ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf66h13 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os07g07646:12007.t04721:unspliced-genomic expressed protein| Length = 2769 Score = 34.1 bits (68), Expect(2) = 0.003 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 R + RRS W GW WW W Sbjct: 285 REIPGCRRSSWSHFGWWWWWW 347 Score = 26.3 bits (51), Expect(2) = 0.003 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 333 WWWWWWWQ 356 Score = 28.6 bits (56), Expect(2) = 4.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 / -3 Query: 141 HHPHQHHPRNCQQLL 97 HH H HHP+ Q+LL Sbjct: 349 HHHHHHHPKCDQELL 305 Score = 24.4 bits (47), Expect(2) = 4.0 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 / -1 Query: 487 LHHQ**PVVLGMLQAGPWLHLGGRFLAACITLTV 386 LHH + + +LQA H FLA IT T+ Sbjct: 771 LHHILTVLTISLLQATLGNHCHHHFLATLITTTI 670
>LOC_Os03g19600:12003.t01725:unspliced-genomic PE_PGRS family protein, putative, expressed| Length = 2044 Score = 27.2 bits (53), Expect(3) = 0.004 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / +3 Query: 98 RSCWQLRGWCWWGW 139 RS W R WC W W Sbjct: 444 RSWWWPRWWCRWRW 485 Score = 26.3 bits (51), Expect(3) = 0.004 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / +3 Query: 231 WRWWTWW 251 WRW TWW Sbjct: 627 WRWRTWW 647 Score = 22.1 bits (42), Expect(3) = 0.004 Identities = 5/9 (55%), Positives = 5/9 (55%) Frame = +2 / +3 Query: 128 WWGWCSTMP 154 WW WC P Sbjct: 531 WWWWCWRRP 557 Score = 26.3 bits (51), Expect(2) = 0.44 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 / +3 Query: 71 SERRLRAVRRSCWQLRGWCWW 133 S RR R+ S W+ R W WW Sbjct: 369 SWRRRRSWWWSRWRWRAW*WW 431 Score = 26.3 bits (51), Expect(2) = 0.44 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / +3 Query: 231 WRWWTWW 251 WRW TWW Sbjct: 477 WRWRTWW 497 Score = 26.3 bits (51), Expect(2) = 0.44 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 / +3 Query: 95 RRSCWQLRGWCW 130 RR W+ R WCW Sbjct: 1011 RRRRWRTRRWCW 1046 Score = 26.3 bits (51), Expect(2) = 0.44 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / +3 Query: 231 WRWWTWW 251 WRWWT W Sbjct: 1107 WRWWTRW 1127 Score = 26.3 bits (51), Expect(2) = 0.59 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / +3 Query: 231 WRWWTWW 251 WRW TWW Sbjct: 1347 WRWRTWW 1367 Score = 25.8 bits (50), Expect(2) = 0.59 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +2 / +3 Query: 80 RLRAVRRSCWQLRGWCWWGW 139 R R R W R WCW W Sbjct: 1206 RWRCWYRWRWWTRWWCWRRW 1265 Score = 26.3 bits (51), Expect(2) = 1.1 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / +3 Query: 231 WRWWTWW 251 WRWWT W Sbjct: 837 WRWWTRW 857 Score = 25.8 bits (50), Expect(2) = 1.1 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 228 TWRWWTWW 251 TWRW WW Sbjct: 663 TWRWSRWW 686 Score = 25.4 bits (49), Expect(2) = 1.1 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = +2 / +3 Query: 98 RSCWQLRGWCWWGW 139 R W+ W WW W Sbjct: 507 RRTWRWSRWWWWCW 548 Score = 24.9 bits (48), Expect(2) = 1.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 / +3 Query: 65 FGSERRLRAVRRSCWQLRGWCWWGW 139 +G R RA R + R WCW W Sbjct: 765 WGCRWRWRA*RWCRGRTRWWCWCRW 839 Score = 26.3 bits (51), Expect(2) = 2.6 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 / +3 Query: 95 RRSCWQLRGWCW 130 RR W+ R WCW Sbjct: 1371 RRRRWRTRWWCW 1406 Score = 23.5 bits (45), Expect(2) = 2.6 Identities = 5/9 (55%), Positives = 5/9 (55%) Frame = +3 / +3 Query: 237 WWTWWKGGC 263 WW WW C Sbjct: 1425 WWVWWWCWC 1451 Score = 26.7 bits (52), Expect(2) = 3.5 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / +3 Query: 231 WRWWTWWKG 257 WRW WW+G Sbjct: 336 WRWVRWWEG 362 Score = 22.6 bits (43), Expect(2) = 3.5 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 / +3 Query: 86 RAVRRSCWQLRGWCWW 133 R RR ++ R W WW Sbjct: 282 RRWRRWWFRWRAWSWW 329 Score = 26.3 bits (51), Expect(2) = 9.8 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / +3 Query: 231 WRWWTWW 251 WRWWT W Sbjct: 987 WRWWTRW 1007 Score = 24.9 bits (48), Expect(2) = 9.8 Identities = 5/11 (45%), Positives = 6/11 (54%) Frame = +2 / +3 Query: 107 WQLRGWCWWGW 139 W+ W WW W Sbjct: 132 WRWLWWWWWSW 164
>LOC_Os11g12740:12011.t01161:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 5313 Score = 33.1 bits (66), Expect(2) = 0.006 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -1 / +2 Query: 462 CWGCCRQGPGCTWGAG 415 CW CR+G G TWG+G Sbjct: 1619 CWCGCRRGRGWTWGSG 1666 Score = 30.9 bits (61), Expect(2) = 0.006 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 / +3 Query: 141 HHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRR 40 HH QHHP +LR A R P + R RR Sbjct: 4083 HHRLQHHPGAAADVLRAAGLRHGHPHRRRRRRRR 4184
>LOC_Os07g48910:12007.t04519:unspliced-genomic collagen-like protein 2, putative, expressed| Length = 1705 Score = 29.9 bits (59), Expect(2) = 0.007 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 / +1 Query: 231 WRWWTWWKGG 260 W WW+WW+ G Sbjct: 445 WWWWSWWRRG 474 Score = 29.0 bits (57), Expect(2) = 0.007 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / +1 Query: 107 WQLRGWCWWGW 139 W+LR WCW W Sbjct: 349 WRLRWWCWCWW 381
>LOC_Os02g50600:12002.t04644:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 1767 Score = 27.6 bits (54), Expect(3) = 0.007 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +3 / +1 Query: 231 WRWWTWWKG 257 W WW WW G Sbjct: 217 WWWWRWWWG 243 Score = 26.7 bits (52), Expect(3) = 0.007 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +2 / +1 Query: 68 GSERRLRAVRRSCWQLRGWCWWGW 139 G RR+ R C W WW W Sbjct: 157 GRRRRIWGAIRRCGPDWRWWWWWW 228 Score = 25.8 bits (50), Expect(3) = 0.007 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 / +3 Query: 267 ELLHDCCSQLSQMPPQCRCNI 329 ELL + Q SQ+PPQ C + Sbjct: 1362 ELLCNSLPQPSQLPPQASCRL 1424
>LOC_Os01g11550:12001.t01025:unspliced-genomic mutant cincinnata, putative, expressed| Length = 2692 Score = 27.2 bits (53), Expect(3) = 0.007 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = +3 / -1 Query: 237 WWTWWKGGCEELLHDCCSQLSQMPP 311 WW W+ CCS S PP Sbjct: 535 WWWSWRSRWWSCCCCCCSSASSCPP 461 Score = 25.4 bits (49), Expect(3) = 0.007 Identities = 7/23 (30%), Positives = 10/23 (43%) Frame = +2 / -1 Query: 122 WCWWGWCSTMPPRDKARFLQELP 190 W WW W P ++ + E P Sbjct: 682 WWWWEWPPASPMGERRAYSAEEP 614 Score = 22.1 bits (42), Expect(3) = 0.007 Identities = 4/6 (66%), Positives = 5/6 (83%) Frame = +3 / -1 Query: 231 WRWWTW 248 W WW+W Sbjct: 538 WWWWSW 521
>LOC_Os07g11310:12007.t01005:unspliced-genomic alpha-amylase inhibitor 5, putative, expressed| Length = 690 Score = 29.0 bits (57), Expect(3) = 0.008 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 / +1 Query: 282 CCSQLSQMPPQCRCNIIQGSIQ 347 CC QL ++ +CRC+ ++ ++ Sbjct: 292 CCHQLREVAARCRCDALRAMVE 357 Score = 23.5 bits (45), Expect(3) = 0.008 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 / +2 Query: 77 RRLRAVRRSCWQLRGWCWWGWCSTMPPR 160 RR + R W+ R W W W S R Sbjct: 50 RRTASSRCRRWRWRWWR*WWWWSAPSSR 133 Score = 22.1 bits (42), Expect(3) = 0.008 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 / +1 Query: 168 LDSCRNYLLDRC 203 L CR YLL RC Sbjct: 223 LPGCRAYLLRRC 258
>LOC_Os08g39590:12008.t03691:unspliced-genomic ATP binding protein, putative, expressed| Length = 2661 Score = 30.9 bits (61), Expect(2) = 0.012 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 / +2 Query: 65 FGSERRLRAVRRSCWQLRGWCWWGW 139 FGSER L + R R W WW W Sbjct: 65 FGSERPLPSQWRQLRGRRRWRWWWW 139 Score = 27.2 bits (53), Expect(2) = 0.012 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 / +2 Query: 122 WCWWGWCS 145 W WW WCS Sbjct: 128 WWWWWWCS 151
>LOC_Os05g44720:12005.t03960:unspliced-genomic spidroin 1, putative| Length = 1752 Score = 32.2 bits (64), Expect(2) = 0.012 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / +3 Query: 107 WQLRGWCWWGW 139 W+ R WCWW W Sbjct: 1485 WRWRWWCWWWW 1517 Score = 29.0 bits (57), Expect(2) = 0.012 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / +3 Query: 231 WRWWTWWKG 257 W WW WW+G Sbjct: 1674 WWWWWWWEG 1700 Score = 29.9 bits (59), Expect(2) = 0.040 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / +3 Query: 231 WRWWTWW 251 WRWW WW Sbjct: 1491 WRWWCWW 1511 Score = 26.3 bits (51), Expect(2) = 0.040 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +2 / +3 Query: 122 WCWWGW 139 WCWW W Sbjct: 1413 WCWWWW 1430 Score = 26.3 bits (51), Expect(2) = 0.44 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 / +3 Query: 107 WQLRGWCWWGW 139 W+ R CWW W Sbjct: 1581 WRWRWCCWWWW 1613 Score = 26.3 bits (51), Expect(2) = 0.44 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +3 / +3 Query: 231 WRWWTWWKGG 260 W WW WW G Sbjct: 1671 WWWWWWWWEG 1700
>LOC_Os01g07070:12001.t00587:unspliced-genomic loricrin, putative, expressed| Length = 5483 Score = 34.5 bits (69), Expect(2) = 0.015 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 / +1 Query: 231 WRWWTWWKGGCEELLHDCCSQLS 299 W WW WW+ + CCS+ S Sbjct: 1780 WWWWWWWRRRWRRIHWQCCSRAS 1848 Score = 23.1 bits (44), Expect(2) = 0.015 Identities = 5/12 (41%), Positives = 5/12 (41%) Frame = +2 / +1 Query: 104 CWQLRGWCWWGW 139 C W WW W Sbjct: 1759 CTSTLSWWWWWW 1794 Score = 28.1 bits (55), Expect(3) = 0.81 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 4056 WTWWLWWR 4079 Score = 24.0 bits (46), Expect(3) = 0.81 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = +2 / +1 Query: 80 RLRAVRRSCWQLRGWCWWGW 139 R R R W W WW W Sbjct: 223 RRRRGRIWWWWCGRWIWWWW 282 Score = 23.5 bits (45), Expect(3) = 0.81 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / +1 Query: 122 WCWWGWCST 148 W WW CST Sbjct: 1513 WAWW*LCST 1539 Score = 26.7 bits (52), Expect(2) = 2.4 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = +3 / +1 Query: 225 VTWRWWTWW 251 ++W WW WW Sbjct: 1771 LSWWWWWWW 1797 Score = 23.1 bits (44), Expect(2) = 2.4 Identities = 5/14 (35%), Positives = 7/14 (50%) Frame = +2 / +1 Query: 107 WQLRGWCWWGWCST 148 W W W WC++ Sbjct: 1726 WSAYAWGWRPWCTS 1767
>LOC_Os07g32680:12007.t02950:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1424 Score = 29.0 bits (57), Expect(2) = 0.016 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 / +1 Query: 107 WQLRGWCWWGW 139 W R W WWGW Sbjct: 652 WWSRWWRWWGW 684 Score = 28.6 bits (56), Expect(2) = 0.016 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +3 / +1 Query: 234 RWWTWWK 254 RWWTWW+ Sbjct: 811 RWWTWWR 831 Score = 29.5 bits (58), Expect(2) = 0.33 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / +1 Query: 231 WRWWTWW 251 WRWW WW Sbjct: 667 WRWWGWW 687 Score = 23.5 bits (45), Expect(2) = 0.33 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 / +1 Query: 77 RRLRAVRRSCWQLRGWCWWGWC 142 RR R +RR W W WC Sbjct: 475 RRWRRIRRWWWPWWWVWCWRWC 540 Score = 24.9 bits (48), Expect(3) = 1.1 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +2 / +1 Query: 104 CWQLRGWCWW 133 CW RG+ WW Sbjct: 340 CWGWRGFWWW 369 Score = 24.4 bits (47), Expect(3) = 1.1 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +1 Query: 231 WRWWTWWK 254 WR W WW+ Sbjct: 1084 WRCWWWWR 1107 Score = 22.1 bits (42), Expect(3) = 1.1 Identities = 4/5 (80%), Positives = 4/5 (80%) Frame = +2 / +1 Query: 128 WWGWC 142 WW WC Sbjct: 838 WWSWC 852
>LOC_Os03g62120:12003.t05439:unspliced-genomic dnaJ domain containing protein| Length = 2695 Score = 39.6 bits (80), Expect = 0.022 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -1 / +3 Query: 135 PHQHHPRNCQQLLRTARRRRSLPKQADPRGRR 40 P +HHPR Q+L+R RRRR + + + R RR Sbjct: 171 PRRHHPRRRQELVRRPRRRRPIGEDLERRRRR 266
>LOC_Os10g36780:12010.t02956:unspliced-genomic prolyl carboxypeptidase like protein, putative, expressed| Length = 5654 Score = 29.9 bits (59), Expect(2) = 0.028 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 / -2 Query: 59 ACFGSERRLRAVRRSCWQLRGWCWWGW 139 A GS R R R + R W WW W Sbjct: 181 AAIGSAPRARRRRTTATARRWWWWWWW 101 Score = 26.7 bits (52), Expect(2) = 0.028 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -2 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 115 WWWWWWWR 92
>LOC_Os02g35630:12002.t03201:unspliced-genomic CLPX, putative, expressed| Length = 6050 Score = 34.1 bits (68), Expect(2) = 0.037 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 / +3 Query: 234 RWWTWWKGGCEE 269 RWW WW GGC E Sbjct: 678 RWWRWW*GGCGE 713 Score = 22.1 bits (42), Expect(2) = 0.037 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 77 RRLRAVRRSCWQLRGWCWW 133 RR R RR + R W WW Sbjct: 639 RRWRWRRRRRRRSRWWRWW 695
>LOC_Os12g30610:12012.t02768:unspliced-genomic expressed protein| Length = 3535 Score = 32.2 bits (64), Expect(2) = 0.038 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 / -3 Query: 231 WRWWTWWKGGCE 266 WRWW WW G E Sbjct: 296 WRWWWWWCGSFE 261 Score = 24.0 bits (46), Expect(2) = 0.038 Identities = 8/21 (38%), Positives = 9/21 (42%) Frame = +2 / -3 Query: 71 SERRLRAVRRSCWQLRGWCWW 133 S RR W+ R W WW Sbjct: 338 SPRRRPRSSSRSWRWRWWWWW 276
>LOC_Os12g05970:12012.t00483:unspliced-genomic hypothetical protein| Length = 2531 Score = 31.3 bits (62), Expect(2) = 0.039 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 / +2 Query: 489 SYITSNSQ*CWGCCRQGPGCTWGAGSW 409 SY N+ CCR G +W AG W Sbjct: 374 SYSHDNADDVVACCRPGTSPSWSAGPW 454 Score = 24.9 bits (48), Expect(2) = 0.039 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -3 / +3 Query: 367 KKPPRSRWIDPWMMLQRH 314 K PP R +PW + RH Sbjct: 537 KSPPTERPNNPWFPISRH 590
>LOC_Os12g06780:12012.t00563:unspliced-genomic expressed protein| Length = 1590 Score = 32.2 bits (64), Expect(2) = 0.040 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 / +1 Query: 231 WRWWTWWKGG 260 W WW WW+GG Sbjct: 295 WWWWWWWRGG 324 Score = 24.0 bits (46), Expect(2) = 0.040 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +2 / +1 Query: 68 GSERRLRAVRRSCWQLRGWCWWGW 139 G RR A + R W WW W Sbjct: 241 GEPRRAPAWGGGGGRRRWWWWWWW 312
