| Clone Name | FLbaf69f18 |
|---|---|
| Clone Library Name | barley_pub |
>P31862:IBBWP_MAIZE Bowman-Birk type wound-induced proteinase inhibitor WIP1 precursor| - Zea mays (Maize) Length = 102 Score = 46.2 bits (108), Expect = 8e-05 Identities = 26/61 (42%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +3 Query: 180 KCCNNCR-SFSGVDVCDDAHPKCPKGCSACRV---VTPSPHKTFRCADMKSTVDGTCGGP 347 KCC NC SFSG+ CDD C C C V + S + FRC D T G CG Sbjct: 45 KCCTNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTD---TFLGMCGPK 101 Query: 348 C 350 C Sbjct: 102 C 102
>P40806:PKSJ_BACSU Putative polyketide synthase pksJ - Bacillus subtilis| Length = 5045 Score = 32.0 bits (71), Expect = 1.7 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -1 Query: 337 QVPSTVLFMSAQRNVL*GL--GVTTRQAEQPLGHLGWASSQTST 212 Q+P T +FMSA N L TT E P G++ W +Q+ T Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGT 1912
>Q9RX22:FPG_DEIRA Formamidopyrimidine-DNA glycosylase - Deinococcus radiodurans| Length = 280 Score = 30.8 bits (68), Expect = 3.7 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = -1 Query: 271 TRQAEQPLGHLGWASSQTSTPEKDLQLLQHLGKKSAFTWERIPMTRTAWRM 119 TR+ + L HL A + P DL+L+ HLG F E P TR + + Sbjct: 49 TRRGKYLLLHLAAADAAEDEPH-DLELIVHLGMTGGFRLEEGPHTRVTFEL 98
>Q9BS86:ZPBP1_HUMAN Zona pellucida-binding protein 1 precursor - Homo sapiens (Human)| Length = 351 Score = 30.0 bits (66), Expect = 6.3 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +3 Query: 198 RSFSGVDVCDDAHPKCPKGCSACRVVTPSPHKTFRCADMKSTV 326 R F G + HPKCP+ C C + +P C S++ Sbjct: 301 RCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSL 343
>Q5TCM9:LCE5A_HUMAN Late cornified envelope protein 5A - Homo sapiens (Human)| Length = 118 Score = 29.6 bits (65), Expect = 8.2 Identities = 29/92 (31%), Positives = 30/92 (32%), Gaps = 4/92 (4%) Frame = +3 Query: 177 PKCCNNCRSFSGVDVCDDAHPKCPKGCSACRVVTPSPHKTFRCADMKSTVDGTC----GG 344 PKC C PKCP CSA P P C S+ G C GG Sbjct: 14 PKCTPKCPPKCTPKCPPKCPPKCPPQCSA-----PCPPPVSSCCG--SSSGGCCSSEGGG 66 Query: 345 PCKKH*SLQGFRLGRGVPPRIKLR*DEQSSCC 440 C H PR LR QSS C Sbjct: 67 CCLSH-----------HRPRQSLRRRPQSSSC 87
>P01066:IBB1_ARAHY Bowman-Birk type proteinase inhibitor A-II [Contains: Bowman-Birk| type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III] - Arachis hypogaea (Peanut) Length = 70 Score = 29.6 bits (65), Expect = 8.2 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 183 CCNNCRSFSGVD-----VCDDAHPKCPKGCSACRVVTPSPHKTFRCAD 311 CCN C VC D CP C++C V T S RC D Sbjct: 11 CCNGCLCDRRAPPYFECVCVDTFDHCPASCNSC-VCTRSNPPQCRCTD 57
>Q9QYR7:ACOT3_MOUSE Acyl-coenzyme A thioesterase 3 - Mus musculus (Mouse)| Length = 432 Score = 29.6 bits (65), Expect = 8.3 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -1 Query: 586 FFFFLGR--HAQPSEVFIQQATPAFCRERKHSDDKQRTYCWPYNAAHTQA*QHDDCSSHL 413 F F +G+ H SE + ++A+ R + H +K + C+P H + C + L Sbjct: 329 FLFLVGQDDHNWKSEFYAREASK---RLQAHGKEKPQIICYPETGHHIEPPYFPLCKASL 385 Query: 412 SFILGG 395 + ++GG Sbjct: 386 NSLVGG 391 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 82,490,157 Number of extensions: 1735276 Number of successful extensions: 4019 Number of sequences better than 10.0: 7 Number of HSP's gapped: 4012 Number of HSP's successfully gapped: 7 Length of query: 195 Length of database: 100,686,439 Length adjustment: 107 Effective length of query: 88 Effective length of database: 71,336,874 Effective search space: 6277644912 Effective search space used: 6277644912 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)