| Clone Name | FLbaf69f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q49Y79:RUVB_STAS1 Holliday junction ATP-dependent DNA helicase r... | 29 | 8.4 |
|---|
>Q49Y79:RUVB_STAS1 Holliday junction ATP-dependent DNA helicase ruvB - Staphylococcus| saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) Length = 334 Score = 29.3 bits (64), Expect = 8.4 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +2 Query: 209 SQSSWISIFVTRGSIRLLNADNAVLDYVHRILISLFLSTRK 331 ++ ISI TR S++LL D+ LDY+ +++ L K Sbjct: 235 NEDELISIATTRASLQLLQVDDEGLDYIDHKMMNCILEQYK 275 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 76,410,385 Number of extensions: 1426445 Number of successful extensions: 3726 Number of sequences better than 10.0: 1 Number of HSP's gapped: 3721 Number of HSP's successfully gapped: 1 Length of query: 174 Length of database: 100,686,439 Length adjustment: 106 Effective length of query: 68 Effective length of database: 71,611,169 Effective search space: 4869559492 Effective search space used: 4869559492 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)