>LOC_Os12g38980:12012.t03578:unspliced-genomic conserved hypothetical protein| Length = 940 Score = 29.9 bits (59), Expect(2) = 0.041 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 / +3 Query: 231 WRWWTWWKGG 260 WRWW WW G Sbjct: 885 WRWWWWWWEG 914 Score = 26.3 bits (51), Expect(2) = 0.041 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 / +3 Query: 107 WQLRGWCWWGW 139 W+ R CWW W Sbjct: 813 WRWRWCCWWWW 845
>LOC_Os03g46110:12003.t03980:unspliced-genomic expressed protein| Length = 2982 Score = 38.2 bits (77), Expect(2) = 0.049 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -1 / +3 Query: 141 HHPHQHHPRNCQQLLRTARRRRSLPK 64 HH HHP + +LRT RRRR LP+ Sbjct: 2559 HHHRCHHPHRRRPVLRTRRRRRPLPR 2636 Score = 21.7 bits (41), Expect(2) = 0.049 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -1 / +3 Query: 462 CWGCCRQGPGCTWG 421 CW CR+G T G Sbjct: 2334 CWMLCRRGTSPTAG 2375
>LOC_Os04g52550:12004.t04729:unspliced-genomic AGO2, putative, expressed| Length = 5229 Score = 32.2 bits (64), Expect(2) = 0.051 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +3 / -2 Query: 231 WRWWTWWKGGCEELLHDCCSQLSQ 302 WRWW WW+ L C S+ S+ Sbjct: 440 WRWWWWWRWW*RWLWWSCWSRWSR 369 Score = 23.5 bits (45), Expect(2) = 0.051 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / -2 Query: 113 LRGWCWWGW 139 LR W WW W Sbjct: 476 LRCWRWWWW 450 Score = 29.5 bits (58), Expect(2) = 9.1 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / -2 Query: 231 WRWWTWW 251 WRWW WW Sbjct: 467 WRWWWWW 447 Score = 23.1 bits (44), Expect(2) = 9.1 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +3 / -2 Query: 540 *KWSWNNVWIKFLNVRHR 593 *+W W + W ++ RHR Sbjct: 410 *RWLWWSCWSRWSRGRHR 357
>LOC_Os06g45050:12006.t04192:unspliced-genomic clathrin assembly protein, putative, expressed| Length = 4189 Score = 28.1 bits (55), Expect(2) = 0.051 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 / -3 Query: 231 WRWWTWWK 254 W WW WWK Sbjct: 239 WWWWWWWK 216 Score = 27.6 bits (54), Expect(2) = 0.051 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +2 / -3 Query: 53 GSACFGSERRLRAVRRSCWQLRGWCWWGW 139 G RR RA R R W WW W Sbjct: 308 GVPILAGRRRGRARRGEARLARWWWWWWW 222
>LOC_Os02g46940:12002.t04280:unspliced-genomic KAN, putative, expressed| Length = 2761 Score = 32.7 bits (65), Expect(2) = 0.053 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 / -1 Query: 231 WRWWTWWKGGCEELLH 278 WRWW W KG E+L+ Sbjct: 775 WRWWLWRKGSGREVLY 728 Score = 23.1 bits (44), Expect(2) = 0.053 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 / -2 Query: 59 ACFGSERRLRAVRRSC 106 AC+G+ R A RRSC Sbjct: 846 ACWGTSARPPARRRSC 799
>LOC_Os06g08400:12006.t04848:unspliced-genomic zinc ion binding protein, putative, expressed| Length = 7706 Score = 29.0 bits (57), Expect(2) = 0.067 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 / +1 Query: 231 WRWWTWWKGGCEELLHD 281 W WW WW L HD Sbjct: 427 WWWWWWWALAFRPLPHD 477 Score = 26.3 bits (51), Expect(2) = 0.067 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 / +1 Query: 116 RGWCWWGW 139 RGW WW W Sbjct: 418 RGWWWWWW 441
>LOC_Os01g71200:12001.t06416:unspliced-genomic RNA binding protein, putative, expressed| Length = 5623 Score = 29.0 bits (57), Expect(2) = 0.068 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / +1 Query: 95 RRSCWQLRGWCWWGW 139 R S ++ R W WWGW Sbjct: 223 RSSRYRRRWWWWWGW 267 Score = 26.3 bits (51), Expect(2) = 0.068 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 / +1 Query: 231 WRWWTWWKGGCE 266 W W WW GG E Sbjct: 256 WWGWGWWSGGGE 291
>LOC_Os05g12740:12005.t01100:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 3065 Score = 29.0 bits (57), Expect(2) = 0.071 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / +2 Query: 231 WRWWTWWKG 257 W WW WW+G Sbjct: 2963 WWWWWWWEG 2989 Score = 26.3 bits (51), Expect(2) = 0.071 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 / +2 Query: 107 WQLRGWCWWGW 139 W+ R WC W W Sbjct: 2855 WRWRWWCCWWW 2887
>LOC_Os11g10800:12011.t00968:unspliced-genomic dirigent-like protein pDIR14, putative, expressed| Length = 876 Score = 29.9 bits (59), Expect(2) = 0.076 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / -2 Query: 86 RAVRRSCWQLRGWCWWGW 139 R RR+C GW WW W Sbjct: 179 RCRRRACRSGGGWWWWWW 126 Score = 25.4 bits (49), Expect(2) = 0.076 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +3 / -2 Query: 237 WWTWWKGGC 263 WW WW+ C Sbjct: 140 WWWWWRRRC 114
>LOC_Os06g43090:12006.t03999:unspliced-genomic MYB transcription factor TaMYB1, putative, expressed| Length = 1374 Score = 26.7 bits (52), Expect(3) = 0.077 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 / -1 Query: 237 WWTWWKGGCE 266 WW WW+ G E Sbjct: 30 WWWWWRWGLE 1 Score = 26.3 bits (51), Expect(3) = 0.077 Identities = 7/18 (38%), Positives = 8/18 (44%) Frame = +3 / -1 Query: 198 RCTTMKDFPVTWRWWTWW 251 RC F + WW WW Sbjct: 72 RCLVSCGFCLVREWWWWW 19 Score = 22.6 bits (43), Expect(3) = 0.077 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +2 / -1 Query: 116 RGWCWWGW 139 R W WW W Sbjct: 543 RRWWWWWW 520
>LOC_Os11g10850:12011.t00973:unspliced-genomic dirigent-like protein pDIR14, putative| Length = 570 Score = 29.9 bits (59), Expect(2) = 0.078 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / -3 Query: 86 RAVRRSCWQLRGWCWWGW 139 R RR+C GW WW W Sbjct: 130 RCRRRACRSGGGWWWWWW 77 Score = 25.4 bits (49), Expect(2) = 0.078 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +3 / -3 Query: 237 WWTWWKGGC 263 WW WW+ C Sbjct: 91 WWWWWRRRC 65
>LOC_Os08g17820:12008.t01653:unspliced-genomic actin binding protein, putative, expressed| Length = 10957 Score = 29.0 bits (57), Expect(2) = 0.088 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 / -1 Query: 122 WCWWGWC 142 W WWGWC Sbjct: 1399 WWWWGWC 1379 Score = 25.8 bits (50), Expect(2) = 0.088 Identities = 5/9 (55%), Positives = 5/9 (55%) Frame = +3 / -1 Query: 237 WWTWWKGGC 263 WW WW C Sbjct: 1318 WWRWWNWSC 1292
>LOC_Os08g15204:12008.t01394:unspliced-genomic thioredoxin domain-containing protein 9, putative, expressed| Length = 9778 Score = 28.6 bits (56), Expect(2) = 0.089 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 / -1 Query: 56 SACFGSERRLRAVRRSCWQLRGWCWWGW 139 +A GSERR +L W WW W Sbjct: 106 AAAGGSERRSEGGSGGWRELLEWWWWWW 23 Score = 26.3 bits (51), Expect(2) = 0.089 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 / -1 Query: 237 WWTWWKGGCEE 269 WW WW G EE Sbjct: 37 WWWWWLGRREE 5
>LOC_Os07g10520:12007.t00926:unspliced-genomic nucleotide binding protein, putative, expressed| Length = 7376 Score = 29.9 bits (59), Expect(2) = 0.090 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 / -2 Query: 231 WRWWTWWKGGC 263 W WW W +GGC Sbjct: 244 WWWWWWRRGGC 212 Score = 24.9 bits (48), Expect(2) = 0.090 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / -2 Query: 80 RLRAVRRSCWQLRGWCWWGW 139 R R R S + R W WW W Sbjct: 289 RARRRRGSGRRRRRWWWWWW 230
>LOC_Os07g40510:12007.t03709:unspliced-genomic formin-2, putative, expressed| Length = 6892 Score = 30.9 bits (61), Expect(2) = 0.091 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / -3 Query: 107 WQLRGWCWWGWCS 145 W+ RGW W WCS Sbjct: 542 WRARGWRWGRWCS 504 Score = 24.0 bits (46), Expect(2) = 0.091 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -3 Query: 231 WRWWTWWK 254 WRWW W+ Sbjct: 449 WRWWGRWR 426
>LOC_Os10g18710:12010.t01418:unspliced-genomic hypothetical protein| Length = 1072 Score = 37.3 bits (75), Expect = 0.11 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPPT 234 +W L+Q++ IVKE TTS PC PT Sbjct: 341 KWSLSQISRMIVKEWSTTSTTPCGPT 418
>LOC_Os12g39310:12012.t03611:unspliced-genomic cytochrome P450 81E1, putative, expressed| Length = 2347 Score = 37.3 bits (75), Expect = 0.11 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 / -3 Query: 120 PRNCQQLLRTARRRRSLPKQADPRGRRPSC 31 P++C+ L A RRR+LPK + R R SC Sbjct: 821 PKSCRSLAMPASRRRALPKSSSRRNGRKSC 732
>LOC_Os07g32570:12007.t02939:unspliced-genomic OsAPRL1 - Oryza sativa adenosine 5'-phosphosulfate reductase-like,| expressed Length = 3296 Score = 37.3 bits (75), Expect = 0.11 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = -1 / +3 Query: 153 GIVEHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRR 40 G V HP +H R + LLR R RR P+Q +PR +R Sbjct: 2217 GPVPGHPRRHPRRPGRPLLRGPRWRRRQPRQVEPRRQR 2330
>LOC_Os11g46240:12011.t04148:unspliced-genomic ATP binding protein, putative, expressed| Length = 6759 Score = 29.5 bits (58), Expect(2) = 0.12 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / +3 Query: 231 WRWWTWWKG 257 W WW WW+G Sbjct: 5745 WFWWPWWQG 5771 Score = 24.9 bits (48), Expect(2) = 0.12 Identities = 5/11 (45%), Positives = 6/11 (54%) Frame = +2 / +3 Query: 107 WQLRGWCWWGW 139 W+ W WW W Sbjct: 5688 WERWSWTWWFW 5720 Score = 25.8 bits (50), Expect(2) = 1.8 Identities = 5/6 (83%), Positives = 6/6 (100%) Frame = +3 / +3 Query: 237 WWTWWK 254 WWTWW+ Sbjct: 5880 WWTWWE 5897 Score = 24.4 bits (47), Expect(2) = 1.8 Identities = 5/11 (45%), Positives = 6/11 (54%) Frame = +2 / +3 Query: 107 WQLRGWCWWGW 139 W+ W WW W Sbjct: 5730 WRKSWWFWWPW 5762
>LOC_Os11g38670:12011.t03410:unspliced-genomic ATP-dependent RNA helicase ded-1, putative, expressed| Length = 5258 Score = 29.5 bits (58), Expect(2) = 0.12 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 / +1 Query: 219 FPVTWRWWTWWKGGCEELL 275 F W W WW+ GC + L Sbjct: 4432 FLCIWGWRLWWRRGCSKCL 4488 Score = 24.9 bits (48), Expect(2) = 0.12 Identities = 5/11 (45%), Positives = 7/11 (63%) Frame = +2 / +1 Query: 107 WQLRGWCWWGW 139 W+ + W WW W Sbjct: 4396 WRQQRWSWWIW 4428
>LOC_Os05g35190:12005.t03112:unspliced-genomic expressed protein| Length = 3788 Score = 27.6 bits (54), Expect(2) = 0.13 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / +1 Query: 98 RSCWQLRGWCWWGW 139 R W+ R W WW W Sbjct: 217 RRGWRRRRWWWWWW 258 Score = 26.7 bits (52), Expect(2) = 0.13 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 288 WWWWWWWR 311
>LOC_Os12g07120:12012.t00597:unspliced-genomic basic proline-rich protein, putative, expressed| Length = 1883 Score = 29.9 bits (59), Expect(2) = 0.13 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +2 / +2 Query: 5 FTCTKTH*QHEGLLPRGSACFGSERRLRAVRRSCWQLRGWCWW 133 F C +G P A G +RR RR + R W WW Sbjct: 254 FRCRAAARISQGKAPTAPAICGGDRRHGRRRRRWRRRRRWWWW 382 Score = 24.4 bits (47), Expect(2) = 0.13 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +3 / +2 Query: 234 RWWTWW 251 RWW WW Sbjct: 368 RWWWWW 385 Score = 28.6 bits (56), Expect(2) = 6.8 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / +2 Query: 95 RRSCWQLRGWCWWGWCSTMP 154 RR W+ R WW WC P Sbjct: 341 RRRRWRRRRRWWWWWC*VRP 400 Score = 23.1 bits (44), Expect(2) = 6.8 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +3 / +1 Query: 231 WRWWTWW 251 WR W WW Sbjct: 598 WRAWWWW 618
>LOC_Os09g13680:12009.t01157:unspliced-genomic zinc finger, C2H2 type family protein| Length = 1226 Score = 28.1 bits (55), Expect(2) = 0.14 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = +3 / -1 Query: 231 WRWWTWWKGGC 263 W WW W++ GC Sbjct: 35 WWWWLWYR*GC 3 Score = 26.3 bits (51), Expect(2) = 0.14 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +2 / -1 Query: 122 WCWWGW 139 WCWW W Sbjct: 164 WCWWWW 147
>LOC_Os04g42570:12004.t03805:unspliced-genomic AP2 domain containing protein, expressed| Length = 4475 Score = 36.8 bits (74), Expect = 0.15 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = -1 / -1 Query: 138 HPHQHHPRNCQQLLRTARRRRSLPKQADPRGRRPSCCQC 22 HPH+ P + R RRRR P A RRP+ C C Sbjct: 3653 HPHRRRPGGRRSRRRPRRRRRPPPP*AAAPRRRPAACCC 3537
>LOC_Os06g43120:12006.t04002:unspliced-genomic zinc finger C-x8-C-x5-C-x3-H type family protein, expressed| Length = 7923 Score = 28.6 bits (56), Expect(2) = 0.16 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +3 / -2 Query: 231 WRWWTWWKG 257 W WW WW G Sbjct: 203 WWWWWWWSG 177 Score = 25.4 bits (49), Expect(2) = 0.16 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / -2 Query: 122 WCWWGWCST 148 W WW WC T Sbjct: 248 WWWW*WCWT 222 Score = 27.2 bits (53), Expect(2) = 0.54 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = +3 / -2 Query: 231 WRWWTWWKGG 260 W WW WW G Sbjct: 206 WWWWWWWWSG 177 Score = 24.9 bits (48), Expect(2) = 0.54 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +2 / -2 Query: 104 CWQLRGWCWWGW 139 CW G WW W Sbjct: 230 CWTRGGGWWWWW 195 Score = 25.8 bits (50), Expect(2) = 5.6 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +3 / -2 Query: 231 WRWWTWW 251 W WW WW Sbjct: 209 WWWWWWW 189 Score = 22.6 bits (43), Expect(2) = 5.6 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +2 / -2 Query: 119 GWCWWGW 139 G CWW W Sbjct: 260 GSCWWWW 240
>LOC_Os07g44090:12007.t04051:unspliced-genomic myb-related protein Hv33, putative, expressed| Length = 2158 Score = 29.5 bits (58), Expect(2) = 0.18 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = +3 / -3 Query: 231 WRWWTWWKGGCEELLHDCC 287 W WW WW+ G + C Sbjct: 1325 WWWWWWWRRGLGQPSSSAC 1269 Score = 24.4 bits (47), Expect(2) = 0.18 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +2 / -3 Query: 104 CWQLRGWCWWGW 139 C R W WW W Sbjct: 1343 CRTARRWWWWWW 1308
>LOC_Os06g20120:12006.t01829:unspliced-genomic CND41, chloroplast nucleoid DNA binding protein, putative| Length = 2122 Score = 29.5 bits (58), Expect(2) = 0.18 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = -1 / +1 Query: 141 HHPHQHHPRNCQQLLRTARRRRSL 70 HHPH HPR L RRR L Sbjct: 1003 HHPHHRHPRARCARLPRLHRRRRL 1074 Score = 24.4 bits (47), Expect(2) = 0.18 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 / +3 Query: 93 TARRRRSLPKQADPRGRRPSC 31 TARRR S P ++ P P C Sbjct: 1074 TARRRSSSPWRSTPASASPWC 1136
