ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf63b02 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os01g48770:12001.t04319:unspliced-genomic 60S ribosomal protein L37a, putative, expressed| Length = 2585 Score = 77.6 bits (163), Expect(4) = 5e-42 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 / +2 Query: 124 GTRYGASLRKQIKKMEVSQHSKYFCEFCGK 213 GTRYGASLRKQIKKMEVSQHSKYFCEFCGK Sbjct: 1067 GTRYGASLRKQIKKMEVSQHSKYFCEFCGK 1156 Score = 72.1 bits (151), Expect(4) = 5e-42 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 / +2 Query: 211 KFAVKRKAVGIWGCKDCGKVKAGGAYTM 294 +FAVKRKAVGIWGCKDCGKVKAGGAYTM Sbjct: 1949 QFAVKRKAVGIWGCKDCGKVKAGGAYTM 2032 Score = 46.0 bits (94), Expect(4) = 5e-42 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = +1 / +2 Query: 295 NTASAVTVRSTIRRLREQTEA*V 363 +TASAVTVRSTIRRLREQTEA*+ Sbjct: 2123 STASAVTVRSTIRRLREQTEA*L 2191 Score = 38.2 bits (77), Expect(4) = 5e-42 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +3 / +3 Query: 84 DEAYQESWNCRQIWY 128 DEA+QE WNC QIWY Sbjct: 948 DEAHQEGWNCWQIWY 992 Score = 62.5 bits (130), Expect(4) = 1e-33 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 / -3 Query: 212 FPQNSQKYFEC*DTSIFLICLRRLAP*RVPYL 117 FPQNSQKY EC*+TSIFLICLR+LAP VP + Sbjct: 1155 FPQNSQKYLEC*ETSIFLICLRKLAPYLVPII 1060 Score = 62.0 bits (129), Expect(4) = 1e-33 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -3 / -2 Query: 297 VHGVSTASLHLPTVLASPNSNCFPLHSK 214 +HGVST LHLPTVLASP+SNCFPLH K Sbjct: 2035 LHGVSTTGLHLPTVLASPDSNCFPLHGK 1952 Score = 42.8 bits (87), Expect(4) = 1e-33 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -1 / -3 Query: 356 ASVCSLKRRIVLLTVTALAV 297 ASVCSL+RRIVLLTVTALAV Sbjct: 2184 ASVCSLRRRIVLLTVTALAV 2125 Score = 38.2 bits (77), Expect(4) = 1e-33 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -1 / -1 Query: 128 VPYLPTIPAFLVRFV 84 +PYLPTIPAFLVRFV Sbjct: 992 IPYLPTIPAFLVRFV 948 Score = 50.1 bits (103), Expect(4) = 2e-22 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 / +1 Query: 240 NLGMQGLWEGEGWRCLHHEHC 302 NLGMQGLWEGEG CLHHE C Sbjct: 1978 NLGMQGLWEGEGRWCLHHEVC 2040 Score = 41.4 bits (84), Expect(4) = 2e-22 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +3 / +1 Query: 294 EHCQRGHCQEHYPSLEGTD*SI 359 +HC GHCQEH PS EG D*S+ Sbjct: 2122 QHC*CGHCQEHNPSSEGAD*SL 2187 Score = 38.2 bits (77), Expect(4) = 2e-22 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +3 / +1 Query: 126 YTLWCQSA*ADQEDGGVSALK 188 Y +WCQ A*A+QEDGG SAL+ Sbjct: 1069 Y*VWCQFA*ANQEDGGFSALQ 1131 Score = 36.8 bits (74), Expect(4) = 2e-22 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 / +1 Query: 85 TKRTKKAGIVGKYGTRY 135 TKRTKKAGIVGKYG + Sbjct: 949 TKRTKKAGIVGKYGMEF 999 Score = 72.1 bits (151), Expect(3) = 2e-19 Identities = 30/39 (76%), Positives = 31/39 (79%) Frame = -1 / -3 Query: 296 FMV*APPAFTFPQSLHPQIPTAFLFTANFPQNSQKYFEC 180 FMV*APPAFTFPQSLHPQIPTAFLFTAN Q+ C Sbjct: 2034 FMV*APPAFTFPQSLHPQIPTAFLFTANCNSTQQQQH*C 1918 Score = 35.9 bits (72), Expect(3) = 2e-19 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 / -2 Query: 354 FSLFPQATDSAPDSDRAGS 298 FSL PQ TD APDSDR S Sbjct: 2182 FSLLPQTTDCAPDSDRTSS 2126 Score = 29.9 bits (59), Expect(3) = 2e-19 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 / -2 Query: 127 YHICRQFQLSWYA 89 YHIC+QFQ SW A Sbjct: 991 YHICQQFQPSWCA 953 Score = 71.2 bits (149), Expect(3) = 5e-18 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -2 / -1 Query: 295 SWCKHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAE 176 SWCKH +PSPSHSPCIP+FQLLSSS+QT + S+++A+ Sbjct: 2033 SWCKHHRPSPSHSPCIPRFQLLSSSRQTVIAHNNSSINAK 1914 Score = 35.0 bits (70), Expect(3) = 5e-18 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -2 / -1 Query: 361 LMLQSVPSSDG*CS*Q*PRWQC 296 + LQS PS DG CS*Q*P QC Sbjct: 2189 IRLQSAPSDDGLCS*Q*PH*QC 2124 Score = 27.2 bits (53), Expect(3) = 5e-18 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 / -3 Query: 126 TIFADNSSFLGTLR 85 TIFA+NSS LG LR Sbjct: 990 TIFANNSSLLGALR 949 Score = 46.9 bits (96), Expect(4) = 6e-14 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = +2 / +3 Query: 224 RGKQLEFGDARTVGR*RLAVLTP*TL 301 RGKQLE GDARTVGR*R VLTP*++ Sbjct: 1962 RGKQLESGDARTVGR*RPVVLTP*SM 2039 Score = 34.5 bits (69), Expect(4) = 6e-14 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +2 / +3 Query: 134 MVPVCVSRSRRWR 172 MVPVCVS+SRRWR Sbjct: 1077 MVPVCVSKSRRWR 1115 Score = 28.6 bits (56), Expect(4) = 6e-14 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +2 / +3 Query: 299 LPARSLSGALSVA*GNRLK 355 L RSLSGA SV *G+RLK Sbjct: 2127 LLVRSLSGAQSVV*GSRLK 2183 Score = 27.2 bits (53), Expect(4) = 6e-14 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 86 RSVPRKLELSANMV 127 RS PR+LEL ANMV Sbjct: 950 RSAPRRLELLANMV 991 Score = 58.3 bits (121), Expect = 4e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 / -1 Query: 211 SHRTHRSTLSAETPPSS*SAYADWHHNVY 125 SHRTHRST SAE PPSS* AYA+WHH Y Sbjct: 1154 SHRTHRSTWSAEKPPSS*FAYANWHHT*Y 1068
