| Clone Name | FLbaf63d21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q5K651:SAMD9_HUMAN Sterile alpha motif domain-containing protein... | 30 | 9.5 |
|---|
>Q5K651:SAMD9_HUMAN Sterile alpha motif domain-containing protein 9 - Homo sapiens| (Human) Length = 1589 Score = 29.6 bits (65), Expect = 9.5 Identities = 21/56 (37%), Positives = 28/56 (50%) Frame = -2 Query: 524 TATYIICVEHRHPGLMLLLPPRKPIKFRAS*SHHSDRTEK*KWWRRRAFFFSIESW 357 TA IIC E+ G +L K ++F+AS R K WW F+FS ES+ Sbjct: 650 TALEIIC-ENECEGTLLEKDKNKFLEFKASKEEDFYRGGKVSWWN---FYFSSESY 701 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 88,491,300 Number of extensions: 1577844 Number of successful extensions: 2944 Number of sequences better than 10.0: 1 Number of HSP's gapped: 2944 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 100,686,439 Length adjustment: 108 Effective length of query: 102 Effective length of database: 71,062,579 Effective search space: 7248383058 Effective search space used: 7248383058 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)