFLIALQWPG 258 W ++ C + ++ FVSW F ++++I +PG Sbjct: 5621 WFLHQCIFLAHIYLYSFVSWNNFGIDCLILYIICNYFPG 5737
>LOC_Os11g40830:12011.t03624:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 3367 Score = 27.6 bits (54), Expect(2) = 4.5 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -3 / +1 Query: 355 PGPPGRCSGRFRPRASSGVGGDSW 284 PG PGR G FR + G G +W Sbjct: 1591 PGSPGRGDGDFRGSSRRGRGRVAW 1662 Score = 24.4 bits (47), Expect(2) = 4.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = -1 / +1 Query: 186 VGEHLHHGEAAVDDPVGGP 130 +G HHG V P GGP Sbjct: 1897 LGRRQHHGVGRVKCPGGGP 1953
>LOC_Os10g31420:12010.t02467:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 934 Score = 31.3 bits (62), Expect = 4.6 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -2 / +3 Query: 368 LSLRAWPAWEMFWSI 324 L LR WP+W ++WSI Sbjct: 189 LWLRVWPSWRLWWSI 233
>LOC_Os10g23160:12010.t01793:unspliced-genomic ent-kaurenoic acid oxidase 1, putative| Length = 1257 Score = 31.3 bits (62), Expect = 4.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 / +2 Query: 349 PPGRCSGRFRPRASSGVG 296 P G CSGR RP AS+ VG Sbjct: 380 PTGSCSGRRRPAASASVG 433
>LOC_Os03g47930:12003.t04156:unspliced-genomic expressed protein| Length = 12532 Score = 31.3 bits (62), Expect = 4.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 / -1 Query: 364 P*EPGPPGRCSGRFRPRASSGVGG 293 P P PP + GR R RA+ G+GG Sbjct: 331 PPPPPPPSKAGGRGRGRAARGLGG 260
>LOC_Os03g47920:12003.t04155:unspliced-genomic hypothetical protein| Length = 3677 Score = 31.3 bits (62), Expect = 4.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 / +2 Query: 364 P*EPGPPGRCSGRFRPRASSGVGG 293 P P PP + GR R RA+ G+GG Sbjct: 245 PPPPPPPSKAGGRGRGRAARGLGG 316
>LOC_Os09g32180:12009.t02834:unspliced-genomic conserved hypothetical protein| Length = 8139 Score = 31.3 bits (62), Expect = 4.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 / +2 Query: 145 IIYGCFSMVEVFADLFVSWFPFYFPFKLIFLI 240 I+Y CF + VF ++S F FY+ I L+ Sbjct: 6854 ILYSCF*LTSVFICCWISLFNFYYEVTFISLL 6949
>LOC_Os01g10980:12001.t00971:unspliced-genomic nodulin-like protein, putative| Length = 1454 Score = 27.2 bits (53), Expect(2) = 5.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 / +1 Query: 359 RAWPAWEMFWSISASCFFRSGRR*LV*MTPAR 264 R WPAW W+ GRR* * T AR Sbjct: 718 RRWPAWCCAWAACWRSRCTPGRR*AP*TTIAR 813 Score = 23.5 bits (45), Expect(2) = 5.2 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 / +2 Query: 102 LQRLEGRVRGVGHAHA 55 LQR G+ +G HAHA Sbjct: 1283 LQRAVGQEQGARHAHA 1330
>LOC_Os01g15890:12001.t01440:unspliced-genomic retrotransposon protein, putative, unclassified, expressed| Length = 4530 Score = 30.9 bits (61), Expect = 6.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 / -2 Query: 482 FLERGVYLALAAPGPSRGR 426 FL+RG++L L PG RGR Sbjct: 1781 FLDRGLFLGLTLPGVGRGR 1725
>LOC_Os06g36750:12006.t03370:unspliced-genomic hypothetical protein| Length = 495 Score = 30.9 bits (61), Expect = 6.4 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -1 / +3 Query: 171 HHGEAAVDDPVGGPLAVVALLGRLQRLEGRVRGVGHAHA 55 HHG+ DD GG LL R +R +GR G HA Sbjct: 165 HHGDNDHDDDEGGAARKQQLLRRPRRRQGRRPADGGHHA 281