>LOC_Os05g48320:12005.t04266:unspliced-genomic 60S ribosomal protein L37a, putative, expressed| Length = 2118 Score = 79.0 bits (166), Expect(4) = 8e-42 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 / +2 Query: 124 GTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKR 228 GTRYGASLRKQIKKMEVSQHSKYFCEFCGK + R Sbjct: 1058 GTRYGASLRKQIKKMEVSQHSKYFCEFCGKVILPR 1162 Score = 72.1 bits (151), Expect(4) = 8e-42 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 / +3 Query: 211 KFAVKRKAVGIWGCKDCGKVKAGGAYTM 294 +FAVKRKAVGIWGCKDCGKVKAGGAYTM Sbjct: 1644 QFAVKRKAVGIWGCKDCGKVKAGGAYTM 1727 Score = 45.5 bits (93), Expect(4) = 8e-42 Identities = 21/22 (95%), Positives = 22/22 (100%) Frame = +1 / +2 Query: 295 NTASAVTVRSTIRRLREQTEA* 360 +TASAVTVRSTIRRLREQTEA* Sbjct: 1799 STASAVTVRSTIRRLREQTEA* 1864 Score = 35.9 bits (72), Expect(4) = 8e-42 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +1 / +3 Query: 85 TKRTKKAGIVGKYG 126 TKRTKKAGIVGKYG Sbjct: 921 TKRTKKAGIVGKYG 962 Score = 64.8 bits (135), Expect(3) = 1e-21 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = -2 / -1 Query: 295 SWCKHRQPSPSHSPCIPKFQLLSSSQQT 212 SWC+H QP P HSPCIP+FQLLSSSQQT Sbjct: 1728 SWCRHHQP*PCHSPCIPRFQLLSSSQQT 1645 Score = 42.8 bits (87), Expect(3) = 1e-21 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -1 / -1 Query: 356 ASVCSLKRRIVLLTVTALAV 297 ASVCSL+RRIVLLTVTALAV Sbjct: 1860 ASVCSLRRRIVLLTVTALAV 1801 Score = 37.3 bits (75), Expect(3) = 1e-21 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -1 / -3 Query: 128 VPYLPTIPAFLVRFV 84 +PYLPTIPAFLVRFV Sbjct: 964 LPYLPTIPAFLVRFV 920 Score = 51.0 bits (105), Expect(4) = 1e-17 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +3 / +2 Query: 240 NLGMQGLWEGEGWRCLHHE 296 NLGMQGLW+G+GW CLHHE Sbjct: 1673 NLGMQGLWQGQGWWCLHHE 1729 Score = 39.6 bits (80), Expect(4) = 1e-17 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +3 / +1 Query: 126 YTLWCQSA*ADQEDGGVSALK 188 Y +WCQ A*ADQEDGG AL+ Sbjct: 1060 YQVWCQFA*ADQEDGGFPALQ 1122 Score = 35.4 bits (71), Expect(4) = 1e-17 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = +3 / +1 Query: 294 EHCQRGHCQEHYPSLEGTD*SI 359 +HCQ GH Q+H PS EG D S+ Sbjct: 1798 QHCQCGHGQKHNPSPEGADRSL 1863 Score = 23.1 bits (44), Expect(4) = 1e-17 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 / +2 Query: 84 DEAYQESWNCRQIW 125 DEA+QE N QIW Sbjct: 920 DEAHQEGRNRWQIW 961 Score = 64.3 bits (134), Expect(2) = 7e-11 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -1 / -3 Query: 296 FMV*APPAFTFPQSLHPQIPTAFLFTAN 213 FMV*APPA T PQSLHPQIPTAFLFTAN Sbjct: 1729 FMV*APPALTLPQSLHPQIPTAFLFTAN 1646 Score = 24.9 bits (48), Expect(2) = 7e-11 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 / -1 Query: 127 YHICRQFQLSWYA 89 YHIC++F SW A Sbjct: 963 YHICQRFLPSWCA 925 Score = 40.9 bits (83), Expect(3) = 3e-08 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = +2 / +1 Query: 224 RGKQLEFGDARTVGR*RLAVLTP*T 298 RGKQLE GDARTV R RL V TP*+ Sbjct: 1657 RGKQLESGDARTVARSRLVVPTP*S 1731 Score = 35.9 bits (72), Expect(3) = 3e-08 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 / +3 Query: 134 MVPVCVSRSRRWR 172 MVPVCVSRSRRWR Sbjct: 1068 MVPVCVSRSRRWR 1106 Score = 21.7 bits (41), Expect(3) = 3e-08 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 / +1 Query: 86 RSVPRKLELSANMV 127 RS PR+ E ANMV Sbjct: 922 RSAPRRQESLANMV 963 Score = 57.4 bits (119), Expect = 7e-08 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = -1 / -1 Query: 245 QIPTAFLFTANFPQNSQKYFEC*DTSIFLICLRRLAP*RVP 123 Q+ L PQNSQKY EC +TSIFLICLR+LAP VP Sbjct: 1179 QVIINILGRITLPQNSQKYLECWETSIFLICLRKLAPYLVP 1057 Score = 56.1 bits (116), Expect = 2e-07 Identities = 22/28 (78%), Positives = 24/28 (85%) Frame = -3 / -2 Query: 297 VHGVSTASLHLPTVLASPNSNCFPLHSK 214 +HGV T SL L TVLASP+SNCFPLHSK Sbjct: 1730 LHGVGTTSLDLATVLASPDSNCFPLHSK 1647 Score = 56.1 bits (116), Expect = 2e-07 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = -2 / -2 Query: 244 KFQLLSSSQQTSHRTHRSTLSAETPPSS*SAYADWHHNVY 125 K L+S + HRT RST SA PPSS*SAYA+WHH Y Sbjct: 1178 K*SLISLEELPCHRTRRSTWSAGKPPSS*SAYANWHHTWY 1059
>LOC_Os02g04570:12002.t00356:unspliced-genomic conserved hypothetical protein| Length = 2752 Score = 38.6 bits (78), Expect = 0.032 Identities = 18/36 (50%), Positives = 20/36 (55%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLEL 112 PP LA R+ PPPLA PP R RS P +L L Sbjct: 95 PPPLATRPRLPLPPPLATPPRLPPPRPRSPPPRLPL 202
>LOC_Os05g26270:12005.t02281:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2575 Score = 29.0 bits (57), Expect(2) = 0.042 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPP 49 PP L+ +SR SPPPP Sbjct: 1094 PPSLSLLSRASPPPP 1050 Score = 26.7 bits (52), Expect(2) = 0.042 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 / -2 Query: 41 PPPLAAHASYPPTR*RSVPRKLELS 115 PP LAA A P R* +PR LS Sbjct: 981 PPALAARARAPHAR*ARLPRGSRLS 907
>LOC_Os09g39180:12009.t03384:unspliced-genomic ribonucleoprotein, chloroplast precursor, putative, expressed| Length = 2553 Score = 38.2 bits (77), Expect = 0.043 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 / +1 Query: 2 LPPQLAPVSRISPPPPLAAHASYPP 76 LPPQ P+ R PPPPL H + PP Sbjct: 106 LPPQALPLLRPIPPPPLPVHPAPPP 180
>LOC_Os04g11840:12004.t01008:unspliced-genomic expressed protein| Length = 499 Score = 37.3 bits (75), Expect = 0.082 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +2 / -1 Query: 8 PQLAPVSRISPPPPLAAHASYPP 76 PQ+AP S + PPPPL +S PP Sbjct: 433 PQIAPASSLLPPPPLPPRSSSPP 365
>LOC_Os05g01350:12005.t00037:unspliced-genomic AFH1, putative, expressed| Length = 4124 Score = 29.9 bits (59), Expect(2) = 0.099 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 / +2 Query: 310 PRWQCSWCKHRQPSPSHSPC 251 P W+ W R P PS SPC Sbjct: 284 PPWRWQWQCRRLPHPSSSPC 343 Score = 24.4 bits (47), Expect(2) = 0.099 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = -2 / +3 Query: 274 PSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETP 170 P+P+H P +L SSS H + S P Sbjct: 432 PNPNHLAAAPLSRLSSSSTSPHPHCHHAHPSTSAP 536
