| Clone Name | FLbaf66i16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P80729:NUO6_SOLTU NADH-ubiquinone oxidoreductase 11 kDa subunit ... | 38 | 0.038 | 2 | Q5U5Q9:UIMC1_MOUSE Ubiquitin interaction motif-containing protei... | 31 | 4.7 | 3 | Q87Q75:HUTG_VIBPA Formimidoylglutamase - Vibrio parahaemolyticus | 30 | 8.1 |
|---|
>P80729:NUO6_SOLTU NADH-ubiquinone oxidoreductase 11 kDa subunit - Solanum tuberosum| (Potato) Length = 19 Score = 37.7 bits (86), Expect = 0.038 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = +3 Query: 117 GFIMEFAENLILRLMEDPE 173 GFIMEFAENLILR MEDP+ Sbjct: 1 GFIMEFAENLILRRMEDPK 19
>Q5U5Q9:UIMC1_MOUSE Ubiquitin interaction motif-containing protein 1 - Mus musculus| (Mouse) Length = 727 Score = 30.8 bits (68), Expect = 4.7 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = -1 Query: 631 SFMEQDRKSADTKHFWYLAEQEVCRSNHIQHMNQLGQFKDKIDETE 494 S E + S T+ W L +C+ +H+ N+ Q K+ D E Sbjct: 142 SHQENTKDSGTTEGVWQLVPPSLCKGSHVSQGNEAEQRKEPWDHNE 187
>Q87Q75:HUTG_VIBPA Formimidoylglutamase - Vibrio parahaemolyticus| Length = 340 Score = 30.0 bits (66), Expect = 8.1 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -1 Query: 661 FFFVCNEIIESFMEQDR-KSADTKHFWYLAEQEVCRSNHIQHMNQLGQFKDKID 503 F + C + S Q + AD + WY+ + ++ NH H+ QL F D D Sbjct: 197 FHYACLGVSRSSNTQALFQKADELNVWYVEDSQLNYLNHSYHLTQLQHFIDDCD 250 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 78,950,492 Number of extensions: 1389161 Number of successful extensions: 3246 Number of sequences better than 10.0: 3 Number of HSP's gapped: 3246 Number of HSP's successfully gapped: 3 Length of query: 222 Length of database: 100,686,439 Length adjustment: 109 Effective length of query: 113 Effective length of database: 70,788,284 Effective search space: 7999076092 Effective search space used: 7999076092 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)