>LOC_Os08g37810:12008.t03517:unspliced-genomic expressed protein| Length = 1649 Score = 29.9 bits (59), Expect(2) = 0.18 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 / -3 Query: 231 WRWWTWWKGG 260 WRWW WW G Sbjct: 171 WRWWWWWWRG 142 Score = 24.0 bits (46), Expect(2) = 0.18 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +2 / -3 Query: 119 GWCWWGW 139 GW WW W Sbjct: 261 GWWWWWW 241
>LOC_Os11g33000:12011.t02896:unspliced-genomic prolamin, putative, expressed| Length = 636 Score = 30.4 bits (60), Expect(2) = 0.19 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 / +2 Query: 270 LLHDCCSQLSQMPPQCRCN 326 L CC QL M PQC C+ Sbjct: 299 LQQQCCMQLQGMMPQCNCD 355 Score = 23.5 bits (45), Expect(2) = 0.19 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +1 Query: 419 APQVQPGPCLQHPQHYWLLLV 481 A VQ GPC WLLL+ Sbjct: 445 AIHVQHGPCQLPTLFLWLLLI 507
>LOC_Os01g60040:12001.t05388:unspliced-genomic cytoskeleton-associated protein 5, putative, expressed| Length = 17062 Score = 26.7 bits (52), Expect(2) = 0.21 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +2 / +3 Query: 128 WWGWCS 145 WWGWCS Sbjct: 153 WWGWCS 170 Score = 26.7 bits (52), Expect(2) = 0.21 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +2 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 206 WWWWWWWR 229
>LOC_Os03g47640:12003.t04127:unspliced-genomic conserved hypothetical protein| Length = 7473 Score = 27.2 bits (53), Expect(2) = 0.22 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +3 / +3 Query: 231 WRWWTWWKG 257 W WW WW G Sbjct: 69 WWWWWWWCG 95 Score = 26.3 bits (51), Expect(2) = 0.22 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +2 / +3 Query: 116 RGWCWWGW 139 RGW WW W Sbjct: 54 RGWWWWWW 77
>LOC_Os03g55730:12003.t04833:unspliced-genomic seven transmembrane domain protein, putative, expressed| Length = 6295 Score = 29.9 bits (59), Expect(2) = 0.22 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 / +1 Query: 270 LLHDCCSQLSQMPPQCRC 323 L CC QL M PQC C Sbjct: 2323 LQQQCCMQLQGMMPQCHC 2376 Score = 23.5 bits (45), Expect(2) = 0.22 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 419 APQVQPGPCLQHPQHYWLLLV 481 A VQ GPC WLLL+ Sbjct: 2466 AIHVQHGPCQLPTLFLWLLLI 2528
>LOC_Os04g52540:12004.t04728:unspliced-genomic eukaryotic translation initiation factor 2C 2, putative, expressed| Length = 4249 Score = 30.9 bits (61), Expect(2) = 0.23 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 / +3 Query: 77 RRLRAVRRSCWQLRGWCWWGWC 142 R R RR + WCWW WC Sbjct: 153 RAWRRWRRWSRRRLWWCWWWWC 218 Score = 22.6 bits (43), Expect(2) = 0.23 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = +3 / +3 Query: 234 RWWTW 248 RWWTW Sbjct: 309 RWWTW 323
>LOC_Os01g14900:12001.t01344:unspliced-genomic glycerol-3-phosphate acyltransferase 1, putative| Length = 2935 Score = 26.7 bits (52), Expect(2) = 0.23 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = +2 / +2 Query: 71 SERRLRAVRRSCWQLRGWCWWGW 139 S + A R R W WWGW Sbjct: 338 SATAMAAAARGRGPWRRWRWWGW 406 Score = 26.7 bits (52), Expect(2) = 0.23 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / +2 Query: 231 WRWWTWWKG 257 WRWW W +G Sbjct: 389 WRWWGWRRG 415
>LOC_Os02g55160:12002.t05092:unspliced-genomic expressed protein| Length = 1444 Score = 27.2 bits (53), Expect(2) = 0.24 Identities = 7/18 (38%), Positives = 7/18 (38%) Frame = +3 / +3 Query: 231 WRWWTWWKGGCEELLHDC 284 WRWW W C C Sbjct: 681 WRWWEWRLSWCSLFFSAC 734 Score = 26.3 bits (51), Expect(2) = 0.24 Identities = 6/12 (50%), Positives = 6/12 (50%) Frame = +2 / +3 Query: 104 CWQLRGWCWWGW 139 CW W WW W Sbjct: 663 CWLYWRWRWWEW 698 Score = 25.8 bits (50), Expect(2) = 2.6 Identities = 6/11 (54%), Positives = 6/11 (54%) Frame = +3 / +3 Query: 231 WRWWTWWKGGC 263 WRW WW C Sbjct: 450 WRWRRWWNRRC 482 Score = 24.0 bits (46), Expect(2) = 2.6 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / +3 Query: 116 RGWCWWGWC 142 R W W GWC Sbjct: 396 RRWRWGGWC 422
>LOC_Os07g32510:12007.t02933:unspliced-genomic expressed protein| Length = 2134 Score = 35.9 bits (72), Expect = 0.27 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +3 / +3 Query: 231 WRWWTWWKGG 260 WRWW WW+GG Sbjct: 75 WRWWWWWRGG 104
>LOC_Os05g08370:12005.t00717:unspliced-genomic CESA1 - cellulose synthase, expressed| Length = 6285 Score = 35.9 bits (72), Expect = 0.27 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 / +1 Query: 234 RWWTWWKGGCEELLHDCCSQLSQMPPQCRCNIIQGS 341 RWW W +G E C S S P C C + GS Sbjct: 421 RWWIWGEGRGSECGVGCASLESNPPQNCVCFFVLGS 528
>LOC_Os01g08530:12001.t00731:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1461 Score = 29.5 bits (58), Expect(2) = 0.28 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 228 TWRWWTWW 251 TW WW WW Sbjct: 1263 TWSWWRWW 1286 Score = 26.7 bits (52), Expect(2) = 0.28 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / +3 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 RRLR S W+ GW W W Sbjct: 282 RRLRREWWSWWRRHGWQWRVW 344 Score = 26.3 bits (51), Expect(2) = 0.60 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 / +3 Query: 234 RWWTWWKGGC 263 RWW W + GC Sbjct: 684 RWWVWCRRGC 713 Score = 25.8 bits (50), Expect(2) = 0.60 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / +3 Query: 95 RRSCWQLRGWCWWG 136 RR CW R WWG Sbjct: 516 RRRCWCRRWSWWWG 557 Score = 25.4 bits (49), Expect(2) = 2.6 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +2 / +3 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 RR R R C RGW W W Sbjct: 183 RRWRGWRCWCRWRRGWWHWRW 245 Score = 24.4 bits (47), Expect(2) = 2.6 Identities = 4/6 (66%), Positives = 6/6 (100%) Frame = +3 / +3 Query: 237 WWTWWK 254 WW+WW+ Sbjct: 300 WWSWWR 317 Score = 24.9 bits (48), Expect(2) = 3.6 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +2 / +3 Query: 128 WWGWCSTMPPRDKARFLQELPAR 196 WW WC + R + +E P R Sbjct: 1359 WWRWCQSWRRRRTQKRWREAPWR 1427 Score = 24.4 bits (47), Expect(2) = 3.6 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / +3 Query: 98 RSCWQLRGWCWWGW 139 RS + R W WW W Sbjct: 1242 RSWSRRRTWSWWRW 1283
>LOC_Os03g05040:12003.t00378:unspliced-genomic expressed protein| Length = 4669 Score = 30.4 bits (60), Expect(2) = 0.31 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -1 / -1 Query: 144 EHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRR 40 + PH+H PR L R R R S PR RR Sbjct: 121 DEEPHEHAPRRT*WLPRGTRARSSSSSPPPPRRRR 17 Score = 22.6 bits (43), Expect(2) = 0.31 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 / -2 Query: 305 HLTQLTATIVKELFTTSLPPCPP 237 HL + +K TS+PP PP Sbjct: 309 HLQKFAEIHLKSHPETSIPPSPP 241
>LOC_Os11g20260:12011.t01795:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4170 Score = 29.5 bits (58), Expect(2) = 0.31 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 / -2 Query: 231 WRWWTWW 251 WRWW WW Sbjct: 2702 WRWWWWW 2682 Score = 23.5 bits (45), Expect(2) = 0.31 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 / -2 Query: 59 ACFGSERRLRAVRRSCWQLRGWCWWGW 139 AC G + RA+ R + R WW W Sbjct: 2774 ACIGVRGQGRAMLRRRRRRRRRRWWRW 2694
>LOC_Os01g59440:12001.t05333:unspliced-genomic BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor, putative, expressed Length = 3989 Score = 27.6 bits (54), Expect(2) = 0.31 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +1 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 148 WGWWRWWR 171 Score = 25.4 bits (49), Expect(2) = 0.31 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +2 / +2 Query: 122 WCWWGWC 142 W WW WC Sbjct: 14 WWWWWWC 34
>LOC_Os08g30850:12008.t02836:unspliced-genomic YDG/SRA domain containing protein, expressed| Length = 3306 Score = 30.4 bits (60), Expect(2) = 0.31 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 / +1 Query: 201 CTTMKDFPVTWRWWTWW 251 C T V W WW WW Sbjct: 19 CVTANLVRVFWAWWWWW 69 Score = 22.6 bits (43), Expect(2) = 0.31 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +3 / +1 Query: 237 WWTWWKGG 260 WW WW G Sbjct: 58 WWWWWWWG 81
>LOC_Os07g44690:12007.t04109:unspliced-genomic AT-HSFB4, putative, expressed| Length = 3262 Score = 28.6 bits (56), Expect(2) = 0.32 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +3 / -2 Query: 174 SCRNYLLDRCTTMKDFPVTWRWWTWW 251 +CR L+ +P T WW WW Sbjct: 2547 ACRRRRLEGGVAPPPWPSTRGWWWWW 2470 Score = 28.6 bits (56), Expect(2) = 0.32 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 / -1 Query: 234 RWWTWWKGGC 263 RWW WW G C Sbjct: 2218 RWWWWW*GWC 2189
>LOC_Os08g37990:12008.t03535:unspliced-genomic expressed protein| Length = 909 Score = 30.9 bits (61), Expect(2) = 0.33 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = -1 / -1 Query: 141 HHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRRPSCC 28 H HQH C+ R RRR+ +Q R CC Sbjct: 303 HSHHQHCFLRCRSFCRRRHRRRAWERQGTLSTRTRCCC 190 Score = 24.4 bits (47), Expect(2) = 0.33 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 / -2 Query: 473 IASSAGDVAGRAL 435 IASSA D+ GRAL Sbjct: 902 IASSASDIKGRAL 864
>LOC_Os08g34390:12008.t03179:unspliced-genomic fibroin heavy chain precursor, putative, expressed| Length = 1038 Score = 26.7 bits (52), Expect(2) = 0.34 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +2 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 320 WWWWWWWR 343 Score = 26.3 bits (51), Expect(2) = 0.34 Identities = 8/21 (38%), Positives = 8/21 (38%) Frame = +2 / +2 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 RR R W W WW W Sbjct: 272 RRWPGTRLGDWSGHRWWWWWW 334
>LOC_Os11g43250:12011.t03855:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 3217 Score = 28.1 bits (55), Expect(3) = 0.34 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 / +3 Query: 132 HQHHPRNCQQLLRTARRRRSLPKQADPRGRRPS 34 HQH+ C LLR+AR RR ++PS Sbjct: 1824 HQHYSPPC*CLLRSARTRRYCAISRSRMAQKPS 1922 Score = 25.8 bits (50), Expect(3) = 0.34 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -3 / +3 Query: 553 QDHFYLSHAVIY 518 QDH+Y+ H +IY Sbjct: 120 QDHYYILHLIIY 155 Score = 21.7 bits (41), Expect(3) = 0.34 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = -1 / +3 Query: 462 CWGCCRQ 442 CW CCR+ Sbjct: 195 CWVCCRR 215
>LOC_Os10g31460:12010.t02469:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 8917 Score = 27.2 bits (53), Expect(3) = 0.34 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +2 / +2 Query: 107 WQLRGWCWWGW 139 W+ R W WW W Sbjct: 347 WRRRWWWWWRW 379 Score = 27.2 bits (53), Expect(3) = 0.34 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 / +1 Query: 198 RCTTMKDFPVTWRWWTWW 251 R + + + WRWWT W Sbjct: 8440 RICSRRGWRTRWRWWTKW 8493 Score = 24.0 bits (46), Expect(3) = 0.34 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +2 / +3 Query: 131 WGWCSTMPPR 160 +GWC + PPR Sbjct: 1017 FGWCKSAPPR 1046
>LOC_Os02g47520:12002.t04336:unspliced-genomic hypothetical protein| Length = 694 Score = 29.5 bits (58), Expect(2) = 0.34 Identities = 8/22 (36%), Positives = 8/22 (36%) Frame = +3 / +1 Query: 231 WRWWTWWKGGCEELLHDCCSQL 296 W WW WW CC L Sbjct: 586 WWWWWWWWW*SSRCCQKCCHHL 651 Score = 23.5 bits (45), Expect(2) = 0.34 Identities = 6/13 (46%), Positives = 7/13 (53%) Frame = +2 / +1 Query: 101 SCWQLRGWCWWGW 139 +C Q W WW W Sbjct: 568 NCRQKWWWWWWWW 606
>LOC_Os05g01040:12005.t00007:unspliced-genomic phytosulfokine receptor precursor, putative, expressed| Length = 5440 Score = 30.4 bits (60), Expect(2) = 0.37 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 / -2 Query: 231 WRWWTWWK 254 WRWW WW+ Sbjct: 591 WRWWWWWR 568 Score = 27.2 bits (53), Expect(2) = 0.37 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 / -1 Query: 98 RSCWQLRGWCWWGW 139 R CW W WGW Sbjct: 862 RICWSWGAWPCWGW 821 Score = 29.0 bits (57), Expect(2) = 0.67 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +3 / -1 Query: 225 VTWRWWTWWKGG 260 V RWW WW+ G Sbjct: 439 VVGRWWAWWRQG 404 Score = 27.6 bits (54), Expect(2) = 0.67 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / -2 Query: 98 RSCWQLRGWCWWGW 139 R W + GW WW W Sbjct: 615 RRRW*ISGWRWWWW 574
>LOC_Os09g16600:12009.t01447:unspliced-genomic hypothetical protein| Length = 2504 Score = 35.4 bits (71), Expect = 0.38 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPPT 234 +W L+Q++ VKE TTS PC PT Sbjct: 1814 KWSLSQISRMTVKEWSTTSTTPCSPT 1891
>LOC_Os01g32550:12001.t02831:unspliced-genomic hypothetical protein| Length = 3042 Score = 35.4 bits (71), Expect = 0.38 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 / +3 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKEL TTS PC P Sbjct: 2361 KWSLSQISRITVKELSTTSTTPCGP 2435
>LOC_Os02g55920:12002.t05166:unspliced-genomic expressed protein| Length = 1536 Score = 35.4 bits (71), Expect = 0.38 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -1 / -3 Query: 186 NSCRNLALSLGGIVEHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRR 40 +S R +A S + HPH HPR + R + R+ RGRR Sbjct: 289 SSPRTVATSPASTRQPHPHHPHPRQTESTTRARQSARAAGAGCQDRGRR 143
>LOC_Os11g42210:12011.t03752:unspliced-genomic hypothetical protein| Length = 2918 Score = 32.7 bits (65), Expect(2) = 0.39 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 / +2 Query: 263 TTSLPPCPPTPGDRKILHRCASI*QVIPAG 174 TT+ PPCPP P +I S+ ++P G Sbjct: 2078 TTTSPPCPPNPKTTEIAGSLVSVFLLLPQG 2167 Score = 24.0 bits (46), Expect(2) = 0.39 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -1 / +3 Query: 462 CWGCCRQGPGCTWG 421 CW CR GC +G Sbjct: 6 CWRICRFWDGCWYG 47