>LOC_Os06g41980:12006.t03890:unspliced-genomic protein kinase, putative, expressed| Length = 2004 Score = 30.9 bits (61), Expect(2) = 0.13 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 / +3 Query: 460 CTWCHGCSVMLFFHPFVAWKKK 525 C WC CSV+ VAW+++ Sbjct: 900 CVWCSACSVLATASVAVAWQRR 965 Score = 26.3 bits (51), Expect(2) = 0.13 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHAS 67 PP AP +S PPP A +S Sbjct: 757 PPSPAPAPAVSAPPPPAVPSS 819
>LOC_Os02g47260:12002.t04311:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3292 Score = 29.0 bits (57), Expect(2) = 0.14 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPP 49 PP L+ +SR SPPPP Sbjct: 1047 PPSLSLLSRASPPPP 1003 Score = 24.9 bits (48), Expect(2) = 0.14 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 / -2 Query: 41 PPPLAAHASYPPTR*RSVPRKLELS 115 PP L A A P R* +PR LS Sbjct: 909 PPALVARARAPHAR*ARLPRGSRLS 835
>LOC_Os04g48510:12004.t04368:unspliced-genomic transcription activator, putative, expressed| Length = 1802 Score = 34.5 bits (69), Expect(2) = 0.21 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 / +3 Query: 20 PVSRISPPPPLAAHASYPPTR*RSVPRKLEL 112 P R SPPPP +A ++PP R + K L Sbjct: 744 PYGRASPPPPRSARKAFPPVRTHATSSKAPL 836 Score = 21.7 bits (41), Expect(2) = 0.21 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 / +2 Query: 445 SQGYLCTWCHGCSV 486 S G TWC G S+ Sbjct: 1031 SGGARATWCRGTSI 1072
>LOC_Os10g34370:12010.t02735:unspliced-genomic expressed protein| Length = 1492 Score = 35.9 bits (72), Expect = 0.21 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = -2 / -1 Query: 283 HRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS*SA 152 H P P +P +P+ +L SSQ +S+++ ++ +PPSS*+A Sbjct: 1159 HPSPIPQPNP*LPQRVVLPSSQSSSYKSIEHHQASLSPPSS*TA 1028
>LOC_Os06g03510:12006.t00243:unspliced-genomic hypothetical protein| Length = 1777 Score = 35.9 bits (72), Expect = 0.21 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +2 / +3 Query: 32 ISPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSRR 166 + PP AA A PP+ + R + L+A ++HV +P C S +RR Sbjct: 1509 LPPPRVNAAVARGPPSLAAWMDRPVGLAAEVLHVPLPACASGARR 1643
>LOC_Os03g64110:12003.t05624:unspliced-genomic expressed protein| Length = 4229 Score = 35.9 bits (72), Expect = 0.21 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -3 / +3 Query: 309 RAGSVHGVSTASLHLPTVLASPNSNCF 229 + G+ H V SLH P+V+A+PNSN + Sbjct: 1080 KVGTTHTVYHISLHQPSVIATPNSNVY 1160
>LOC_Os01g11970:12001.t01066:unspliced-genomic conserved hypothetical protein| Length = 744 Score = 35.9 bits (72), Expect = 0.21 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKL 106 PP L ++R PPPPLAA A+ P R+ P L Sbjct: 147 PPHLPDLARAPPPPPLAASAARLPPPPRAPPGAL 248
>LOC_Os06g30830:12006.t02786:unspliced-genomic DNA binding protein, putative, expressed| Length = 3456 Score = 30.9 bits (61), Expect(2) = 0.28 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PP+ P R +PPP +AH PP Sbjct: 1319 PPRTRPPDRRAPPPAPSAHPPEPP 1390 Score = 25.8 bits (50), Expect(2) = 0.28 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 / +2 Query: 273 GWRCLHHEHC 302 GWR LHH C Sbjct: 1484 GWRLLHHRRC 1513
>LOC_Os07g33410:12007.t03020:unspliced-genomic ATPase, AAA family protein| Length = 3646 Score = 33.6 bits (67), Expect(2) = 0.40 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 / +3 Query: 38 PPPPLAAHASYPPTR*RSVPRKL 106 PPP AAH +PP R R PR+L Sbjct: 183 PPPGGAAHRHHPPRRRRRTPRRL 251 Score = 22.6 bits (43), Expect(2) = 0.40 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 / +3 Query: 146 CVSRSRRWR 172 CV+ SRRWR Sbjct: 2910 CVASSRRWR 2936
>LOC_Os11g39020:12011.t03445:unspliced-genomic expressed protein| Length = 3966 Score = 35.0 bits (70), Expect = 0.40 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP +P SPPPP AA A+ PP+ S P Sbjct: 150 PPSASPPPLPSPPPPPAASAATPPSTAASPP 242
>LOC_Os11g13970:12011.t01231:unspliced-genomic transferase, putative| Length = 1437 Score = 35.0 bits (70), Expect = 0.40 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = +2 / +2 Query: 11 QLAPVSRISPPPPLAAHASYPPTR*RSVP 97 ++ P R SPPPP +++ S PP+ RS P Sbjct: 143 RIPPPPRCSPPPPTSSNTSPPPSPPRSAP 229
>LOC_Os09g15980:12009.t01386:unspliced-genomic expressed protein| Length = 6811 Score = 35.0 bits (70), Expect = 0.40 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRK 103 PP P S PPPP A AS PP+ PR+ Sbjct: 118 PPPPPPRSPARPPPPSTAAASSPPSTCADAPRR 216
>LOC_Os07g27320:12007.t02426:unspliced-genomic hydrolase, hydrolyzing O-glycosyl compounds, putative, expressed| Length = 5675 Score = 35.0 bits (70), Expect = 0.40 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 / +2 Query: 23 VSRISPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMV 139 VS S P PL+AH +PP R+ P KL + +++ + V Sbjct: 5 VSLASDPIPLSAHVGFPPRGQRNRPTKLRTAPSLLSLSV 121
>LOC_Os05g01940:12005.t00093:unspliced-genomic zinc finger, RING-type, putative, expressed| Length = 1823 Score = 35.0 bits (70), Expect = 0.40 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYP 73 PP L P R SPPPP AA A+ P Sbjct: 83 PPNLPPPRRSSPPPPAAAAAAPP 151 Score = 30.4 bits (60), Expect = 9.6 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP P R S PPP AA A+ PP+ Sbjct: 80 PPPNLPPPRRSSPPPPAAAAAAPPS 154
>LOC_Os01g10250:12001.t00900:unspliced-genomic monoglyceride lipase, putative, expressed| Length = 4676 Score = 35.0 bits (70), Expect = 0.40 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHA 64 PP+L P+ RI+PPPP AA A Sbjct: 280 PPRLRPLPRIAPPPPPAAAA 221
>LOC_Os06g40870:12006.t03782:unspliced-genomic expressed protein| Length = 2000 Score = 26.7 bits (52), Expect(2) = 0.46 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 / -2 Query: 38 PPPPLAAHASYPPTR*RSVPRK 103 PPPP + A PP + R PR+ Sbjct: 1597 PPPPPSPDAQQPPAQRRRHPRE 1532 Score = 25.4 bits (49), Expect(2) = 0.46 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPP 49 PP L P R PPPP Sbjct: 1633 PPALPPPRRPPPPPP 1589
