| Clone Name | FLbaf60o18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | P33485:VNUA_PRVKA Probable nuclear antigen - Pseudorabies virus ... | 35 | 1.3 | 2 | P22807:SLOU_DROME Homeobox protein slou - Drosophila melanogaste... | 35 | 2.3 | 3 | Q10180:MU113_SCHPO Meiotically up-regulated gene 113 protein - S... | 33 | 8.7 | 4 | Q6BSP4:BBP_DEBHA Branchpoint-bridging protein - Debaryomyces han... | 33 | 8.7 |
|---|
>P33485:VNUA_PRVKA Probable nuclear antigen - Pseudorabies virus (strain Kaplan) (PRV)| Length = 1733 Score = 35.4 bits (80), Expect = 1.3 Identities = 44/137 (32%), Positives = 51/137 (37%), Gaps = 5/137 (3%) Frame = -1 Query: 873 GSISCLRSRKLPTISGQSSKKCWCFLGFVGVASPGRSEGKANT-RRQRPDGWHDRGALPG 697 G+ R R P G ++ L V A P G A RR RP G G+ P Sbjct: 1551 GAPGAKRPRIEPPRGGGLVEQGLAVLVMVTTAVPSGGGGAAAAGRRDRPGGGGGWGSGPP 1610 Query: 696 TAR-WRHRGAASWWSWTERERLLTAVCRRPTVIDSSHGTGGDGERRCRRAW-ARLGVVAG 523 R HR WW R R RRP + D GG R CR A A G G Sbjct: 1611 PCRRCGHRCWLCWWRRGPRPR------RRPGLTDRVPPRGGPSPRGCRGAGRAGGGGRGG 1664 Query: 522 LWEGHDQGSS--PILCR 478 G G++ P LCR Sbjct: 1665 CGGGRAPGAAGGPGLCR 1681
>P22807:SLOU_DROME Homeobox protein slou - Drosophila melanogaster (Fruit fly)| Length = 659 Score = 34.7 bits (78), Expect = 2.3 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = +3 Query: 150 PKVAPEPTILLHLQLVSSTVTPPPKIAPEPTS*VAEHHRRLLLLPATACHPAMHDESSCT 329 P P P+ + HL+ SS+ T PP A P S P T+ PAMH + + Sbjct: 228 PHPHPHPSAVFHLRAPSSSSTAPPSPATSPLS------------PPTS--PAMHSDQQMS 273 Query: 330 SPVHP 344 P+ P Sbjct: 274 PPIAP 278
>Q10180:MU113_SCHPO Meiotically up-regulated gene 113 protein - Schizosaccharomyces| pombe (Fission yeast) Length = 326 Score = 32.7 bits (73), Expect = 8.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 844 FPGPETRN*PCMLYVLISKLIHPQLNLYLIEKESFVC 954 FP P + PC + + +L+H +LN YL + F C Sbjct: 253 FPDPGKTSKPCQVSFKVERLVHKELNEYLSWMQPFTC 289
>Q6BSP4:BBP_DEBHA Branchpoint-bridging protein - Debaryomyces hansenii (Yeast)| (Torulaspora hansenii) Length = 518 Score = 32.7 bits (73), Expect = 8.7 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 637 PLSFSPAPPASCSTMTPPRSSRQCSPVVPA-IRPLSPGVGLSFTTPRTSN 783 P S +P PP S PP SS + P P+ I P P G++ P++ N Sbjct: 441 PSSLAPPPPPSSDIAPPPPSSDRAPPPPPSGIAPPPPPSGIAPPPPKSPN 490 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 479,671,040 Number of extensions: 10402918 Number of successful extensions: 26754 Number of sequences better than 10.0: 4 Number of HSP's gapped: 26670 Number of HSP's successfully gapped: 4 Length of query: 956 Length of database: 100,686,439 Length adjustment: 123 Effective length of query: 833 Effective length of database: 66,948,154 Effective search space: 55767812282 Effective search space used: 55767812282 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)