| Clone Name | FLbaf65o16 |
|---|---|
| Clone Library Name | barley_pub |
>Q9WV48:SHAN1_RAT SH3 and multiple ankyrin repeat domains protein 1 - Rattus norvegicus| (Rat) Length = 2167 Score = 30.4 bits (67), Expect = 3.3 Identities = 18/56 (32%), Positives = 22/56 (39%), Gaps = 5/56 (8%) Frame = -1 Query: 205 TEDGGR---LLH--VLPQQHHRRAHAYNRQDQVGQRHRRPTNSPQNPSARRGSSPE 53 T GGR L H LP HH H ++ Q H + P P G SP+ Sbjct: 986 TRGGGREKSLYHSAALPPAHHHPPHHHHHHAPPPQPHHHHAHPPHPPEMETGGSPD 1041
>Q4V887:S39A6_RAT Zinc transporter SLC39A6 precursor - Rattus norvegicus (Rat)| Length = 741 Score = 29.3 bits (64), Expect = 7.4 Identities = 18/60 (30%), Positives = 26/60 (43%) Frame = -1 Query: 211 VATEDGGRLLHVLPQQHHRRAHAYNRQDQVGQRHRRPTNSPQNPSARRGSSPEFGARKGL 32 V T G LLH+LP H H+++ ++ + R P S + SS KGL Sbjct: 352 VGTLSGDALLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSAQNLEESSYFDSTWKGL 411
>Q8C145:S39A6_MOUSE Zinc transporter SLC39A6 precursor - Mus musculus (Mouse)| Length = 765 Score = 29.3 bits (64), Expect = 7.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 211 VATEDGGRLLHVLPQQHHRRAHAYNRQDQVGQRHRRP 101 V T G LLH+LP H H+++ ++ + R P Sbjct: 376 VGTLSGDALLHLLPHSHASHQHSHSHEEPAMEMKRGP 412
>Q9P889:CREA_ASPOR DNA-binding protein creA - Aspergillus oryzae| Length = 429 Score = 28.9 bits (63), Expect = 9.6 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -1 Query: 160 HRRAHAYNRQDQVGQRHRRPTNSPQNPSARRGSSPEF 50 H + +++ +D+ G HR + P +P++ SSP F Sbjct: 269 HSMSRSHSHEDEDGYTHRVKRSRPNSPNSTAPSSPTF 305
>Q6SZ61:CD2_MACFA T-cell surface antigen CD2 precursor - Macaca fascicularis (Crab| eating macaque) (Cynomolgus monkey) Length = 351 Score = 28.9 bits (63), Expect = 9.6 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -1 Query: 154 RAHAYNRQDQVGQRHRRPTNSPQNPSARRGSSPEFGAR 41 RAH +++ + H+ P ++PQNP+A + P G R Sbjct: 252 RAHRVATEERGRKPHQIPASTPQNPAASQHPPPPPGHR 289 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 79,106,272 Number of extensions: 1555270 Number of successful extensions: 4890 Number of sequences better than 10.0: 5 Number of HSP's gapped: 4882 Number of HSP's successfully gapped: 5 Length of query: 163 Length of database: 100,686,439 Length adjustment: 104 Effective length of query: 59 Effective length of database: 72,159,759 Effective search space: 4257425781 Effective search space used: 4257425781 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)