>LOC_Os07g08430:12007.t00718:unspliced-genomic indole-3-glycerol phosphate lyase, chloroplast precursor, putative,| expressed Length = 3249 Score = 24.0 bits (46), Expect(4) = 0.48 Identities = 6/17 (35%), Positives = 10/17 (58%) Frame = +1 / +1 Query: 205 CGKFAVKRKAVGIWGCK 255 CG+F + + WGC+ Sbjct: 412 CGRFVISARVGWGWGCR 462 Score = 22.6 bits (43), Expect(4) = 0.48 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 / +1 Query: 19 PRLPDFAATAARRPRFLPADEM 84 P +PD TAA R R P M Sbjct: 16 PSIPDSTTTAAARHRRRPPPPM 81 Score = 22.6 bits (43), Expect(4) = 0.48 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +3 / +1 Query: 456 SLYLVPWMFCYVILPPFCCLE 518 S+ +P + CYV + F C+E Sbjct: 1585 SVIRLPLVSCYVYILAFQCIE 1647 Score = 21.7 bits (41), Expect(4) = 0.48 Identities = 6/18 (33%), Positives = 9/18 (50%) Frame = +3 / +1 Query: 264 EGEGWRCLHHEHCQRGHC 317 + E W H+ C+R C Sbjct: 1321 DSEAWHRKLHDCCKRSRC 1374
>LOC_Os03g31370:12003.t02733:unspliced-genomic circumsporozoite protein precursor, putative| Length = 960 Score = 27.6 bits (54), Expect(2) = 0.48 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 / -2 Query: 38 PPPPLAAHASYPP 76 PPPPLA+ AS PP Sbjct: 305 PPPPLASTASPPP 267 Score = 24.4 bits (47), Expect(2) = 0.48 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLA 55 PP L P R+ PPP A Sbjct: 370 PPPLTPPRRLLQPPPPA 320
>LOC_Os09g19970:12009.t01731:unspliced-genomic expressed protein| Length = 1251 Score = 32.7 bits (65), Expect(2) = 0.50 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP P SPPPP AA A+ PP+ Sbjct: 675 PPPWRPPPTSSPPPPSAAAAAAPPS 601 Score = 21.7 bits (41), Expect(2) = 0.50 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 / -3 Query: 259 CGKVKAGGAYTMNTASAVTVRST 327 CG AGGA T V VR + Sbjct: 472 CGSEAAGGAATGERLRGVGVRGS 404
>LOC_Os01g47200:12001.t04168:unspliced-genomic expressed protein| Length = 2490 Score = 33.1 bits (66), Expect(2) = 0.51 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP ++P + PPPPL A A+ P T Sbjct: 238 PPPISPQNPTPPPPPLPASAAAPTT 312 Score = 22.1 bits (42), Expect(2) = 0.51 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 / +2 Query: 279 RCLHHEHCQ 305 R LHH HC+ Sbjct: 479 RLLHHHHCR 505
>LOC_Os10g30970:12010.t02427:unspliced-genomic expressed protein| Length = 7527 Score = 26.7 bits (52), Expect(3) = 0.53 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHA 64 PP L ++PPPPL A A Sbjct: 121 PPPLLSPRAVAPPPPLRAAA 180 Score = 25.4 bits (49), Expect(3) = 0.53 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 / +3 Query: 276 WRCLHHEHCQRGHCQEH 326 W C H + + G+C EH Sbjct: 6072 WSCSHRQWKRMGYCCEH 6122 Score = 24.0 bits (46), Expect(3) = 0.53 Identities = 10/26 (38%), Positives = 11/26 (42%) Frame = +3 / +3 Query: 111 CRQIWYTLWCQSA*ADQEDGGVSALK 188 C IW WC A* D G+ K Sbjct: 1095 CLIIWKLQWCSRA**FDGDSGIKHCK 1172
>LOC_Os07g43220:12007.t03969:unspliced-genomic SKP1-like protein 1A, putative| Length = 666 Score = 34.5 bits (69), Expect = 0.55 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR 82 PP P S SPPPPLA + PP R Sbjct: 226 PPPPTPPSPPSPPPPLATYPPPPPPR 149
>LOC_Os05g32640:12005.t02860:unspliced-genomic expressed protein| Length = 691 Score = 34.5 bits (69), Expect = 0.55 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 / +3 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 LPP +P S SPPPP PPT S P Sbjct: 195 LPPSSSPTSSTSPPPPSTRSPLSPPTPSSSRP 290
>LOC_Os04g18800:12004.t01622:unspliced-genomic mucin-associated surface protein, putative| Length = 510 Score = 34.5 bits (69), Expect = 0.55 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSRRWR 172 PP + P PPPP+ + S PP R P + S + + P C + R R Sbjct: 208 PPPIPPPLIRLPPPPIPSQPSIPPPPIRLPPLPIPNSTPPLSIPPPPCQEQRERRR 41
>LOC_Os08g04230:12008.t00318:unspliced-genomic protein kinase, putative, expressed| Length = 1981 Score = 28.6 bits (56), Expect(2) = 0.56 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 / +3 Query: 279 RCLHHEHCQRGHCQEHYPSL 338 R + H HC CQ +PSL Sbjct: 1512 RGIWHHHCAHNACQRRFPSL 1571 Score = 26.3 bits (51), Expect(2) = 0.56 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAA 58 PP+ AP + PPPP A Sbjct: 695 PPRRAPAADSPPPPPAGA 748
>LOC_Os12g31840:12012.t02887:unspliced-genomic heat shock protein binding protein, putative, expressed| Length = 3535 Score = 28.1 bits (55), Expect(2) = 0.70 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -2 / -1 Query: 280 RQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS 161 R PSP+ +P P SSS S S+ PPSS Sbjct: 964 RPPSPTRAPGTPSLAPSSSSPPPSSSPPPPPSSSPPPPSS 845 Score = 27.2 bits (53), Expect(2) = 0.70 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 / -1 Query: 479 HPWHQVQRYP*LNRQRN*IQSIV*TA 402 HPWHQ+ + P RQ + S *T+ Sbjct: 1465 HPWHQLVKLPPEERQNHSSYSCA*TS 1388
>LOC_Os03g49880:12003.t04335:unspliced-genomic teosinte branched1 protein, putative, expressed| Length = 1957 Score = 32.2 bits (64), Expect(2) = 0.75 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 / -3 Query: 11 QLAPVSRISPPPPLAAHASYPPTR*R 88 +LA + R PPPP AAHA+ P+ *R Sbjct: 794 RLARLPRPPPPPPAAAHAAPTPSP*R 717 Score = 22.1 bits (42), Expect(2) = 0.75 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +1 / -1 Query: 211 KFAVKRKAVGIWGCKDCGKVKAGGAYTMNTASAVT 315 K VKR G WG ++ G T + +A T Sbjct: 562 KLLVKRYVHGAWGIEERKHALLMGLLTPSRVAAAT 458