>LOC_Os06g50390:12006.t04723:unspliced-genomic aspartic-type endopeptidase/ pepsin A, putative, expressed| Length = 2906 Score = 34.5 bits (69), Expect(2) = 0.39 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 / +3 Query: 153 GIVEHHPHQHHPRNCQQLLRTARRRRSLPKQ 61 G+ HP QH R +QLL ++RR P Q Sbjct: 915 GVRAQHPRQHRRRQVEQLLHVLQQRRPRPDQ 1007 Score = 22.1 bits (42), Expect(2) = 0.39 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = -3 / +2 Query: 385 RSR*NPKKPPRSRWIDPW 332 R+R + PP + W+ W Sbjct: 857 RARSSTAPPPTASWVSAW 910
>LOC_Os03g22690:12003.t02017:unspliced-genomic nucleoporin interacting component, putative, expressed| Length = 9025 Score = 29.5 bits (58), Expect(2) = 0.40 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -2 / -2 Query: 302 LTQLTATIVKELFTTSLPPCPPTPGDRKILHRCAS 198 +T+ T TI +E + PP P P DR LH S Sbjct: 3207 ITRRTDTIHREREKETTPPPLPPPSDRSRLHAAES 3103 Score = 23.1 bits (44), Expect(2) = 0.40 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = -1 / -3 Query: 147 VEHHPHQHHPRNCQQLLRTARRRR 76 V HH H C + R RRRR Sbjct: 2996 VRHHHHCRTSPPCTERERKRRRRR 2925
>LOC_Os08g42980:12008.t04026:unspliced-genomic RNA binding protein, putative, expressed| Length = 5466 Score = 30.4 bits (60), Expect(2) = 0.41 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 / -3 Query: 122 WCWWGWC 142 WCWW WC Sbjct: 325 WCWWWWC 305 Score = 22.1 bits (42), Expect(2) = 0.41 Identities = 4/5 (80%), Positives = 4/5 (80%) Frame = +3 / -3 Query: 237 WWTWW 251 WW WW Sbjct: 232 WWWWW 218
>LOC_Os06g03820:12006.t00273:unspliced-genomic expressed protein| Length = 1573 Score = 28.1 bits (55), Expect(3) = 0.41 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 / +1 Query: 237 WWTWWKGG 260 WW WW+GG Sbjct: 310 WWWWWQGG 333 Score = 22.6 bits (43), Expect(3) = 0.41 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = +2 / +1 Query: 77 RRLRAVRRSCWQLRGWCWW 133 RR R +R R W WW Sbjct: 265 RRRRWIREPQAATRWWWWW 321 Score = 22.6 bits (43), Expect(3) = 0.41 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 / +1 Query: 409 PRTCPPGATRALPATSPAL 465 PRT PP A A +P L Sbjct: 433 PRTPPPARAAATGAAAPGL 489
>LOC_Os03g10680:12003.t00869:unspliced-genomic actin binding protein, putative, expressed| Length = 4512 Score = 26.7 bits (52), Expect(2) = 0.41 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -3 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 1273 WWWWWWWR 1250 Score = 25.8 bits (50), Expect(2) = 0.41 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / -3 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 RRLR + GW WW W Sbjct: 1318 RRLRRLWEIVV*RHGWWWWWW 1256
>LOC_Os12g08610:12012.t00743:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass, expressed| Length = 2377 Score = 26.3 bits (51), Expect(2) = 0.43 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -1 / -1 Query: 459 WGCCRQGPGCTW 424 W CC G GC W Sbjct: 2041 WNCCCCGRGCHW 2006 Score = 26.3 bits (51), Expect(2) = 0.43 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 / -1 Query: 358 PRSRWIDPWMML 323 PR W+DPW ++ Sbjct: 1987 PRCHWLDPWRLM 1952
>LOC_Os04g41570:12004.t03716:unspliced-genomic ER33 protein, putative, expressed| Length = 4956 Score = 34.5 bits (69), Expect(2) = 0.46 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +3 / -3 Query: 231 WRWWTWWKGGCE 266 W WW WW+G C+ Sbjct: 1126 WWWWWWWRGACD 1091 Score = 22.6 bits (43), Expect(2) = 0.46 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 / -1 Query: 156 LGTKLDSCRNYLLD 197 L T SCRNY+L+ Sbjct: 3231 LRTLFSSCRNYVLE 3190
>LOC_Os12g23890:12012.t02119:unspliced-genomic expressed protein| Length = 332 Score = 29.9 bits (59), Expect(2) = 0.50 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 / +2 Query: 104 CWQLRGWCWWGW 139 C + R WCWW W Sbjct: 188 CVRTRCWCWWWW 223 Score = 22.1 bits (42), Expect(2) = 0.50 Identities = 4/5 (80%), Positives = 4/5 (80%) Frame = +3 / +2 Query: 237 WWTWW 251 WW WW Sbjct: 215 WWWWW 229
>LOC_Os12g25530:12012.t02273:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3083 Score = 35.0 bits (70), Expect = 0.52 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPPT 234 +W L+Q++ VKE TTS PC PT Sbjct: 2330 KWSLSQISRMTVKEWSTTSTTPCGPT 2407
>LOC_Os10g25750:12010.t01991:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3121 Score = 35.0 bits (70), Expect = 0.52 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPPT 234 +W L+Q++ VKE TTS PC PT Sbjct: 2368 KWSLSQISRMTVKEWSTTSTTPCGPT 2445
>LOC_Os09g20060:12009.t01740:unspliced-genomic hypothetical protein| Length = 1743 Score = 35.0 bits (70), Expect = 0.52 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPPT 234 +W L+Q++ VKE TTS PC PT Sbjct: 989 KWSLSQISKMTVKEWSTTSTTPCGPT 1066
>LOC_Os05g49050:12005.t04338:unspliced-genomic urease accessory protein ureG, putative, expressed| Length = 3173 Score = 35.0 bits (70), Expect = 0.52 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 / -1 Query: 222 PVTWRWWTWWKGGCEELLHDCCSQLSQMPPQC 317 P +W WW WW D +L ++PP C Sbjct: 122 PSSWLWWWWWSWSWS*DAMDSDLELRRIPPGC 27
>LOC_Os05g34450:12005.t03039:unspliced-genomic ASYMMETRIC LEAVES2, putative, expressed| Length = 3678 Score = 35.0 bits (70), Expect = 0.52 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 / -1 Query: 74 ERRLRAVRRSCWQLRGWCW 130 E RA RSCW R WCW Sbjct: 447 ESSKRARERSCWSWRSWCW 391
>LOC_Os01g17980:12001.t01593:unspliced-genomic hypothetical protein| Length = 1267 Score = 35.0 bits (70), Expect = 0.52 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 / +2 Query: 35 EGLLPRGSACFGSERRLRAVRRSCWQLRGWCWWG 136 E LP GS C R + A R ++R CWWG Sbjct: 26 EACLPTGSGC*SRLREVAAARGRERRIRQLCWWG 127
>LOC_Os05g12690:12005.t01095:unspliced-genomic flagelliform silk protein, putative| Length = 2617 Score = 35.0 bits (70), Expect = 0.52 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 / -1 Query: 135 PHQHHPRNCQQLLRTARRRRSLPKQADPRGRRPSC 31 P + HPR ++ R ARRRR P++ R RP C Sbjct: 376 PRRPHPRRRRRHHRPARRRRFPPRRPQHRRPRPRC 272
>LOC_Os02g39930:12002.t03629:unspliced-genomic OsTIL-1 - Oryza sativa Temperature-induced lipocalin-1, expressed| Length = 962 Score = 35.0 bits (70), Expect = 0.52 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 / +3 Query: 117 RNCQQLLRTARRRRSLPKQADPRGR 43 R+C + RT RRRR+ P+ PRGR Sbjct: 666 RSCARRRRTTRRRRATPRPPTPRGR 740
>LOC_Os01g49240:12001.t04363:unspliced-genomic limonoid UDP-glucosyltransferase, putative, expressed| Length = 1849 Score = 35.0 bits (70), Expect = 0.52 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 / +2 Query: 144 EHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGR 43 + H H PR +L R RRRR P++A PR R Sbjct: 236 QRHLHYGSPRRHPRLRRRRRRRRRRPRRAPPRWR 337
>LOC_Os03g12300:12003.t01029:unspliced-genomic HEAT repeat family protein, expressed| Length = 8132 Score = 34.1 bits (68), Expect(2) = 0.53 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 / -2 Query: 237 WWTWWKGGCEELL 275 WW WW GGCE L Sbjct: 3847 WWQWWLGGCEGYL 3809 Score = 23.5 bits (45), Expect(2) = 0.53 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 / -3 Query: 421 PPGATRALPATSPALLAIT 477 PP A P+ SPA+ A T Sbjct: 339 PPSPAAATPSRSPAIAAST 283
>LOC_Os04g57060:12004.t05173:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4967 Score = 26.3 bits (51), Expect(2) = 0.55 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +3 / -3 Query: 192 LDRCTTMKDFPVTWRWWTWW 251 L R + ++ W WW WW Sbjct: 570 LVRWSVLRWLGKVWWWWWWW 511 Score = 25.8 bits (50), Expect(2) = 0.55 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +3 / -3 Query: 237 WWTWWKGGC 263 WW WW G C Sbjct: 447 WWRWW*G*C 421 Score = 31.8 bits (63), Expect = 4.8 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 / -3 Query: 231 WRWWTWWKGGC 263 W WW WW G C Sbjct: 525 WWWWWWWYGAC 493
>LOC_Os09g27080:12009.t02387:unspliced-genomic axi 1 like protein, putative, expressed| Length = 4807 Score = 28.6 bits (56), Expect(2) = 0.55 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / -2 Query: 122 WCWWGWCSTMPPRD 163 W WW W + PP D Sbjct: 543 WWWWWWTAPPPPAD 502 Score = 23.5 bits (45), Expect(2) = 0.55 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +2 / -2 Query: 80 RLRAVRRSCWQLRGWCWW 133 RL+ RSC W WW Sbjct: 582 RLKRRNRSCCCWLWWWWW 529
>LOC_Os11g04740:12011.t00367:unspliced-genomic L-Galactono-1,4-lactone dehydrogenase, putative, expressed| Length = 4473 Score = 26.7 bits (52), Expect(2) = 0.56 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +2 / +1 Query: 113 LRGWCWWGWC 142 + GWC W WC Sbjct: 1672 IAGWCPWHWC 1701 Score = 25.4 bits (49), Expect(2) = 0.56 Identities = 6/18 (33%), Positives = 7/18 (38%) Frame = +3 / +1 Query: 240 WTWWKGGCEELLHDCCSQ 293 WTWW C C + Sbjct: 1816 WTWWPWSCSRSYSSMCGK 1869
>LOC_Os03g29614:12003.t02580:unspliced-genomic anthocyanin regulatory C1 protein, putative, expressed| Length = 4199 Score = 29.0 bits (57), Expect(2) = 0.56 Identities = 8/24 (33%), Positives = 9/24 (37%) Frame = +3 / -2 Query: 231 WRWWTWWKGGCEELLHDCCSQLSQ 302 W WW WW C S S+ Sbjct: 3835 WWWWWWWSPSSSSSASSCPSNASR 3764 Score = 23.1 bits (44), Expect(2) = 0.56 Identities = 6/13 (46%), Positives = 6/13 (46%) Frame = +2 / -2 Query: 101 SCWQLRGWCWWGW 139 S W W WW W Sbjct: 3853 SYWWWWWWWWWWW 3815
>LOC_Os06g21250:12006.t01942:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 1240 Score = 26.3 bits (51), Expect(2) = 0.61 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +2 / +3 Query: 107 WQLRGWCWW 133 W+LR W WW Sbjct: 777 WRLRWWIWW 803 Score = 25.8 bits (50), Expect(2) = 0.61 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +3 / +3 Query: 234 RWWTWWK 254 RWW WW+ Sbjct: 891 RWWRWWR 911
>LOC_Os08g01210:12008.t00021:unspliced-genomic YLS9, putative, expressed| Length = 567 Score = 28.6 bits (56), Expect(2) = 0.64 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 / -2 Query: 107 WQLRGWCWWG 136 WQ+ GW WWG Sbjct: 554 WQVVGWKWWG 525 Score = 23.5 bits (45), Expect(2) = 0.64 Identities = 6/15 (40%), Positives = 8/15 (53%) Frame = +3 / -3 Query: 216 DFPVTWRWWTWWKGG 260 D+ W WW W + G Sbjct: 526 DYDY*WWWWRWKEKG 482
>LOC_Os12g16080:12012.t01461:unspliced-genomic expressed protein| Length = 11235 Score = 28.6 bits (56), Expect(2) = 0.70 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / +2 Query: 95 RRSCWQLRGWCWW 133 R CW WCWW Sbjct: 8129 RAFCWFSSWWCWW 8167 Score = 23.1 bits (44), Expect(2) = 0.70 Identities = 7/27 (25%), Positives = 9/27 (33%) Frame = +3 / +2 Query: 237 WWTWWKGGCEELLHDCCSQLSQMPPQC 317 WW WW C + S +C Sbjct: 8153 WWCWW*SSPLSRCSTCSASSSPPASRC 8233
>LOC_Os12g23790:12012.t02109:unspliced-genomic hypothetical protein| Length = 4253 Score = 34.5 bits (69), Expect = 0.71 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS+ PC P Sbjct: 3500 KWSLSQISRMTVKEWSTTSMTPCDP 3574
>LOC_Os09g23190:12009.t02003:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6788 Score = 34.5 bits (69), Expect = 0.71 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 RW L+Q++ VKE TTS PC P Sbjct: 5798 RWSLSQISRMTVKEWSTTSTTPCDP 5872
>LOC_Os05g01370:12005.t00039:unspliced-genomic polygalacturonase inhibitor precursor, putative, expressed| Length = 1029 Score = 34.5 bits (69), Expect = 0.71 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 / +2 Query: 89 AVRRSCWQLRGWCWWGWCSTMPPRDKAR 172 A RR+CW+ R W WW T P + R Sbjct: 659 ASRRTCWRRRTWRWWTCRGTR*PATRRR 742
>LOC_Os04g13560:12004.t01175:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3464 Score = 34.5 bits (69), Expect = 0.71 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ IVKE TTS PC P Sbjct: 3149 KWPLSQISRMIVKEWSTTSTTPCGP 3223
>LOC_Os01g39290:12001.t03460:unspliced-genomic harpin-induced protein, putative, expressed| Length = 1129 Score = 34.5 bits (69), Expect = 0.71 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 / +1 Query: 122 WCWWGWCSTMPPR 160 W WWGWCS P R Sbjct: 364 WWWWGWCSWAPSR 402
>LOC_Os01g22590:12001.t01991:unspliced-genomic polygalacturonase, putative, expressed| Length = 2829 Score = 34.5 bits (69), Expect = 0.71 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 / -3 Query: 95 RRSCWQLRGWCWWGWC 142 RR WQ R CWW WC Sbjct: 1000 RRGRWQRRWRCWWCWC 953
>LOC_Os06g45940:12006.t04282:unspliced-genomic potassium transporter 13, putative, expressed| Length = 7530 Score = 26.7 bits (52), Expect(2) = 0.72 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 384 WWWWWWWR 407 Score = 24.9 bits (48), Expect(2) = 0.72 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / +3 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 RR R+ R GW WW W Sbjct: 339 RRRRSSERWRDGCGGWWWWWW 401
>LOC_Os05g32480:12005.t02844:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 5821 Score = 29.5 bits (58), Expect(2) = 0.74 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 83 LRAVRRSCWQLRGWCWWGW 139 L+ VR CW R WW W Sbjct: 3795 LKCVRTRCWCWRRQWWWWW 3851 Score = 22.1 bits (42), Expect(2) = 0.74 Identities = 4/5 (80%), Positives = 4/5 (80%) Frame = +3 / +3 Query: 237 WWTWW 251 WW WW Sbjct: 3840 WWWWW 3854
>LOC_Os12g41680:12012.t03844:unspliced-genomic NAC domain-containing protein 21/22, putative, expressed| Length = 5610 Score = 27.6 bits (54), Expect(2) = 0.74 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +2 / -2 Query: 92 VRRSCWQLRGWCWWGW 139 VRR W G WW W Sbjct: 4892 VRRLVWMCHGQWWWWW 4845 Score = 24.0 bits (46), Expect(2) = 0.74 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +3 / -2 Query: 237 WWTWWKGGCEELLH 278 WW WW G LH Sbjct: 4856 WWWWW*GFLTWRLH 4815
>LOC_Os09g32944:12009.t02908:unspliced-genomic teosinte glume architecture 1, putative, expressed| Length = 4771 Score = 28.1 bits (55), Expect(2) = 0.75 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 / -2 Query: 228 TWRWWTWW 251 TW WW WW Sbjct: 4371 TWWWWWWW 4348 Score = 23.5 bits (45), Expect(2) = 0.75 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / -2 Query: 119 GWCWWGWCS 145 G WW WCS Sbjct: 4503 GIWWWWWCS 4477