>LOC_Os03g14610:12003.t01250:unspliced-genomic receptor expression-enhancing protein 3, putative, expressed| Length = 4997 Score = 30.9 bits (61), Expect = 6.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 / +3 Query: 277 IYTNYLRPLLKKHEAEIDQNI 339 IY + RP + +HE EID+N+ Sbjct: 1788 IYGTFFRPYISQHENEIDRNL 1850
>LOC_Os02g30800:12002.t02773:unspliced-genomic DNA polymerase family B, exonuclease domain containing protein,| expressed Length = 22072 Score = 30.9 bits (61), Expect = 6.4 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = +1 / -2 Query: 103 TPEEGDDRQWTTYWIIYGCFSMVEVFADLFV 195 T E G ++WT YW++ F + +F+ ++ Sbjct: 4749 TSEVGAKKKWTAYWLLLPPFHNIRLFSIAYI 4657
>LOC_Os01g07212:12001.t00601:unspliced-genomic staphylococcal nuclease homologue family protein, expressed| Length = 6406 Score = 24.0 bits (46), Expect(2) = 7.4 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 / -1 Query: 359 RAWPAWEMFWSISASC 312 RA AWE +W S C Sbjct: 142 RAGSAWERYWWASFEC 95 Score = 23.5 bits (45), Expect(2) = 7.4 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -3 / -3 Query: 460 WPWRRQDP 437 WPWRR+ P Sbjct: 290 WPWRRRRP 267
>LOC_Os04g45460:12004.t04080:unspliced-genomic secretory protein-like, putative, expressed| Length = 3742 Score = 30.4 bits (60), Expect = 8.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 / +2 Query: 358 EPGPPGRCSGRFRPRAS 308 +P PGRC RF+P AS Sbjct: 74 DPAKPGRCVARFKPAAS 124
>LOC_Os02g43770:12002.t03961:unspliced-genomic bZIP protein, putative, expressed| Length = 2335 Score = 30.4 bits (60), Expect = 8.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 / +2 Query: 355 PGPPGRCSGRFRPRAS 308 PGPPG+ R RPRA+ Sbjct: 1490 PGPPGQAPARLRPRAA 1537
>LOC_Os01g46250:12001.t04076:unspliced-genomic lipase-like protein, putative, expressed| Length = 2872 Score = 30.4 bits (60), Expect = 8.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 / +2 Query: 343 GRCSGRFRPRASSGVGGDSW 284 GRC+GR PR+++G G W Sbjct: 284 GRCAGRDAPRSATGWGTSPW 343
>LOC_Os07g42410:12007.t03893:unspliced-genomic expressed protein| Length = 7850 Score = 27.6 bits (54), Expect(2) = 9.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -2 / -1 Query: 209 KGNHETNRSANTSTMEKQP*MIQ*VVHWRSSPSSG 105 K H+TNR+ + +KQ I V+H S +SG Sbjct: 1085 KNRHKTNRTRLKTPFDKQKNTINIVMHTSSISASG 981 Score = 24.4 bits (47), Expect(2) = 9.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 / -1 Query: 128 WRSSPSSGVSSALKDAYAG 72 W+S+ SSG S ++ A AG Sbjct: 368 WKSAKSSGASGSIAAAAAG 312 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 125,819,892 Number of extensions: 1690527 Number of successful extensions: 9848 Number of sequences better than 10.0: 30 Length of query: 164 Length of database: 55,613,886 Length adjustment: 47 Effective length of query: 117 Effective length of database: 52,968,820 Effective search space: 6197351940 Effective search space used: 6197351940 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)