>LOC_Os12g37910:12012.t03472:unspliced-genomic GDSL-motif lipase/hydrolase-like protein, putative, expressed| Length = 4282 Score = 34.1 bits (68), Expect = 0.76 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PPQ P++ I PPPP + +S PP Sbjct: 177 PPQRRPLAAIQPPPPPCSTSSPPP 106
>LOC_Os11g47390:12011.t04214:unspliced-genomic laccase, putative, expressed| Length = 2720 Score = 34.1 bits (68), Expect = 0.76 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +1 / -2 Query: 394 WDFAV*TILWIQFRCLFSQGYLCTWCHGC 480 W FAV T W Q R F+ G+ C C GC Sbjct: 598 WRFAVATGKWQQRRT*FTSGW*CFCCRGC 512
>LOC_Os06g36080:12006.t03305:unspliced-genomic kinesin motor domain containing protein, expressed| Length = 9096 Score = 34.1 bits (68), Expect = 0.76 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 / -3 Query: 95 PRKLELSANMVHVMVPVCVSRSRRW 169 P KL+ AN + +PVC SR+R+W Sbjct: 709 PDKLQAIANQIQYGLPVCPSRNRQW 635
>LOC_Os05g24890:12005.t02146:unspliced-genomic tetratricopeptide-like helical, putative, expressed| Length = 1960 Score = 34.1 bits (68), Expect = 0.76 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 / +2 Query: 41 PPPLAAHASYPPTR*RSVPRKL 106 PPP HAS+PP R R +PR + Sbjct: 371 PPPRLLHASFPPPRRRPMPRAI 436
>LOC_Os05g18170:12005.t01585:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2364 Score = 34.1 bits (68), Expect = 0.76 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 / -2 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSANMVH 130 LPP L+ + PP PL AH+ + P+R +P + ++ H Sbjct: 1172 LPPSLSLPPSLGPPLPLPAHSLFLPSRLGRLPAQAAPASRAAH 1044
>LOC_Os02g29940:12002.t02687:unspliced-genomic conserved hypothetical protein| Length = 642 Score = 34.1 bits (68), Expect = 0.76 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP L P + SPPPPL A +P T Sbjct: 488 PPSLPPSTPSSPPPPLVLSAVHPST 414
>LOC_Os02g46700:12002.t04257:unspliced-genomic N-acetyltransferase, putative, expressed| Length = 4243 Score = 29.5 bits (58), Expect(2) = 0.82 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 / +1 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPT 79 LPP + PV+ + PPPL + S P T Sbjct: 16 LPPLILPVAAAAGPPPLPSLPSPPRT 93 Score = 25.8 bits (50), Expect(2) = 0.82 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 415 ILWIQFRCLFSQGY 456 IL I F CLFSQG+ Sbjct: 2469 ILEISFSCLFSQGW 2510
>LOC_Os03g14380:12003.t01227:unspliced-genomic autophagy protein 9, putative, expressed| Length = 7524 Score = 32.7 bits (65), Expect(2) = 1.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELS 115 PPQ+A + R +PPPP+ + P S+ L LS Sbjct: 239 PPQVACLLRPAPPPPVRRRSPVPARSVESIALSLSLS 349 Score = 23.1 bits (44), Expect(2) = 1.0 Identities = 8/34 (23%), Positives = 16/34 (47%) Frame = +1 / +3 Query: 145 LRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIW 246 L Q+ +S ++Y + CG+ R + +W Sbjct: 5952 LANQVGASMISNQNEYLEDLCGQNRT*RTKLSLW 6053
>LOC_Os12g01360:12012.t00035:unspliced-genomic expressed protein| Length = 5386 Score = 33.6 bits (67), Expect = 1.0 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = +2 / -1 Query: 8 PQLAPVSRISPPPPLAAHASYPP 76 P AP + SPPPP AAH+ PP Sbjct: 1177 PCCAPPALASPPPPPAAHSPAPP 1109
>LOC_Os01g50110:12001.t04448:unspliced-genomic myb-related protein Hv33, putative, expressed| Length = 1203 Score = 33.6 bits (67), Expect = 1.0 Identities = 18/55 (32%), Positives = 22/55 (40%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSRRW 169 PP + P + PP L P R R R L LSA + P S+RW Sbjct: 560 PPPITPTPPLPSPPLLTRRRCRPSRRGRHPRRPLALSAATIVPDRPTVAVTSQRW 724
>LOC_Os07g10250:12007.t00899:unspliced-genomic ATP-dependent RNA helicase DED1, putative, expressed| Length = 6296 Score = 26.3 bits (51), Expect(2) = 1.0 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPP 49 PP +P +R SPPPP Sbjct: 25 PPPPSPPTRRSPPPP 69 Score = 24.4 bits (47), Expect(2) = 1.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 38 PPPPLAAHASYPP 76 PPPP A AS PP Sbjct: 81 PPPPPLATASLPP 119
>LOC_Os01g34680:12001.t03025:unspliced-genomic conserved hypothetical protein| Length = 5782 Score = 26.3 bits (51), Expect(2) = 1.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 / -1 Query: 38 PPPPLAAHASYPPTR*RSVPRKLE 109 PPPP AA A + R +PR+ E Sbjct: 142 PPPPAAAAAPHRHPHQREMPRERE 71 Score = 24.4 bits (47), Expect(2) = 1.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / -1 Query: 2 LPPQLAPVSRISPPPPLAA 58 LPP P+ + PPP AA Sbjct: 175 LPPSPPPLPPLPPPPAAAA 119
>LOC_Os02g03260:12002.t00226:unspliced-genomic 3-isopropylmalate dehydratase large subunit 2, putative, expressed| Length = 5026 Score = 31.8 bits (63), Expect(2) = 1.3 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 / +1 Query: 466 WCHGCSVMLFFHPFVAW 516 WC C++ + FHP VAW Sbjct: 1417 WCTYCAI*ILFHPNVAW 1467 Score = 23.1 bits (44), Expect(2) = 1.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 / +3 Query: 8 PQLAPVSRISPPPPLAAHAS 67 P V ISPPPP A A+ Sbjct: 36 PHTPQVFAISPPPPPRAAAA 95
>LOC_Os07g07220:12007.t00600:unspliced-genomic small nuclear ribonucleoprotein-associated protein B, putative,| expressed Length = 2382 Score = 25.4 bits (49), Expect(3) = 1.3 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = +3 / +2 Query: 474 WMFCYVILPPFCC 512 W+ C+++ P CC Sbjct: 2270 WIACFIVCPDSCC 2308 Score = 23.5 bits (45), Expect(3) = 1.3 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR 82 PPQ+ P PPP + PP R Sbjct: 756 PPQVRPGMPGGPPPGMRPGMPPPPFR 833 Score = 22.6 bits (43), Expect(3) = 1.3 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 / +2 Query: 363 CY*CFVLVNHLGFCS 407 C+ CF +++H+G S Sbjct: 2114 CHLCFTVLSHIGVTS 2158