>LOC_Os11g08440:12011.t00735:unspliced-genomic heat shock 70 kDa protein, putative, expressed| Length = 3303 Score = 30.9 bits (61), Expect(2) = 0.78 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / -1 Query: 95 RRSCWQLRGWCWWG 136 R C+ R WCWWG Sbjct: 306 RSECFSDRRWCWWG 265 Score = 24.9 bits (48), Expect(2) = 0.78 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 / -2 Query: 53 GSACFGSERRLRAVRRSCWQ 112 GS+C S R A R CWQ Sbjct: 1856 GSSCRRSRCRREASRPRCWQ 1797
>LOC_Os06g41740:12006.t03866:unspliced-genomic expressed protein| Length = 966 Score = 26.3 bits (51), Expect(2) = 0.83 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 234 RWWTWWKG 257 RWW WW G Sbjct: 333 RWWWWWGG 356 Score = 25.4 bits (49), Expect(2) = 0.83 Identities = 6/11 (54%), Positives = 6/11 (54%) Frame = +2 / +3 Query: 107 WQLRGWCWWGW 139 W R W WW W Sbjct: 285 WWWRRWRWWWW 317
>LOC_Os06g51440:12006.t04827:unspliced-genomic expressed protein| Length = 956 Score = 29.5 bits (58), Expect(2) = 0.84 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 / +3 Query: 231 WRWWTWWKGGCEEL 272 WRWW W+ G EL Sbjct: 627 WRWWCGWRWGRREL 668 Score = 24.4 bits (47), Expect(2) = 0.84 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +2 / +3 Query: 107 WQLRGWCWW 133 WQ R W WW Sbjct: 291 WQWRWWRWW 317
>LOC_Os04g30120:12004.t02699:unspliced-genomic hypothetical protein| Length = 1429 Score = 32.7 bits (65), Expect(2) = 0.91 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 575 KWSLSQISRMTVKEWSTTSTTPCGP 649 Score = 21.7 bits (41), Expect(2) = 0.91 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 / +1 Query: 641 YFFFFFGHIEMFAIDTSV 588 YF F H + A+DTS+ Sbjct: 370 YFKDLFDHYRLRAVDTSL 423
>LOC_Os02g15700:12002.t01363:unspliced-genomic expressed protein| Length = 1323 Score = 26.3 bits (51), Expect(3) = 0.93 Identities = 8/25 (32%), Positives = 10/25 (40%) Frame = +2 / -2 Query: 65 FGSERRLRAVRRSCWQLRGWCWWGW 139 F S A + W+ W WW W Sbjct: 1016 FSSSSPAAAASSARWRKLRWWWWWW 942 Score = 23.1 bits (44), Expect(3) = 0.93 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -2 Query: 231 WRWWTWWK 254 WR W WW+ Sbjct: 611 WR*WWWWE 588 Score = 22.1 bits (42), Expect(3) = 0.93 Identities = 6/23 (26%), Positives = 11/23 (47%) Frame = +3 / -2 Query: 180 RNYLLDRCTTMKDFPVTWRWWTW 248 RN + ++ + +W WW W Sbjct: 779 RNRFMGAPSSRCSWSSSWWWWWW 711
>LOC_Os03g56020:12003.t04861:unspliced-genomic glycine-rich RNA-binding protein, putative, expressed| Length = 8044 Score = 28.6 bits (56), Expect(2) = 0.94 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +3 / +1 Query: 294 LSQMPPQCRCNIIQGSIQRDLGGFFGFQRDRTVKVIQAAKNLPPRCNQGP 443 + + P+C + +G GG R +++QA++ PP GP Sbjct: 3646 MEEAAPRCHVALPRGESGPRWGGGHSLAETRGRRLLQASRGPPPERGSGP 3795 Score = 28.1 bits (55), Expect(2) = 0.94 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 / +3 Query: 122 WCWWGWCSTMP 154 WC GWCST P Sbjct: 219 WCTPGWCSTWP 251
>LOC_Os12g35710:12012.t03259:unspliced-genomic extensin-like protein, putative, expressed| Length = 2620 Score = 34.1 bits (68), Expect = 0.98 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 / -2 Query: 80 RLRAVRRSCWQLRGWCWWGW 139 R R CW+ RG+ WWGW Sbjct: 1569 RWRWRAHGCWRWRGFDWWGW 1510
>LOC_Os07g11650:12007.t01038:unspliced-genomic alpha-amylase/trypsin inhibitor precursor, putative, expressed| Length = 793 Score = 34.1 bits (68), Expect = 0.98 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 / +1 Query: 267 ELLHDCCSQLSQMPPQCRCNII 332 +LL CC +L+ +P QCRC+ + Sbjct: 340 QLLEPCCRELAAVPMQCRCDAL 405
>LOC_Os06g42824:12006.t04927:unspliced-genomic expressed protein| Length = 1281 Score = 34.1 bits (68), Expect = 0.98 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 / +3 Query: 207 TMKDFPVTWRWWTWWKGG 260 T++D + RWW WW GG Sbjct: 762 TVRDDEMVMRWWWWWTGG 815
>LOC_Os03g63580:12003.t05575:unspliced-genomic hydrolase, acting on ester bonds, putative, expressed| Length = 1620 Score = 34.1 bits (68), Expect = 0.98 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +2 / +2 Query: 68 GSERRLRAVRRSCWQLRGWCWWGWCST 148 G RR R+ RR R WC WG CST Sbjct: 1280 GRRRRRRSRRR*RSSRRSWCSWGRCST 1360
>LOC_Os01g64570:12001.t05824:unspliced-genomic ubiquitin-protein ligase, putative, expressed| Length = 1215 Score = 34.1 bits (68), Expect = 0.98 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +2 / +2 Query: 59 ACFGSERRLRAVRRSCWQLRGWCWWGWCSTMPPRDKA 169 AC G R R RR C + R WWG C+ R A Sbjct: 998 ACCGRWRGTRRRRRCCRRWRSAAWWGSCAWRCGRSSA 1108
>LOC_Os05g04540:12005.t00350:unspliced-genomic expressed protein| Length = 1755 Score = 22.6 bits (43), Expect(3) = 0.98 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -2 / +2 Query: 263 TTSLPPCPPTP 231 ++SLPP PP+P Sbjct: 191 SSSLPPPPPSP 223 Score = 22.1 bits (42), Expect(3) = 0.98 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -1 / +3 Query: 135 PHQHHPRNCQQLLRTARRRRSLP 67 PH R Q LL RRRR P Sbjct: 312 PHLRRRRRGQGLLLHPRRRRRPP 380 Score = 22.1 bits (42), Expect(3) = 0.98 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 / +2 Query: 90 ARRRRSLPKQADPRGRRP 37 A RRR ++ P GRRP Sbjct: 452 APRRRRARRRTAPPGRRP 505
>LOC_Os10g33240:12010.t02626:unspliced-genomic expressed protein| Length = 3550 Score = 34.1 bits (68), Expect = 0.98 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = -1 / +3 Query: 138 HPHQHHPRNCQQLLRTARRRRSLPKQADPRGRRP 37 HPHQ PR L R RRRR LP +RP Sbjct: 744 HPHQRRPRPRLALRRRQRRRRRLPLGRRLPAQRP 845
>LOC_Os08g06380:12008.t00528:unspliced-genomic CSLF6 - cellulose synthase-like family F; beta1,3;1,4 glucan| synthase, expressed Length = 6499 Score = 34.1 bits (68), Expect = 0.98 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -1 / +3 Query: 150 IVEHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRR 40 + HPH HHPR +L R R+ A +GRR Sbjct: 5388 VAHDHPHHHHPRQHHRLRRRLRQGARRRVDALAQGRR 5498
>LOC_Os12g29160:12012.t02626:unspliced-genomic fibroin heavy chain precursor, putative| Length = 4576 Score = 28.1 bits (55), Expect(2) = 1.0 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 / +1 Query: 65 FGSERRLRAVRRSCWQLRGWCWWGW 139 F + RR R W+ R WWGW Sbjct: 4240 FFTNRRWRWNPLRWWRTRRCAWWGW 4314 Score = 23.1 bits (44), Expect(2) = 1.0 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +3 / +1 Query: 231 WRWWTWWKG 257 W W+ WW G Sbjct: 4306 WGWFWWWCG 4332
>LOC_Os10g42900:12010.t03513:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 2958 Score = 27.2 bits (53), Expect(2) = 1.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 / +3 Query: 116 RGWCWWGWCS 145 R WC W WCS Sbjct: 1455 RRWCRWRWCS 1484 Score = 24.0 bits (46), Expect(2) = 1.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 / +3 Query: 231 WRWWTWWKGG 260 WR WW+GG Sbjct: 1608 WRRLLWWRGG 1637
>LOC_Os10g33810:12010.t02682:unspliced-genomic myb-related protein Myb4, putative, expressed| Length = 2691 Score = 28.6 bits (56), Expect(2) = 1.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 / -2 Query: 231 WRWWTWWKGG 260 W WW WW+ G Sbjct: 167 WWWWWWWRTG 138 Score = 22.6 bits (43), Expect(2) = 1.0 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +2 / -2 Query: 116 RGWCWWGW 139 R W WW W Sbjct: 182 RWWWWWWW 159
>LOC_Os02g33890:12002.t03030:unspliced-genomic hypothetical protein| Length = 2508 Score = 28.6 bits (56), Expect(2) = 1.1 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -1 / +3 Query: 153 GIVEHHPHQHHPRNCQQLLRTARRRRSLP 67 G++ PH+H P + LLR R R++P Sbjct: 1419 GVLLLRPHRHLPPHAHPLLRRDLRARAVP 1505 Score = 22.6 bits (43), Expect(2) = 1.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 / +3 Query: 239 PTPGDRKILHRCASI*QVIP 180 P PG + LHR QV+P Sbjct: 1332 PVPGIHRHLHRHGGAVQVLP 1391
>LOC_Os06g35960:12006.t03293:unspliced-genomic heat shock factor protein 3, putative, expressed| Length = 2494 Score = 26.3 bits (51), Expect(2) = 1.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 / +1 Query: 138 HPHQHHPRNCQQLLRTARRRRS 73 H +H PR C++ R RRR S Sbjct: 1903 HRRRHVPRRCRRCRRRRRRRVS 1968 Score = 24.9 bits (48), Expect(2) = 1.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -2 / +3 Query: 263 TTSLPPCPPTPGDR 222 T LPP PPT G R Sbjct: 1758 TAPLPPPPPTTGSR 1799
>LOC_Os01g21590:12001.t01896:unspliced-genomic expressed protein| Length = 2202 Score = 27.2 bits (53), Expect(2) = 1.1 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +2 / -1 Query: 122 WCWWGWCSTMPPRDKARFLQELPARSMHNDEGFSGHLALV 241 W WW W + PP + F+ + S + S +L+ Sbjct: 1227 WWWWWWWTRWPP*IRRDFIPGPTSSSSSSSSSSSSSTSLL 1108 Score = 24.0 bits (46), Expect(2) = 1.1 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 / -1 Query: 95 RRSCWQLRGWCWW 133 RR W L W WW Sbjct: 1248 RRLWWPLWWWWWW 1210
>LOC_Os12g06150:12012.t00501:unspliced-genomic plant-specific domain TIGR01568 family protein, expressed| Length = 1379 Score = 26.7 bits (52), Expect(2) = 1.1 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +2 / -1 Query: 125 CWWGWCS 145 CWW WCS Sbjct: 1019 CWWCWCS 999 Score = 24.4 bits (47), Expect(2) = 1.1 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +3 / -1 Query: 234 RWWTWW 251 RWW WW Sbjct: 956 RWWWWW 939 Score = 27.6 bits (54), Expect(2) = 1.6 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 / -1 Query: 107 WQLRGWCWWGWCSTMPPRDKAR 172 W LR WW WC R + R Sbjct: 971 WWLRRRWWWWWCRRRRRRGRRR 906 Score = 25.8 bits (50), Expect(2) = 1.6 Identities = 5/8 (62%), Positives = 7/8 (87%) Frame = +3 / -1 Query: 231 WRWWTWWK 254 WR W+WW+ Sbjct: 578 WRGWSWWR 555
>LOC_Os11g34160:12011.t02969:unspliced-genomic expressed protein| Length = 3444 Score = 29.9 bits (59), Expect(2) = 1.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 / +3 Query: 577 RNFIHTLFQDHFYLSHAVIYDSLL 506 R ++H L +FY SHA +Y LL Sbjct: 756 RKYVHHLLYSYFYNSHAFLYIFLL 827 Score = 25.4 bits (49), Expect(2) = 1.1 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = -3 / +2 Query: 436 WLHLGGRFLAACITLTVRSR*NPKKPPRS 350 W GGR+ C + RSR PRS Sbjct: 1505 WPRSGGRYSPRCSPSSTRSRRRRSTSPRS 1591
>LOC_Os07g05350:12007.t00418:unspliced-genomic hypothetical protein| Length = 1079 Score = 28.6 bits (56), Expect(2) = 1.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 / +2 Query: 50 RGSACFGSERRLRAVRRSCWQLRGWCWWGWCS 145 R C + R+ V R +G WW WCS Sbjct: 845 RNPGCVAEDGRIWGVWRPFHGDKGLRWWIWCS 940 Score = 22.6 bits (43), Expect(2) = 1.1 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +2 / +2 Query: 122 WCWWGWCSTMPPRDKARFLQEL 187 WC+W + +D +LQEL Sbjct: 983 WCFWAGRLRLSDKDGWCWLQEL 1048
>LOC_Os10g31320:12010.t02458:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 929 Score = 27.6 bits (54), Expect(2) = 1.1 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / +3 Query: 98 RSCWQLRGWCWWGW 139 R CW+ W WW W Sbjct: 246 RWCWRWWVWPWWWW 287 Score = 23.5 bits (45), Expect(2) = 1.1 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +3 / +3 Query: 231 WRWWTWW 251 WRW WW Sbjct: 399 WRWRRWW 419 Score = 23.5 bits (45), Expect(3) = 2.0 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +3 / +3 Query: 231 WRWWTWW 251 WRW WW Sbjct: 495 WRWTWWW 515 Score = 23.1 bits (44), Expect(3) = 2.0 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 77 RRLRAVRRSCWQLRGWCWW 133 RR R RR + R W WW Sbjct: 153 RRWRWWRRRW*RRRRWLWW 209 Score = 22.6 bits (43), Expect(3) = 2.0 Identities = 4/6 (66%), Positives = 5/6 (83%) Frame = +2 / +3 Query: 122 WCWWGW 139 WC+W W Sbjct: 366 WCFWSW 383
>LOC_Os03g17150:12003.t01495:unspliced-genomic ZFP16-1, putative, expressed| Length = 932 Score = 25.8 bits (50), Expect(2) = 1.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 / +1 Query: 102 LLRTARRRRSLPKQADPRGRRP 37 +L ARR P++A P GRRP Sbjct: 274 VLPGARRPPGQPQEAPPGGRRP 339 Score = 25.4 bits (49), Expect(2) = 1.1 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 / +1 Query: 168 ALSLGGIVEHHPHQHHPRNCQQLLRTARRRR 76 A S GG V+ Q H + LLR RRRR Sbjct: 115 AASRGGGVQPVRQQRHGAHHAALLRRPRRRR 207
>LOC_Os06g10430:12006.t00921:unspliced-genomic gb protein, putative, expressed| Length = 7613 Score = 28.6 bits (56), Expect(2) = 1.3 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = +2 / -2 Query: 41 LLPRGSACFGSERRLRAVRRSCWQLRGWCWWGW 139 LL A RR R + R+ + W WW W Sbjct: 283 LLGASPAPASHRRRRREIARTLRRRSAWWWWWW 185 Score = 22.1 bits (42), Expect(2) = 1.3 Identities = 4/5 (80%), Positives = 4/5 (80%) Frame = +3 / -2 Query: 237 WWTWW 251 WW WW Sbjct: 199 WWWWW 185
>LOC_Os12g24110:12012.t02140:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6734 Score = 28.1 bits (55), Expect(2) = 1.3 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 / -3 Query: 234 RWWTWWKG 257 RWW WW+G Sbjct: 2319 RWWWWWRG 2296 Score = 22.6 bits (43), Expect(2) = 1.3 Identities = 5/10 (50%), Positives = 6/10 (60%) Frame = +2 / -2 Query: 122 WCWWGWCSTM 151 W WGWC + Sbjct: 2341 W*GWGWCQVV 2312
>LOC_Os06g41020:12006.t03797:unspliced-genomic expressed protein| Length = 5912 Score = 27.2 bits (53), Expect(2) = 1.3 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +2 / +3 Query: 56 SACFGSERRLRAVRRSCWQLRGWC 127 +AC G R CW+ GWC Sbjct: 462 TACTGERSRRTWSTCCCWRWTGWC 533 Score = 23.5 bits (45), Expect(2) = 1.3 Identities = 7/17 (41%), Positives = 7/17 (41%) Frame = +2 / +3 Query: 122 WCWWGWCSTMPPRDKAR 172 W W GWC R R Sbjct: 513 WRWTGWCGASGRRPGCR 563
>LOC_Os12g19290:12012.t01776:unspliced-genomic serine/threonine-protein kinase 38-like, putative, expressed| Length = 7070 Score = 33.6 bits (67), Expect = 1.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 / -2 Query: 89 AVRRSCWQLRGWCWWGWCSTMPPR 160 +V R+ LR W WWGW + P R Sbjct: 292 SVLRAARDLRIWGWWGWQAAQPSR 221
>LOC_Os08g03400:12008.t00234:unspliced-genomic expressed protein| Length = 1027 Score = 33.6 bits (67), Expect = 1.3 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = +2 / -1 Query: 62 CFGSERRLRAVRRSCWQLRGWCWWGWCSTMPPRDKAR 172 C RR R W+ R W W WCS P + R Sbjct: 475 CCCWRRRRRRRAPCRWRRRRWSWQRWCSAAAPAPRGR 365
>LOC_Os07g11630:12007.t01036:unspliced-genomic alpha-amylase/trypsin inhibitor precursor, putative, expressed| Length = 701 Score = 33.6 bits (67), Expect = 1.3 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 / +2 Query: 267 ELLHDCCSQLSQMPPQCRCNII 332 E L CC +L+ +P QCRC+ + Sbjct: 260 EFLEPCCRELAAVPMQCRCDAL 325
>LOC_Os03g08700:12003.t00726:unspliced-genomic expressed protein| Length = 6641 Score = 33.6 bits (67), Expect = 1.3 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -3 / -2 Query: 436 WLHLGGRFLAACITLTVRSR*NPKKPPRSRWIDPWMML 323 WL LGG F C+ ++ R + +P W W ++ Sbjct: 2689 WLRLGGSFQILCLVISKNLRKHESQPSLRNWYGSWSIV 2576
>LOC_Os01g69920:12001.t06294:unspliced-genomic histidine kinase 2, putative, expressed| Length = 5886 Score = 33.6 bits (67), Expect = 1.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 / +1 Query: 50 RGSACFGSERRLRAVRRSCWQLRGWCWWGWC 142 RG + RR V R W RGW WW C Sbjct: 391 RGWRGWARGRREEVVARRSWGWRGWGWWCGC 483
>LOC_Os01g61200:12001.t05500:unspliced-genomic anther-specific proline-rich protein APG precursor, putative,| expressed Length = 1879 Score = 33.6 bits (67), Expect = 1.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 / -2 Query: 207 TMKDFPVTWRWWTWWKGG 260 T+ +F W+WW W KGG Sbjct: 495 TLAEFSWRWKWWWWRKGG 442
>LOC_Os01g61190:12001.t05499:unspliced-genomic protein binding protein, putative, expressed| Length = 4655 Score = 33.6 bits (67), Expect = 1.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 / +3 Query: 207 TMKDFPVTWRWWTWWKGG 260 T+ +F W+WW W KGG Sbjct: 4161 TLAEFSWRWKWWWWRKGG 4214
>LOC_Os10g08830:12010.t00703:unspliced-genomic hypothetical protein| Length = 5279 Score = 28.1 bits (55), Expect(2) = 1.3 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 / -3 Query: 141 HHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRR 40 H + P +CQ R+A+R+R + +GRR Sbjct: 4764 HRHRRSPPHSCQTNKRSAKRKRDKRNRRRKKGRR 4663 Score = 22.6 bits (43), Expect(2) = 1.3 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 / -3 Query: 266 FTTSLPPCPPTP 231 + +L PCPP+P Sbjct: 4869 YAYALEPCPPSP 4834
>LOC_Os04g38430:12004.t03414:unspliced-genomic nodulin-like protein 5NG4, putative, expressed| Length = 2652 Score = 33.6 bits (67), Expect = 1.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 / -2 Query: 159 LGGIVEHHPHQHHPRNCQQLLRT 91 LG V H H HHP +CQ+ L T Sbjct: 194 LGEGVHHREHHHHPNHCQRWLPT 126
>LOC_Os01g03900:12001.t00279:unspliced-genomic expressed protein| Length = 654 Score = 33.6 bits (67), Expect = 1.3 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -1 / -3 Query: 363 NHRDHVGLIPG*CCSGIAVAFDSTDCNNREGALHNLPSTMSTNA 232 N HV ++ CC G + +S C R G P+T ST+A Sbjct: 376 NRSMHVCILYSTCCGGHRGSLESAACRRRTGRQLQKPTTSSTSA 245
>LOC_Os02g30900:12002.t02783:unspliced-genomic protein kinase APK1A, chloroplast precursor, putative, expressed| Length = 4510 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +2 / -3 Query: 125 CWWGWC 142 CWW WC Sbjct: 491 CWWWWC 474 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 9/25 (36%), Positives = 10/25 (40%) Frame = +3 / -3 Query: 237 WWTWWKGGCEELLHDCCSQLSQMPP 311 WW W + G L C L PP Sbjct: 488 WWWWCRSG*PPPLSPCRPALEPPPP 414
>LOC_Os04g29790:12004.t02666:unspliced-genomic OsWAK40 - OsWAK receptor-like protein (OsWAK-RLP)| Length = 4269 Score = 26.3 bits (51), Expect(2) = 1.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 / +2 Query: 116 RGWCWWGWCST 148 R WCW GW S+ Sbjct: 275 RRWCWQGWRSS 307 Score = 24.4 bits (47), Expect(2) = 1.4 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +3 / +3 Query: 231 WRWWTW 248 WRWW W Sbjct: 372 WRWWGW 389
>LOC_Os06g30730:12006.t02776:unspliced-genomic ATPase, coupled to transmembrane movement of substances, putative,| expressed Length = 2531 Score = 26.7 bits (52), Expect(2) = 1.4 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / -3 Query: 231 WRWWTWWKG 257 W WWT W+G Sbjct: 252 WWWWTLWRG 226 Score = 24.0 bits (46), Expect(2) = 1.4 Identities = 7/14 (50%), Positives = 7/14 (50%) Frame = +2 / -3 Query: 98 RSCWQLRGWCWWGW 139 R C L W WW W Sbjct: 282 RHCRVL*RWWWWWW 241
>LOC_Os01g08470:12001.t00725:unspliced-genomic protein binding protein, putative, expressed| Length = 2275 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / -2 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 RRLR V C + R W W W Sbjct: 1425 RRLRWVEDWCRRWRRWWRWRW 1363 Score = 25.4 bits (49), Expect(2) = 1.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 / -2 Query: 231 WRWWTWWKGGCEELL 275 W W WW+ G +E L Sbjct: 1284 WWWRRWWRQGRDERL 1240
>LOC_Os10g38940:12010.t03134:unspliced-genomic beta-carotene hydroxylase, putative, expressed| Length = 1972 Score = 25.8 bits (50), Expect(2) = 1.4 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +3 / +2 Query: 234 RWWTWWK 254 RWW WW+ Sbjct: 230 RWWRWWR 250 Score = 24.9 bits (48), Expect(2) = 1.4 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +2 / +2 Query: 86 RAVRRSCWQLRGWCWWGWCSTMPPRDKA 169 RA +++R W GW S+ PP A Sbjct: 20 RARAHRAFRIRTWPSRGWWSSPPPSSSA 103
>LOC_Os09g11880:12009.t00977:unspliced-genomic glycine-rich cell wall structural protein precursor, putative| Length = 1084 Score = 27.2 bits (53), Expect(2) = 1.5 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 107 WQLRGWCWWGWC 142 W RGW WW C Sbjct: 862 WVRRGWPWWRQC 897 Score = 23.5 bits (45), Expect(2) = 1.5 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +1 Query: 228 TWRWWTWW 251 +WRWW W Sbjct: 934 SWRWWRPW 957
>LOC_Os04g22800:12004.t02007:unspliced-genomic hypothetical protein| Length = 2495 Score = 31.3 bits (62), Expect(2) = 1.5 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +1 / -1 Query: 382 IGQSK*YKQPRTCPPGATRALPATSPA 462 +G+++* ++ R+CPP R LPA + A Sbjct: 1661 LGRAR*RRRRRSCPPAVARTLPAFARA 1581 Score = 23.1 bits (44), Expect(2) = 1.5 Identities = 4/6 (66%), Positives = 5/6 (83%) Frame = +3 / -3 Query: 237 WWTWWK 254 WW WW+ Sbjct: 1977 WWRWWQ 1960
>LOC_Os03g62590:12003.t05485:unspliced-genomic expressed protein| Length = 1898 Score = 28.6 bits (56), Expect(2) = 1.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 / +2 Query: 50 RGSACFGSERRLRAVRRSCWQLRGWCWW 133 RG+ G +R + R S W R W WW Sbjct: 137 RGTV*CGRDRLIDRSRWSRW*TRCWTWW 220 Score = 25.4 bits (49), Expect(2) = 1.6 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / +1 Query: 234 RWWTWWKGG 260 R W WW+GG Sbjct: 475 RTWCWWRGG 501
>LOC_Os04g02570:12004.t00150:unspliced-genomic hypothetical protein| Length = 414 Score = 27.6 bits (54), Expect(2) = 1.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 / +2 Query: 234 RWWTWWKGGCEE 269 RWW WW EE Sbjct: 212 RWWWWWLSSTEE 247 Score = 23.1 bits (44), Expect(2) = 1.6 Identities = 9/22 (40%), Positives = 9/22 (40%) Frame = +3 / +2 Query: 177 CRNYLLDRCTTMKDFPVTWRWW 242 CR L DR P W WW Sbjct: 161 CRFELHDRFGASPPPPPRWWWW 226
>LOC_Os09g02260:12009.t00126:unspliced-genomic pentatricopeptide repeat-containing protein, putative, expressed| Length = 2723 Score = 32.7 bits (65), Expect(2) = 1.6 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = -1 / +1 Query: 141 HHPHQHHPRNCQQLLRTARRRRSLPKQA 58 HHPH HH + R RRR P A Sbjct: 160 HHPHPHHRHRIVSISRRRARRRRRPPHA 243 Score = 21.7 bits (41), Expect(2) = 1.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -2 / +3 Query: 254 LPPCPPTPGDRKIL 213 LPP PP P R +L Sbjct: 51 LPPPPPPPPRRALL 92
>LOC_Os08g44870:12008.t04260:unspliced-genomic transparent testa 12 protein, putative, expressed| Length = 2051 Score = 27.6 bits (54), Expect(2) = 1.7 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 / +2 Query: 101 SCWQLRGWCWWG 136 +CW R CWWG Sbjct: 431 TCWPSRCSCWWG 466 Score = 26.3 bits (51), Expect(2) = 1.7 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +3 / +2 Query: 237 WWTWWKGGC 263 WW WW+ C Sbjct: 1037 WWWWWRSRC 1063
>LOC_Os01g09246:12001.t00803:unspliced-genomic expressed protein| Length = 11453 Score = 27.2 bits (53), Expect(2) = 1.7 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +3 / +3 Query: 231 WRWWTWW 251 W WW+WW Sbjct: 5982 WWWWSWW 6002 Score = 23.1 bits (44), Expect(2) = 1.7 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +2 / +3 Query: 71 SERRLRAVRRSCWQLRGWCWWGWCS 145 S RL R+ ++ WC W W S Sbjct: 5922 SNFRLPKWSRTRKDIKQWCKWWWWS 5996
>LOC_Os08g10770:12008.t00959:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4944 Score = 27.6 bits (54), Expect(2) = 1.8 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +2 / -1 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 R++ V R W + W WW W Sbjct: 651 RKVMWVGRVLWWIWWWWWWWW 589 Score = 22.6 bits (43), Expect(2) = 1.8 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +3 / -1 Query: 240 WTWWKGG 260 W WW GG Sbjct: 492 WVWWYGG 472
>LOC_Os03g16000:12003.t01386:unspliced-genomic clathrin binding protein, putative, expressed| Length = 5190 Score = 27.6 bits (54), Expect(2) = 1.8 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 / +2 Query: 141 HHPHQHHPRNCQQLLRTARRRR 76 HH H HH RN +L A RR Sbjct: 206 HHHHHHHHRNRTKLGEAAE*RR 271 Score = 22.6 bits (43), Expect(2) = 1.8 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -1 / +2 Query: 156 GGIVEHHPHQHH 121 G I H PH HH Sbjct: 182 GPIHPHQPHHHH 217
>LOC_Os01g52130:12001.t04640:unspliced-genomic sulfate transporter 3.5, putative, expressed| Length = 6231 Score = 30.4 bits (60), Expect(2) = 1.8 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +3 / +2 Query: 201 CTTMKDFPVTWRWWTWWKGGC 263 CT P TWRW W + C Sbjct: 881 CTRCSGAPTTWRWGRWRRRRC 943 Score = 24.9 bits (48), Expect(2) = 1.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 / +2 Query: 420 PPRCNQGPACNIPSTTG 470 PPR P+C P+ TG Sbjct: 1322 PPRQTSSPSCTPPTITG 1372
>LOC_Os01g14932:12001.t01347:unspliced-genomic NAK-like ser/thr protein kinase, putative, expressed| Length = 8218 Score = 33.1 bits (66), Expect = 1.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 / -3 Query: 180 RNYLLDRCTTMKDFPVTWRWWTWW 251 RN+ ++ F V W WW WW Sbjct: 140 RNFFFFLSSSSSPFAVPWWWWWWW 69
>LOC_Os01g13700:12001.t01231:unspliced-genomic OB-fold nucleic acid binding domain containing protein, expressed| Length = 2697 Score = 33.1 bits (66), Expect = 1.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 / -1 Query: 231 WRWWTWWKGGCEE 269 W WW WW+GG E+ Sbjct: 39 WWWW*WWRGGGED 1
>LOC_Os03g44660:12003.t03854:unspliced-genomic cytosolic 5-nucleotidase III, putative, expressed| Length = 3881 Score = 26.7 bits (52), Expect(2) = 1.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 / +2 Query: 260 TSLPPCPPTP 231 +SLPPCPP P Sbjct: 149 SSLPPCPPPP 178 Score = 23.5 bits (45), Expect(2) = 1.8 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -1 / +3 Query: 123 HPRNCQQLLRTARRRRSLPKQADPRGRRP 37 H R+ + LR RRRR P+ RRP Sbjct: 180 HRRHQKPRLRRRRRRRPRPQGRRHPRRRP 266
>LOC_Os07g39020:12007.t03565:unspliced-genomic subtilisin-like protease precursor, putative, expressed| Length = 2447 Score = 33.1 bits (66), Expect = 1.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 / -2 Query: 120 PRNCQQLLRTARRRRSLPKQADPRGRRPSCC 28 PR C+ L R + RRR ++ RRP+CC Sbjct: 718 PRACRALRRPSGRRRRRTRRRRSPWRRPACC 626
>LOC_Os03g62200:12003.t05447:unspliced-genomic ammonium transporter 2, putative, expressed| Length = 3719 Score = 33.1 bits (66), Expect = 1.9 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = -1 / +3 Query: 156 GGIVEHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRRP 37 GG HP HH Q L A RRR + PR RRP Sbjct: 2937 GGARRQHPVVHHDDPPQALQDPAARRRHPRRLPHPRRRRP 3056
>LOC_Os01g48444:12001.t04289:unspliced-genomic OsIAA5 - Auxin-responsive Aux/IAA gene family member, expressed| Length = 3473 Score = 33.1 bits (66), Expect = 1.9 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -1 / +1 Query: 99 LRTARRRRSLPKQADPRGRRPSC 31 LR RRRRSLP Q PR R C Sbjct: 286 LRLRRRRRSLPGQGGPRRRSAGC 354
>LOC_Os12g10630:12012.t00941:unspliced-genomic ZF-HD homeobox protein, putative, expressed| Length = 3221 Score = 27.6 bits (54), Expect(2) = 1.9 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 / -1 Query: 237 WWTWWKGG 260 WW WW GG Sbjct: 1589 WWWWWSGG 1566 Score = 22.6 bits (43), Expect(2) = 1.9 Identities = 5/8 (62%), Positives = 5/8 (62%) Frame = +2 / -1 Query: 116 RGWCWWGW 139 R W WW W Sbjct: 1646 RWWWWWPW 1623
>LOC_Os03g38210:12003.t03270:unspliced-genomic myb-like DNA-binding domain containing protein, expressed| Length = 2953 Score = 26.3 bits (51), Expect(2) = 1.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -2 / +2 Query: 278 VKELFTTSLPPCPPTPG 228 + L+T +PP PP PG Sbjct: 704 MSSLWTQPMPPAPPRPG 754 Score = 24.0 bits (46), Expect(2) = 1.9 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 / +2 Query: 120 PRNCQQLLRTARRRRSLPKQADPRGRRPSCCQC 22 PR + L T S ++ R RRP C+C Sbjct: 857 PRGVSRSLGTRSSSSSRTRRPCRRRRRPGRCRC 955
>LOC_Os01g41120:12001.t03634:unspliced-genomic protein binding protein, putative, expressed| Length = 2099 Score = 25.8 bits (50), Expect(2) = 1.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +2 / -1 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 RR RAV W+ R W W W Sbjct: 1487 RRRRAVVHWRWRRRRWRRWRW 1425 Score = 24.4 bits (47), Expect(2) = 1.9 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +3 / -1 Query: 231 WRWWTW 248 WRWW W Sbjct: 1361 WRWWWW 1344 Score = 24.9 bits (48), Expect(2) = 6.2 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 / -1 Query: 80 RLRAVRRSCWQLRGWCWW 133 R R RR W R W WW Sbjct: 1454 RRRRWRRWRWWRRRWRWW 1401 Score = 23.5 bits (45), Expect(2) = 6.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 / -1 Query: 234 RWWTWWKGGCEELLHDCC 287 RWW W + +ELL C Sbjct: 1277 RWWRWRRRREDELLAPEC 1224