>LOC_Os04g32790:12004.t02957:unspliced-genomic AP2 domain containing protein, expressed| Length = 1412 Score = 26.7 bits (52), Expect(2) = 1.4 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 / -1 Query: 2 LPPQLAPVSRISPPPPL 52 LPPQ S PPPPL Sbjct: 671 LPPQYMETSSTIPPPPL 621 Score = 26.3 bits (51), Expect(2) = 1.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 / -2 Query: 38 PPPPLAAHASYPPTR*RSVP 97 PPPP AA +S P T S P Sbjct: 127 PPPPAAASSSTPTTTTTSSP 68
>LOC_Os12g38540:12012.t03534:unspliced-genomic expressed protein| Length = 2320 Score = 33.1 bits (66), Expect = 1.4 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = +2 / -1 Query: 17 APVSRISPPPPLAAHASYPPTR*RSVPRK 103 AP R PPPP PP+R RS PR+ Sbjct: 202 APPRRRIPPPPPRCRCRSPPSRRRSPPRR 116
>LOC_Os09g02260:12009.t00126:unspliced-genomic pentatricopeptide repeat-containing protein, putative, expressed| Length = 2723 Score = 33.1 bits (66), Expect = 1.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRK 103 P ++ + SPPPP +A +S PP+R S P + Sbjct: 321 PSRMPSSAPPSPPPPASASSSSPPSRRASAPAR 419
>LOC_Os08g04680:12008.t00362:unspliced-genomic hypothetical protein| Length = 908 Score = 33.1 bits (66), Expect = 1.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP L+P +++ PPPP A P R RS P Sbjct: 870 PPSLSPSAQLRPPPPPPPPALAPHHRRRSPP 778
>LOC_Os08g03380:12008.t00232:unspliced-genomic expressed protein| Length = 4113 Score = 33.1 bits (66), Expect = 1.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 / -2 Query: 38 PPPPLAAHASYPPTR*RSVPRKLELSANMVH 130 PPPP H + PPTR +P + + + ++H Sbjct: 347 PPPPRPTHVASPPTRRPFIPCQKKKNLKLIH 255
>LOC_Os06g43610:12006.t04051:unspliced-genomic formamidopyrimidine-DNA glycosylase, putative, expressed| Length = 3029 Score = 33.1 bits (66), Expect = 1.4 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +2 / -2 Query: 8 PQLAPVSRISPPPPLAAHASYPP 76 P+ AP + SPPPP AA AS PP Sbjct: 151 PRSAPPAPSSPPPPPAAPASPPP 83
>LOC_Os06g23220:12006.t02134:unspliced-genomic GRF zinc finger family protein| Length = 2051 Score = 33.1 bits (66), Expect = 1.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 / -3 Query: 2 LPPQLAPVSRISPPPPLAAHASYP 73 LPP+ P ++ PPPP A+ + YP Sbjct: 1776 LPPEAIPPAQPPPPPPPASRSGYP 1705
>LOC_Os02g48590:12002.t04443:unspliced-genomic expressed protein| Length = 1867 Score = 33.1 bits (66), Expect = 1.4 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 / -2 Query: 41 PPPLAAHASYPPTR*RSVPRKLELSAN 121 PPP ++ S+PPT +S P + ELS++ Sbjct: 162 PPPPSSTPSHPPTHSQSTPHRAELSSS 82
>LOC_Os01g66830:12001.t06042:unspliced-genomic carboxylic ester hydrolase, putative, expressed| Length = 3351 Score = 33.1 bits (66), Expect = 1.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 / +3 Query: 430 FRCLFSQGYLCTWCHGCSVMLFFHPF 507 FR F L W H C+ M+F H F Sbjct: 1290 FRPYFQDALLVVWLHYCTAMIFMHDF 1367
>LOC_Os01g09200:12001.t00797:unspliced-genomic serine/threonine-protein kinase 38, putative, expressed| Length = 9688 Score = 33.1 bits (66), Expect = 1.4 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +2 / -1 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 LPP P + SPPPP A PP+R S P Sbjct: 217 LPPPPPPAAPPSPPPPPPVPAPRPPSRSPSPP 122
>LOC_Os01g33490:12001.t02916:unspliced-genomic F-box domain containing protein, expressed| Length = 1303 Score = 29.5 bits (58), Expect(2) = 1.7 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYP 73 PP + SR SPPPP ++ +S P Sbjct: 312 PPPRSSASRPSPPPPTSSPSSSP 380 Score = 23.1 bits (44), Expect(2) = 1.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 / +1 Query: 226 RKAVGIWGCKDCGKVKAGG 282 R+ +WG C V+AGG Sbjct: 706 RRGGEVWGGGTCAGVEAGG 762
>LOC_Os07g09600:12007.t00834:unspliced-genomic vesicle-associated membrane protein 725, putative, expressed| Length = 3833 Score = 29.9 bits (59), Expect(2) = 1.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 / +1 Query: 274 PSPSHSPCIPKFQLLSSSQQT 212 PSP HSPC P ++L + ++T Sbjct: 3442 PSPPHSPCPP*YRLFLAKKKT 3504 Score = 24.0 bits (46), Expect(2) = 1.8 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -2 / +1 Query: 304 WQCSWCKHRQPSPSHSPC 251 W+ S+C +QP P C Sbjct: 1759 WESSYCCSKQPQPRIRVC 1812
>LOC_Os11g35762:12011.t03124:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 4637 Score = 27.6 bits (54), Expect(2) = 1.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 / +1 Query: 35 SPPPPLAAHASYPPTR 82 S PPP A HA+ PP R Sbjct: 85 STPPPRARHAAAPPRR 132 Score = 22.1 bits (42), Expect(2) = 1.9 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 / +2 Query: 2 LPPQLAPVSRISPPP 46 LPP P S PPP Sbjct: 20 LPPMPTPTSTRPPPP 64
>LOC_Os06g02019:12006.t00098:unspliced-genomic cytochrome P450 88A1, putative, expressed| Length = 5786 Score = 27.2 bits (53), Expect(2) = 1.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 P S SPPPP A PPT Sbjct: 3178 PTTTTAASASSPPPPSTASTPSPPT 3252 Score = 27.2 bits (53), Expect(2) = 1.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +1 / +3 Query: 124 GTRYGASLRKQIKKMEVSQHSKYFCEFC 207 G R SLR+ + ++ S H ++ CE C Sbjct: 4464 GCRRDTSLRQHLLRVLPSGHKRHLCERC 4547
>LOC_Os11g09530:12011.t00845:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 2437 Score = 32.7 bits (65), Expect = 2.0 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 / +1 Query: 8 PQLAPVSRISPPPPLAAHASYPP 76 P L P+SR+ PLAAH + PP Sbjct: 1072 PSLTPLSRLGQASPLAAHDNEPP 1140
>LOC_Os06g22390:12006.t02053:unspliced-genomic expressed protein| Length = 766 Score = 32.7 bits (65), Expect = 2.0 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +2 / +1 Query: 8 PQLAPVSRISPPPPLAAHASYPPTR*RSVPRKL 106 P AP R SPPPP A PP RS+ R + Sbjct: 406 PATAPRCRSSPPPPPAPPPCSPPPADRSIGRAM 504