>LOC_Os12g42910:12012.t03964:unspliced-genomic K-exchanger-like protein, putative, expressed| Length = 2007 Score = 27.6 bits (54), Expect(2) = 1.9 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +2 / -3 Query: 77 RRLRAVRRSCWQLRGWCWWGW 139 RR R R W+ GW W W Sbjct: 1204 RRRRGGRPRAWRRGGWSLWWW 1142 Score = 22.6 bits (43), Expect(2) = 1.9 Identities = 5/10 (50%), Positives = 6/10 (60%) Frame = +3 / -3 Query: 231 WRWWTWWKGG 260 W W WW+ G Sbjct: 1150 WWWARWWRRG 1121
>LOC_Os01g41430:12001.t03663:unspliced-genomic flavonol-3-O-glycoside-7-O-glucosyltransferase 1, putative,| expressed Length = 1964 Score = 26.3 bits (51), Expect(2) = 1.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 / +3 Query: 120 PRNCQQLLRTARRRRSLPKQADPRGRR 40 P C++ RRR++P + P GRR Sbjct: 273 PWRCRRRTGDRHRRRAIPGRRAPAGRR 353 Score = 24.0 bits (46), Expect(2) = 1.9 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -1 / +3 Query: 132 HQHHPRNCQQ 103 H HHPR C++ Sbjct: 204 HPHHPRQCRR 233
>LOC_Os08g36410:12008.t03381:unspliced-genomic clathrin assembly protein, putative, expressed| Length = 1644 Score = 25.8 bits (50), Expect(2) = 2.0 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +3 / +1 Query: 237 WWTWWKG 257 WW WW+G Sbjct: 199 WWWWWRG 219 Score = 24.4 bits (47), Expect(2) = 2.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 / +1 Query: 80 RLRAVRRSCWQLRGWCWWGW 139 R+R R+ + R W WW W Sbjct: 154 RIRWHFRTDEEHRAWWWWWW 213
>LOC_Os01g10180:12001.t00893:unspliced-genomic avr9/Cf-9 rapidly elicited protein 146, putative, expressed| Length = 1239 Score = 31.3 bits (62), Expect(2) = 2.0 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -1 / +2 Query: 117 RNCQQLLRTARRRRSLPKQADPRGRRPSCC 28 R +Q LR ARR R P+ D + RR CC Sbjct: 563 RRRRQQLRRARRLRRGPRLRDAQRRRRGCC 652 Score = 21.7 bits (41), Expect(2) = 2.0 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = -1 / +1 Query: 147 VEHHPHQHHP 118 + H P QHHP Sbjct: 1 IHHPPIQHHP 30
>LOC_Os07g39080:12007.t03570:unspliced-genomic expressed protein| Length = 1257 Score = 25.8 bits (50), Expect(2) = 2.0 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -3 Query: 237 WWTWWKGG 260 WW WW+ G Sbjct: 154 WWWWWRAG 131 Score = 24.4 bits (47), Expect(2) = 2.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 / -3 Query: 95 RRSCWQLRGWCWWGW 139 RRS + RG WW W Sbjct: 190 RRSSPRPRGGAWWWW 146
>LOC_Os10g31440:12010.t02468:unspliced-genomic lipoprotein, putative, expressed| Length = 1037 Score = 25.4 bits (49), Expect(2) = 2.0 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 / +2 Query: 41 LLPRGSACFGSERRLRAVRRSCWQLRGWCW 130 L PR S C R R R + W++ W W Sbjct: 584 LWPRWSICSRRWTRWRWRRWTVWRVWAWFW 673 Score = 24.9 bits (48), Expect(2) = 2.0 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +3 / +2 Query: 231 WRWWTW 248 WRWW W Sbjct: 740 WRWWRW 757 Score = 27.2 bits (53), Expect(2) = 2.2 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +3 / +2 Query: 231 WRWWTWWK 254 WRWWT W+ Sbjct: 518 WRWWTKWR 541 Score = 25.4 bits (49), Expect(2) = 2.2 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +2 / +2 Query: 107 WQLRGWCWWG 136 W++RGW W G Sbjct: 164 WRVRGWFWMG 193
>LOC_Os06g21270:12006.t01944:unspliced-genomic glycine-rich cell wall structural protein precursor, putative,| expressed Length = 991 Score = 26.7 bits (52), Expect(2) = 2.0 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +2 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 566 WWWWWWWR 589 Score = 23.5 bits (45), Expect(2) = 2.0 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +2 / +2 Query: 92 VRRSCWQLRGWCWW 133 V R W+L W WW Sbjct: 518 VWRWIWRLWRWIWW 559
>LOC_Os10g31420:12010.t02467:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 934 Score = 26.3 bits (51), Expect(2) = 2.0 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 231 WRWWTWWK 254 WRWW W K Sbjct: 255 WRWWRWTK 278 Score = 24.0 bits (46), Expect(2) = 2.0 Identities = 6/14 (42%), Positives = 7/14 (50%) Frame = +2 / +3 Query: 98 RSCWQLRGWCWWGW 139 R W + W WW W Sbjct: 216 RLWWSIC*WRWWRW 257 Score = 24.9 bits (48), Expect(2) = 6.6 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +3 / +3 Query: 231 WRWWTW 248 WRWW W Sbjct: 240 WRWWRW 257 Score = 23.5 bits (45), Expect(2) = 6.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 / +3 Query: 80 RLRAVRRSCWQLRGWCWWG 136 R R RR W +R W W G Sbjct: 126 RRRWGRRRWWWVREWFWVG 182
>LOC_Os01g18440:12001.t01637:unspliced-genomic MADS-box transcription factor PHERES2, putative| Length = 921 Score = 25.8 bits (50), Expect(2) = 2.0 Identities = 5/7 (71%), Positives = 5/7 (71%) Frame = +3 / -2 Query: 231 WRWWTWW 251 W WW WW Sbjct: 668 WFWWWWW 648 Score = 24.4 bits (47), Expect(2) = 2.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 / -3 Query: 77 RRLRAVRRSCWQLR 118 RR R RRSCW+ R Sbjct: 796 RRHRCWRRSCWRRR 755
>LOC_Os03g47850:12003.t04147:unspliced-genomic conserved hypothetical protein| Length = 603 Score = 26.7 bits (52), Expect(2) = 2.1 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 / -1 Query: 302 LTQLTATIVKELFTTSLPPCPPTPGDR 222 + ++ +V E+ LPPCPP R Sbjct: 429 VVEVVVGVVVEVVERRLPPCPPPASPR 349 Score = 23.5 bits (45), Expect(2) = 2.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 / -3 Query: 132 HQHHPRNCQQLLRTARRRRSLPKQADPRGRRP 37 H+ H R + R RRR ++ RGRRP Sbjct: 226 HRRHRRGRRH*GRHRGRRRRGRRRGRRRGRRP 131
>LOC_Os03g30400:12003.t02649:unspliced-genomic early light-induced protein, chloroplast precursor, putative| Length = 1029 Score = 27.2 bits (53), Expect(2) = 2.2 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 / +3 Query: 119 GWCWWGWCSTMPPR 160 GW WWG C P R Sbjct: 402 GWRWWGSCRCSPWR 443 Score = 25.4 bits (49), Expect(2) = 2.2 Identities = 8/22 (36%), Positives = 9/22 (40%) Frame = +2 / +3 Query: 62 CFGSERRLRAVRRSCWQLRGWC 127 C+ L RR CW WC Sbjct: 9 CYHGAELLLRRRRRCWCAMAWC 74
>LOC_Os10g29720:12010.t02311:unspliced-genomic hypothetical protein| Length = 4191 Score = 30.4 bits (60), Expect(2) = 2.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 65 FGSERRLRAVRRSCWQLRGWCWWGW 139 FG+ +R R RR W+ R W W W Sbjct: 66 FGTWKRRRRQRRWRWRWRWWWRWRW 140 Score = 24.0 bits (46), Expect(2) = 2.3 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +3 / +3 Query: 447 CNIPSTTGYYW*CS 488 C +TG+YW CS Sbjct: 1356 CGPAKSTGWYWYCS 1397
>LOC_Os03g38440:12003.t03287:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3035 Score = 27.6 bits (54), Expect(2) = 2.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 / -2 Query: 56 SACFGSERRLRAVRRSCWQLRGWCW 130 S C+ S RR+ A R C + G W Sbjct: 232 SGCWRSNRRIEAAVRRCLDVTGAAW 158 Score = 26.3 bits (51), Expect(2) = 2.4 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 / -1 Query: 308 TAMPLQHHPGINPT 349 TA+P HHP NPT Sbjct: 80 TAVPPPHHPSPNPT 39
>LOC_Os07g10250:12007.t00899:unspliced-genomic ATP-dependent RNA helicase DED1, putative, expressed| Length = 6296 Score = 27.6 bits (54), Expect(2) = 2.4 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +2 / +2 Query: 128 WWGWCSTMPP 157 WW WC +PP Sbjct: 821 WWRWCMELPP 850 Score = 22.1 bits (42), Expect(2) = 2.4 Identities = 4/4 (100%), Positives = 4/4 (100%) Frame = +2 / +2 Query: 122 WCWW 133 WCWW Sbjct: 791 WCWW 802
>LOC_Os03g14890:12003.t01275:unspliced-genomic expressed protein| Length = 5635 Score = 26.3 bits (51), Expect(2) = 2.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 / +3 Query: 409 PRTCPPGATRALPATSPA 462 PR PP RALP+ +P+ Sbjct: 141 PRRPPPAVRRALPSAAPS 194 Score = 23.5 bits (45), Expect(2) = 2.4 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +2 / +2 Query: 569 KISKCAPPRC 598 +++ CAPPRC Sbjct: 239 RLNPCAPPRC 268
>LOC_Os11g01270:12011.t00027:unspliced-genomic expressed protein| Length = 4932 Score = 26.3 bits (51), Expect(2) = 2.4 Identities = 7/16 (43%), Positives = 7/16 (43%) Frame = +3 / -1 Query: 237 WWTWWKGGCEELLHDC 284 WW WW G E C Sbjct: 453 WWWWWVFGSAEACPSC 406 Score = 23.5 bits (45), Expect(2) = 2.4 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +2 / -1 Query: 113 LRGWCWWGW 139 +R W WW W Sbjct: 471 VRWWTWWWW 445
>LOC_Os07g25810:12007.t02277:unspliced-genomic expressed protein| Length = 1681 Score = 26.3 bits (51), Expect(3) = 2.4 Identities = 6/8 (75%), Positives = 6/8 (75%) Frame = +3 / +3 Query: 237 WWTWWKGG 260 WWTWW G Sbjct: 927 WWTWWGRG 950 Score = 22.6 bits (43), Expect(3) = 2.4 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +2 / +3 Query: 107 WQLRGWCW 130 W+ R WCW Sbjct: 531 WRHRTWCW 554 Score = 21.7 bits (41), Expect(3) = 2.4 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 / +3 Query: 56 SACFGSERRLRAVRRSCWQ 112 +AC S+ L + SCW+ Sbjct: 12 AACRSSQELLEFLLSSCWE 68
>LOC_Os12g39840:12012.t03663:unspliced-genomic expressed protein| Length = 3123 Score = 32.2 bits (64), Expect(2) = 2.5 Identities = 16/51 (31%), Positives = 23/51 (45%) Frame = -1 / -3 Query: 183 SCRNLALSLGGIVEHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRRPSC 31 +CR GG+ P Q HP ++ R + RS ++ R RRP C Sbjct: 184 TCRTRGRVTGGLPSPPPQQQHPPPRRRRRRRSSGARSRRRRRRRRRRRPWC 32 Score = 21.7 bits (41), Expect(2) = 2.5 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = -3 / -3 Query: 355 RSRWIDPW 332 RSRW +PW Sbjct: 316 RSRWGEPW 293
>LOC_Os11g47780:12011.t04272:unspliced-genomic pollen signalling protein with adenylyl cyclase activity, putative,| expressed Length = 3984 Score = 27.6 bits (54), Expect(2) = 2.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 / +1 Query: 141 HHPHQHHPRNCQQLLRTARRRRSLP 67 HH H+ +PR+ LL+ RR LP Sbjct: 1003 HHVHKLYPRDAWSLLKKQVRRVILP 1077 Score = 22.1 bits (42), Expect(2) = 2.5 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = -3 / +1 Query: 256 PFHHVHQ 236 PFHHVH+ Sbjct: 997 PFHHVHK 1017
>LOC_Os08g43410:12008.t04066:unspliced-genomic SHI, putative, expressed| Length = 1628 Score = 26.7 bits (52), Expect(2) = 2.5 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = +2 / -3 Query: 92 VRRSCWQLRGWCWWGW 139 + RS + R W WW W Sbjct: 828 IGRSMYLRRWWAWWRW 781 Score = 26.3 bits (51), Expect(2) = 2.5 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -2 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 106 WWWWWWWE 83
>LOC_Os12g40600:12012.t03739:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2755 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os12g26990:12012.t02412:unspliced-genomic hypothetical protein| Length = 1094 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 341 KWSLSQISRMTVKEWSTTSTTPCGP 415
>LOC_Os11g33020:12011.t02898:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3096 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +3 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2343 KWSLSQISRITVKEWSTTSTTPCGP 2417
>LOC_Os11g26100:12011.t02226:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2626 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os11g25920:12011.t02209:unspliced-genomic EMB1444, putative, expressed| Length = 4713 Score = 32.7 bits (65), Expect = 2.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / -2 Query: 104 CWQLRGWCWWGWCSTM 151 C G CWW WCS+M Sbjct: 4121 CGAAIGCCWWWWCSSM 4074
>LOC_Os11g23020:12011.t01972:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3079 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os11g20570:12011.t01826:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3095 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os11g19200:12011.t01689:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3116 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2363 KWSLSQISRMTVKEWSTTSTTPCGP 2437
>LOC_Os11g01370:12011.t00037:unspliced-genomic expressed protein| Length = 4599 Score = 32.7 bits (65), Expect = 2.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 / -3 Query: 225 VTWRWWTWWKG 257 V W WW WWKG Sbjct: 238 VRWWWWLWWKG 206
>LOC_Os10g39000:12010.t03142:unspliced-genomic expressed protein| Length = 1404 Score = 32.7 bits (65), Expect = 2.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 / -1 Query: 225 VTWRWWTWWKGGC 263 V W WW WW G C Sbjct: 63 VPWWWWRWWLGQC 25
>LOC_Os10g23950:12010.t01821:unspliced-genomic hypothetical protein| Length = 1094 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 341 KWSLSQISRMTVKEWSTTSTTPCGP 415
>LOC_Os10g17980:12010.t01354:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3827 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 3074 KWSLSQISRMTVKEWSTTSTTPCGP 3148
>LOC_Os10g14120:12010.t01132:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3088 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os10g07000:12010.t00563:unspliced-genomic hypothetical protein| Length = 673 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 341 KWSLSQISRMTVKEWSTTSTTPCGP 415
>LOC_Os10g04140:12010.t00303:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7453 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os09g37012:12009.t03177:unspliced-genomic aspartic-type endopeptidase/ pepsin A, putative, expressed| Length = 3672 Score = 32.7 bits (65), Expect = 2.5 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 / +2 Query: 219 FPVTWRWWTWWKGGC 263 F ++ WW WW GGC Sbjct: 17 FVASYGWWWWWCGGC 61
>LOC_Os09g23640:12009.t02048:unspliced-genomic ABC-2 type transporter family protein| Length = 3671 Score = 32.7 bits (65), Expect = 2.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +2 / +1 Query: 50 RGSACFGSERRLRAVRRSCWQLRGWCWWGWCSTMPP 157 R C G+ RRSC L WC W S+ PP Sbjct: 2788 RWRCCRGARCSTWCARRSCSSLGRWCSRRWRSSSPP 2895
>LOC_Os09g04000:12009.t00296:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3095 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os09g02480:12009.t00147:unspliced-genomic hypothetical protein| Length = 1094 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 341 KWSLSQISKMTVKEWSTTSTTPCGP 415
>LOC_Os08g31380:12008.t02887:unspliced-genomic hypothetical protein| Length = 952 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 200 KWSLSQISRMTVKEWSTTSTTPCGP 274
>LOC_Os08g26930:12008.t02457:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3116 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2246 KWSLSQISRMTVKEWSTTSTTPCGP 2320
>LOC_Os08g16420:12008.t01515:unspliced-genomic hypothetical protein| Length = 2929 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2348 KWSLSQISRMTVKEWSTTSTTPCGP 2422
>LOC_Os08g13140:12008.t01192:unspliced-genomic hypothetical protein| Length = 453 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 341 KWSLSQISRMTVKEWSTTSTTPCGP 415
>LOC_Os07g34500:12007.t03126:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3095 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os07g29030:12007.t02593:unspliced-genomic hypothetical protein| Length = 2421 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 1699 KWSLSQISRMTVKEWSTTSTTPCGP 1773
>LOC_Os07g18520:12007.t01711:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3095 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os07g15310:12007.t01394:unspliced-genomic hypothetical protein| Length = 640 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 341 KWSLSQISRMTVKEWSTTSTTPCGP 415
>LOC_Os06g32674:12006.t02965:unspliced-genomic hypothetical protein| Length = 2397 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 461 KWSLSQISRMTVKEWSTTSTTPCGP 535
>LOC_Os06g21300:12006.t01947:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3094 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISKMTVKEWSTTSTTPCGP 2416
>LOC_Os06g21080:12006.t01925:unspliced-genomic hypothetical protein| Length = 1993 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 1240 KWSLSQISKMTVKEWSTTSTTPCGP 1314
>LOC_Os05g51280:12005.t04556:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3117 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +3 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2364 KWSLSQISRMTVKEWSTTSTTPCGP 2438
>LOC_Os05g48820:12005.t04316:unspliced-genomic DDT domain containing protein, expressed| Length = 10708 Score = 32.7 bits (65), Expect = 2.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 / +3 Query: 231 WRWWTWWKG 257 WRWW WW G Sbjct: 10362 WRWWRWWSG 10388
>LOC_Os05g35090:12005.t03102:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2673 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2341 KWSLSQISRMTVKEWSTTSTTPCGP 2415
>LOC_Os05g28430:12005.t02491:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3094 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2341 KWSLSQISRMTVKEWSTTSTTPCGP 2415
>LOC_Os05g04830:12005.t00377:unspliced-genomic expressed protein| Length = 2200 Score = 32.7 bits (65), Expect = 2.5 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +2 / -1 Query: 77 RRLRAVRRSCWQLRGWCWWG 136 RR R RR C R WC WG Sbjct: 766 RRRRGRRRRCCSCRSWCGWG 707
>LOC_Os04g49950:12004.t04508:unspliced-genomic F-box domain containing protein, expressed| Length = 6076 Score = 32.7 bits (65), Expect = 2.5 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +2 / +3 Query: 95 RRSCWQLRGWCWWG 136 R SCW LR WCW G Sbjct: 1428 RFSCWCLRRWCWTG 1469
>LOC_Os04g25700:12004.t02277:unspliced-genomic hypothetical protein| Length = 1234 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 341 KWSLSQISRMTVKEWSTTSTTPCGP 415
>LOC_Os04g22090:12004.t01940:unspliced-genomic NB-ARC domain containing protein, expressed| Length = 5477 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 / +1 Query: 243 TWWKGGCEELLHDCCSQLSQMPPQCRCNIIQGSIQRDL 356 +WW ++HD L+++ Q C I GS R+L Sbjct: 1174 SWWSSSVVFVMHDLMHDLARLVSQTECATIDGSECREL 1287
>LOC_Os03g57820:12003.t05043:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3095 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2342 KWSLSQISRMTVKEWSTTSTTPCGP 2416
>LOC_Os03g45480:12003.t03923:unspliced-genomic hypothetical protein| Length = 2146 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 1393 KWSLSQISRMTVKEWSTTSTTPCGP 1467
>LOC_Os03g37736:12003.t03226:unspliced-genomic hypothetical protein| Length = 1204 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 988 KWSLSQISRMTVKEWSTTSTTPCGP 1062
>LOC_Os03g27670:12003.t02440:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 2932 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2179 KWSLSQISRMTVKEWSTTSTTPCGP 2253
>LOC_Os03g13890:12003.t01182:unspliced-genomic hypothetical protein| Length = 2316 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +3 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 1563 KWSLSQISRMTVKEWSTTSTTPCGP 1637
>LOC_Os02g34210:12002.t03061:unspliced-genomic hypothetical protein| Length = 1952 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 1199 KWSLSQISRMTVKEWSTTSTTPCGP 1273
>LOC_Os02g07620:12002.t00659:unspliced-genomic hypothetical protein| Length = 3094 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 2341 KWSLSQISRMTVKEWSTTSTTPCGP 2415
>LOC_Os01g34290:12001.t02988:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6964 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +1 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 6211 KWSLSQISRMTVKEWSTTSTTPCGP 6285
>LOC_Os02g11110:12002.t00959:unspliced-genomic flavonol-3-O-glycoside-7-O-glucosyltransferase 1, putative,| expressed Length = 2303 Score = 27.2 bits (53), Expect(2) = 2.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 / -1 Query: 93 TARRRRSLPKQADPRGRRPSCC 28 TAR RR+ + R RRP+CC Sbjct: 524 TARGRRAAGCRGSGRLRRPTCC 459 Score = 26.3 bits (51), Expect(2) = 2.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 / -2 Query: 141 HHPHQHHPRNCQQLLRTARRRR 76 HHP P NCQ LL RR Sbjct: 1381 HHPRDVTPINCQVLLVQHAHRR 1316
>LOC_Os08g07010:12008.t00590:unspliced-genomic ABC-2 type transporter family protein, expressed| Length = 5116 Score = 32.7 bits (65), Expect = 2.5 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -1 / +1 Query: 135 PHQHHPRNCQQLLRTARRRRSLPKQADP 52 PH+H R ++ LR RRRR+LP++ P Sbjct: 4513 PHRHPVRRRRRPLRLRRRRRALPRRRLP 4596
>LOC_Os06g45540:12006.t04242:unspliced-genomic zinc-binding protein, putative, expressed| Length = 4417 Score = 32.7 bits (65), Expect = 2.5 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -1 / +2 Query: 123 HPRNCQQLLRTARRRRSLPKQADPRGRR 40 HP + ++LLR AR RR LP +P RR Sbjct: 3653 HPLHVRRLLRRARPRRRLPALREPPRRR 3736
>LOC_Os05g35120:12005.t03105:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7160 Score = 32.7 bits (65), Expect = 2.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 / +2 Query: 311 RWHLTQLTATIVKELFTTSLPPCPP 237 +W L+Q++ VKE TTS PC P Sbjct: 6407 KWSLSQISRMTVKEWSTTSTTPCGP 6481 Score = 24.4 bits (47), Expect(2) = 5.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 / +1 Query: 287 ATIVKELFTTSLPPCPPTP 231 AT+ + L T + PP PP+P Sbjct: 2953 ATVSRLLRTLAPPPTPPSP 3009 Score = 24.0 bits (46), Expect(2) = 5.7 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 / +3 Query: 162 SLGGIVEHHPHQHHPRNCQQLLRTARRR 79 S +V H H+H R+ + R RRR Sbjct: 3000 SFAAVVLPHRHRHRDRHHRHRARRHRRR 3083
>LOC_Os03g50600:12003.t04400:unspliced-genomic hypothetical protein| Length = 381 Score = 32.7 bits (65), Expect = 2.5 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = -1 / -1 Query: 201 IDLAGNSCRNLALSLGGIVEHHPHQHHPRNCQQLLRTARRRR 76 +D+ G + R A+ GG++ HQ PR +L + +RRRR Sbjct: 351 VDVVGVARRPRAVVRGGVLPCRHHQKPPRRVPRLPQYSRRRR 226
>LOC_Os02g36440:12002.t03281:unspliced-genomic sugar transport protein 5, putative, expressed| Length = 4628 Score = 32.7 bits (65), Expect = 2.5 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = -1 / +1 Query: 144 EHHPHQHHPRNCQQLLRTARRRRSLPKQA 58 E HP HH R Q LR RR R P +A Sbjct: 3802 EGHPRVHHHRRRQHRLRRCRRGRGRPPRA 3888
>LOC_Os10g31040:12010.t02434:unspliced-genomic arsenite transport protein, putative, expressed| Length = 13444 Score = 26.3 bits (51), Expect(3) = 2.7 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -1 / +3 Query: 477 SNSQ*CWGCCRQGPGCTWGA 418 S S CW C R+ C W A Sbjct: 10296 SRSSGCWPCSRRCRSCRWVA 10355 Score = 25.8 bits (50), Expect(3) = 2.7 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -1 / +2 Query: 156 GGIVEHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRRP 37 G + HP + PR +Q R +R ++ +PR R P Sbjct: 10940 GHLAPVHPGEDVPRVVRQRQRLHQRAHPPEREHEPRRRAP 11059 Score = 24.0 bits (46), Expect(3) = 2.7 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -2 / +1 Query: 638 FFFFFGHIEMFAIDTSVAHI*KFYPYIIPRPL 543 FFF+ + D V HI FYP PL Sbjct: 6295 FFFYMLSFAIAIGDRPVGHIFFFYPVCHVHPL 6390
>LOC_Os05g24300:12005.t02087:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 1273 Score = 26.7 bits (52), Expect(2) = 2.7 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -1 / -1 Query: 459 WGCCRQGPGCTW 424 W CC G GC W Sbjct: 652 WNCCYCGRGCHW 617 Score = 23.1 bits (44), Expect(2) = 2.7 Identities = 5/11 (45%), Positives = 8/11 (72%) Frame = -3 / -1 Query: 355 RSRWIDPWMML 323 R W+DPW ++ Sbjct: 595 RCHWLDPWRLM 563
>LOC_Os01g03320:12001.t00224:unspliced-genomic Bowman-Birk type bran trypsin inhibitor precursor, putative,| expressed Length = 952 Score = 26.7 bits (52), Expect(2) = 2.7 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 / -1 Query: 234 RWWTWWKGGC 263 RWW WW+ C Sbjct: 193 RWWWWWR*RC 164 Score = 23.1 bits (44), Expect(2) = 2.7 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +2 / -1 Query: 95 RRSCWQLRGWCWWGW 139 RR CW C W W Sbjct: 226 RRRCWGGECCCRWWW 182
>LOC_Os10g31640:12010.t02487:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 863 Score = 25.8 bits (50), Expect(2) = 2.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 / +1 Query: 62 CFGSERRLRAVRRSCWQLRGWCW 130 C+G RL+ R CW+ R W Sbjct: 208 CWGCTERLKWCPRYCWRWRWRWW 276 Score = 24.0 bits (46), Expect(2) = 2.7 Identities = 5/10 (50%), Positives = 6/10 (60%) Frame = +3 / +1 Query: 222 PVTWRWWTWW 251 P+ W W WW Sbjct: 283 PIRWIWGGWW 312
>LOC_Os10g26950:12010.t02103:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3638 Score = 31.8 bits (63), Expect(2) = 2.8 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +2 / +2 Query: 53 GSACFGSERRLRAVRRSCWQLRGWCWW 133 G +G RR R + R W+ GW WW Sbjct: 947 GRRQWGWRRRTRLLWRGWWRRLGWGWW 1027 Score = 22.1 bits (42), Expect(2) = 2.8 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 / +3 Query: 420 PPRCNQGPACNIPSTT 467 PP+ + C+ PSTT Sbjct: 2127 PPKMEKPNGCSAPSTT 2174
>LOC_Os01g60730:12001.t05454:unspliced-genomic RING-H2 finger protein ATL5A, putative, expressed| Length = 1362 Score = 29.9 bits (59), Expect(2) = 2.9 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -1 / +2 Query: 150 IVEHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRRP 37 ++ H P PR Q RRRR A RGRRP Sbjct: 851 LLPHVPGLRPPRRHHQAQTNRRRRRRGQPAAGERGRRP 964 Score = 22.6 bits (43), Expect(2) = 2.9 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = -1 / +1 Query: 459 WGCCRQGPGCTWG 421 WGC R TWG Sbjct: 373 WGCTRSR*AGTWG 411
>LOC_Os12g34360:12012.t03125:unspliced-genomic expressed protein| Length = 2683 Score = 29.5 bits (58), Expect(2) = 2.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -1 / +3 Query: 147 VEHHPHQHHPRNCQQLLRTARRRRSLPKQADPRGRRP 37 V H P + +LLR RR LP++A R R P Sbjct: 969 VRRREHLRRPPDGPRLLRRGAPRRGLPRRAAHRRRDP 1079 Score = 24.0 bits (46), Expect(2) = 2.9 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 / +1 Query: 355 RSRWIDPWMMLQRHCGGI 302 R RW W L RH G + Sbjct: 622 RRRWRISWSFLSRHVGRV 675
>LOC_Os04g17130:12004.t01465:unspliced-genomic formin Homology 2 Domain containing protein| Length = 10501 Score = 26.3 bits (51), Expect(2) = 3.1 Identities = 5/7 (71%), Positives = 7/7 (100%) Frame = +3 / -1 Query: 228 TWRWWTW 248 +WRWW+W Sbjct: 5389 SWRWWSW 5369 Score = 23.1 bits (44), Expect(2) = 3.1 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +2 / -1 Query: 77 RRLRAVRRSCWQLRGWCWW 133 RR R RGW WW Sbjct: 5494 RRGRGATYPTMSSRGWRWW 5438
>LOC_Os02g10660:12002.t00914:unspliced-genomic glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed| Length = 2909 Score = 29.5 bits (58), Expect(2) = 3.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 / -3 Query: 141 HHPHQHHPRNCQQLLRTARRRR 76 HH QHHP + R RRRR Sbjct: 594 HHQQQHHPATPKHHRRRRRRRR 529 Score = 24.0 bits (46), Expect(2) = 3.1 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 / -2 Query: 263 TTSLPPCPPTPG 228 T S PP PP+PG Sbjct: 1381 TRSPPPSPPSPG 1346 Score = 30.9 bits (61), Expect = 9.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 / +2 Query: 125 CWWGWCSTMPPR 160 CWW WCS PR Sbjct: 584 CWWWWCSGCSPR 619
>LOC_Os03g23800:12003.t02075:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass, expressed| Length = 6735 Score = 24.9 bits (48), Expect(2) = 3.2 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / -1 Query: 237 WWTWWKGG 260 WW WW+ G Sbjct: 2328 WWWWWRRG 2305 Score = 24.4 bits (47), Expect(2) = 3.2 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / -1 Query: 216 DFPVTWRWW 242 +F V WRWW Sbjct: 2457 EFRVLWRWW 2431
>LOC_Os02g15560:12002.t01349:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 5606 Score = 25.8 bits (50), Expect(2) = 3.2 Identities = 5/8 (62%), Positives = 6/8 (75%) Frame = +3 / +2 Query: 231 WRWWTWWK 254 W WW WW+ Sbjct: 2900 WCWW*WWR 2923 Score = 23.5 bits (45), Expect(2) = 3.2 Identities = 5/18 (27%), Positives = 10/18 (55%) Frame = +2 / +2 Query: 86 RAVRRSCWQLRGWCWWGW 139 ++ R ++ + W WW W Sbjct: 2822 KSQREGKFKFKWWWWWWW 2875 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 320,662,798 Number of extensions: 6117823 Number of successful extensions: 48030 Number of sequences better than 10.0: 488 Length of query: 214 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 166 Effective length of database: 52,912,542 Effective search space: 8783481972 Effective search space used: 8783481972 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