>LOC_Os06g08800:12006.t00759:unspliced-genomic RNA methyltransferase NCOA6IP, expressed| Length = 1585 Score = 32.7 bits (65), Expect = 2.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PP+ P + PPPPLA H+ PP Sbjct: 42 PPRHVPG*DLPPPPPLARHSPPPP 113
>LOC_Os05g15240:12005.t01296:unspliced-genomic conserved hypothetical protein| Length = 3626 Score = 32.7 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR 82 PP+LA + PPPP + AS PP+R Sbjct: 302 PPRLARRPQPPPPPPTSGLASAPPSR 379 Score = 30.4 bits (60), Expect = 9.6 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR 82 PP+LA ++ PP P + AS PP+R Sbjct: 496 PPRLARRPQLPPPLPTSGLASAPPSR 573
>LOC_Os04g09320:12004.t00770:unspliced-genomic hypothetical protein| Length = 387 Score = 32.7 bits (65), Expect = 2.0 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP L P + SPPPPL A P T Sbjct: 332 PPSLPPSTSSSPPPPLVLSAVRPST 258
>LOC_Os03g16270:12003.t01412:unspliced-genomic conserved hypothetical protein| Length = 585 Score = 32.7 bits (65), Expect = 2.0 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR 82 PPQL ++ PPPPLA +S+ TR Sbjct: 469 PPQLRRQPQLHPPPPLARPSSHRRTR 392
>LOC_Os02g37040:12002.t03342:unspliced-genomic peptide transporter PTR2, putative, expressed| Length = 4510 Score = 32.7 bits (65), Expect = 2.0 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = +2 / -3 Query: 35 SPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSRRWR 172 SP P AS PP + V R L + + V+ VC S S RWR Sbjct: 932 SPAPSCPPSASSPPAWQQIVVRFLHRARMIEDVLFCVCESESVRWR 795
>LOC_Os01g74630:12001.t06741:unspliced-genomic conserved hypothetical protein| Length = 1033 Score = 32.7 bits (65), Expect = 2.0 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +1 / -1 Query: 1 AAAAARPRLPDFAATAARRPRFLPADEMTKR 93 A A ARPR P A + RF+PADE+ R Sbjct: 952 AEADARPRRPRLARPRRQGMRFVPADELEPR 860
>LOC_Os01g22520:12001.t01985:unspliced-genomic dihydrolipoyl dehydrogenase, mitochondrial precursor, putative,| expressed Length = 3624 Score = 32.7 bits (65), Expect = 2.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PP+ P + PPPP AA A+ PP Sbjct: 311 PPRTTPSAPTPPPPPAAAAAAPPP 240
>LOC_Os01g18270:12001.t01622:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 5787 Score = 32.7 bits (65), Expect = 2.0 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 / +2 Query: 17 APVSRISPPPPLAAHASYPPTR*RSVPRKL 106 +P SPPPP AA S+PP R R+L Sbjct: 536 SPPPAPSPPPPAAASPSHPPPAARRTHRRL 625
>LOC_Os09g34140:12009.t02990:unspliced-genomic expressed protein| Length = 1864 Score = 24.9 bits (48), Expect(3) = 2.0 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +3 / -3 Query: 258 LWEGEGWRC 284 L EGEGWRC Sbjct: 203 LREGEGWRC 177 Score = 23.5 bits (45), Expect(3) = 2.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 / -2 Query: 41 PPPLAAHASYPPTR*RSVPRKLELSAN 121 PPP A +S PP PR+ L N Sbjct: 384 PPPSPATSSEPPAPAAIKPRRNALEKN 304 Score = 21.7 bits (41), Expect(3) = 2.0 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 / -3 Query: 20 PVSRISPPPPLA 55 P S ++PPPP A Sbjct: 449 PSSPLAPPPPAA 414
>LOC_Os02g57800:12002.t05351:unspliced-genomic rf1 protein, mitochondrial precursor, putative, expressed| Length = 5139 Score = 25.4 bits (49), Expect(3) = 2.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 / +3 Query: 2 LPPQLAPVSRISPPPPLAAH 61 LPP L P PPPP H Sbjct: 99 LPPPLLPPLPSRPPPPPPPH 158 Score = 24.9 bits (48), Expect(3) = 2.0 Identities = 6/23 (26%), Positives = 12/23 (52%) Frame = +1 / +1 Query: 457 LCTWCHGCSVMLFFHPFVAWKKK 525 +C C+ ++ HP W+K+ Sbjct: 3136 MCNTCYTADILAQLHPQPRWRKR 3204 Score = 22.6 bits (43), Expect(3) = 2.0 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 / +2 Query: 166 MEVSQHSKYFCEFCGKFAVKRKAVGIW 246 M +S ++ FC+FC A + K W Sbjct: 2072 MLISPYTIRFCKFCVTMA*QEKPQLFW 2152
>LOC_Os10g05088:12010.t00387:unspliced-genomic anther-specific proline-rich protein APG, putative, expressed| Length = 4277 Score = 32.2 bits (64), Expect(2) = 2.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 P AP ++ SPPPPL H +P T Sbjct: 1803 PRPAAPPAQPSPPPPLPRHRLFPAT 1877 Score = 21.7 bits (41), Expect(2) = 2.0 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +3 / +3 Query: 300 CQRGHCQEHYPS 335 C RGH H P+ Sbjct: 2817 CSRGHTPNHVPN 2852
>LOC_Os11g14060:12011.t04316:unspliced-genomic expressed protein| Length = 1557 Score = 26.7 bits (52), Expect(2) = 2.1 Identities = 12/52 (23%), Positives = 23/52 (44%) Frame = +1 / +1 Query: 121 YGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDCGKVKA 276 YG+R A+ + ++ + ++ E CG + + G GC K +A Sbjct: 475 YGSRRSAAGFARPRRWSSRRRAQLAAEICGDYGAREGEAGETGCVGATKGRA 630 Score = 23.1 bits (44), Expect(2) = 2.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 / +1 Query: 20 PVSRISPPPP 49 P+SR PPPP Sbjct: 439 PISRSPPPPP 468
>LOC_Os03g43900:12003.t03780:unspliced-genomic phosphatidylinositol N-acetylglucosaminyltransferase subunit P,| putative, expressed Length = 4631 Score = 25.4 bits (49), Expect(3) = 2.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 / +1 Query: 291 HEHCQRGHCQEHYPSLEGTD 350 HE C HCQ P+L+ T+ Sbjct: 643 HESCCLHHCQTFKPTLDMTN 702 Score = 24.9 bits (48), Expect(3) = 2.2 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 / +3 Query: 478 CSVMLFFHPFVAW 516 C+ MLF HP W Sbjct: 3522 CTAMLFIHPMHTW 3560 Score = 22.1 bits (42), Expect(3) = 2.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 / +3 Query: 14 LAPVSRISPPPPLAAHASYP 73 L+P ++ PPPP A +P Sbjct: 42 LSPCAQPPPPPPAPAIPIHP 101
>LOC_Os01g35050:12001.t03060:unspliced-genomic HYP1, putative, expressed| Length = 11019 Score = 26.7 bits (52), Expect(3) = 2.3 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 / +2 Query: 418 LWIQFRCLFSQGYLC 462 LWI RC FS Y+C Sbjct: 2759 LWILNRCYFSISYIC 2803 Score = 24.9 bits (48), Expect(3) = 2.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 / +3 Query: 264 EGEGWRCLHHEHCQRGH 314 E + W C+ E CQ GH Sbjct: 2400 ESKSWGCICAEVCQFGH 2450 Score = 23.1 bits (44), Expect(3) = 2.3 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = +1 / +2 Query: 460 CTWCHGCSV 486 C+W H CS+ Sbjct: 9206 CSWTHNCSI 9232
>LOC_Os12g17550:12012.t01607:unspliced-genomic conserved hypothetical protein| Length = 8905 Score = 25.4 bits (49), Expect(2) = 2.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 / +2 Query: 4 AAAARPRLPDFAATAARRPR 63 AAA RPR P +AA PR Sbjct: 548 AAAVRPRPPPLPPSAATAPR 607 Score = 24.0 bits (46), Expect(2) = 2.5 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 / +2 Query: 41 PPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSR 163 P PL A+ PP R S P ++ S P R R Sbjct: 638 PSPLPDRAAEPPPRLPSRPCRIWRSGRRRRASPPALAQRKR 760
>LOC_Os07g45480:12007.t04186:unspliced-genomic conserved hypothetical protein| Length = 5437 Score = 29.5 bits (58), Expect(2) = 2.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 / -3 Query: 347 RLKHKLLLVFCPSESSGILQFRRYFGFSSVACLVKDIFVLGAM 475 R+K ++ CP + L R+F S+ +C +F L +M Sbjct: 4277 RIKLLMITRMCPMSALVFLSMARFFRISAASCFSSWLFPLSSM 4149 Score = 24.4 bits (47), Expect(2) = 2.5 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 / -1 Query: 457 LCTWCHGCSVMLFFHPFV 510 LC W H V+++ HP + Sbjct: 2707 LCFWNHDLVVLVYTHPAI 2654
>LOC_Os05g37040:12005.t03248:unspliced-genomic MYB-like transcription factor DIVARICATA, putative| Length = 783 Score = 26.7 bits (52), Expect(2) = 2.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 / -1 Query: 276 WRCLHHEHCQR 308 WRC HH C R Sbjct: 51 WRCRHHSRCPR 19 Score = 24.4 bits (47), Expect(2) = 2.6 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 / -2 Query: 11 QLAPVSRISPPPPLAAHASYPPTR 82 Q P SP PP A Y PTR Sbjct: 347 QAMPRRHSSPSPPPLRPAPYAPTR 276
>LOC_Os03g37720:12003.t03224:unspliced-genomic NBS-LRR type disease resistance protein Rps1-k-1, putative| Length = 3801 Score = 25.4 bits (49), Expect(2) = 2.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 / -3 Query: 295 SWCKHRQPSPSHSPCIPKFQL 233 SW QPSPS + +P+ +L Sbjct: 1291 SWLAPMQPSPSVTASLPRLRL 1229 Score = 24.0 bits (46), Expect(2) = 2.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 / -1 Query: 142 WHHNVYHICRQFQLS 98 W H Y IC F+LS Sbjct: 1110 WRHCSYRICCNFRLS 1066
>LOC_Os11g07912:12011.t004384:unspliced-genomic MLO-like protein 4, putative, expressed| Length = 4621 Score = 32.2 bits (64), Expect = 2.7 Identities = 20/56 (35%), Positives = 24/56 (42%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSRRWR 172 PP L + PPPPLA+ P R R + S + V C SRS R R Sbjct: 264 PPFLHHPPPLPPPPPLASTPPQPAARDDGEHRSIARSLSSVRKRGS*CGSRSARDR 97
>LOC_Os10g40410:12010.t03281:unspliced-genomic expressed protein| Length = 3107 Score = 32.2 bits (64), Expect = 2.7 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 / +2 Query: 286 KHRQPSPSHSPCIPKFQLLSSSQQTSHR 203 +H P PSH PC P L + + S+R Sbjct: 227 RHTSPPPSHRPCAPPISLSADAISPSNR 310
>LOC_Os10g22170:12010.t01699:unspliced-genomic expressed protein| Length = 3938 Score = 32.2 bits (64), Expect = 2.7 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 / +3 Query: 29 RISPPPPLAAHASYPPTR*RSVPRKLELS 115 R+SPPPP ++ Y P RS+P L S Sbjct: 33 RLSPPPPPPPYSRYTPPFPRSIPPGLSFS 119
>LOC_Os09g06950:12009.t00491:unspliced-genomic expressed protein| Length = 800 Score = 32.2 bits (64), Expect = 2.7 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 / +3 Query: 20 PVSRISPPPPLAAHASYPPTR*RSVPRKLELSA 118 P S +PPPP+AA PP +VP L SA Sbjct: 180 PSSSTAPPPPVAAAGCSPPPPPVTVPPPLSASA 278
>LOC_Os08g21360:12008.t01931:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 7926 Score = 32.2 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 / +2 Query: 480 TSMAPSTKISLTKQATELNPKYRLN 406 T M P+T I++T + T+L PK+ LN Sbjct: 3524 TGMVPTTPITITMERTQLWPKFLLN 3598
>LOC_Os08g20770:12008.t01887:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 4308 Score = 32.2 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 / +2 Query: 480 TSMAPSTKISLTKQATELNPKYRLN 406 T M P+T I++T + T+L PK+ LN Sbjct: 20 TGMVPTTPITITMERTQLWPKFLLN 94
>LOC_Os07g48430:12007.t04475:unspliced-genomic nucleoside-triphosphatase, putative, expressed| Length = 4255 Score = 32.2 bits (64), Expect = 2.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 / -1 Query: 421 WIQFRCLFSQGYLCTWC 471 WIQ C++ QG C WC Sbjct: 1702 WIQMICIYFQGKCCFWC 1652
>LOC_Os07g41260:12007.t03781:unspliced-genomic expressed protein| Length = 3617 Score = 32.2 bits (64), Expect = 2.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPR 100 PP++ P R SPPP PP R R PR Sbjct: 141 PPRIPPRRRRSPPPSPGRSPRCPPPRHRPPPR 236
>LOC_Os07g07780:12007.t00656:unspliced-genomic hypothetical protein| Length = 5771 Score = 32.2 bits (64), Expect = 2.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +2 / +2 Query: 8 PQLAPVSRISPPPPLAAHASYPPTR*RSVPR 100 P L P +R+ P PP+ A S PP R +V R Sbjct: 4295 PPLPPGARLLPSPPVRATLSLPPRRGPAVDR 4387
>LOC_Os06g23770:12006.t02189:unspliced-genomic expressed protein| Length = 3514 Score = 32.2 bits (64), Expect = 2.7 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 / +3 Query: 35 SPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSRRWR 172 +P PP A + +PPT S SA+ VH + V +R R R Sbjct: 3321 APSPPRTARSHWPPTARASSATGRSTSASAVHALRVVAPARERENR 3458
>LOC_Os06g07020:12006.t00587:unspliced-genomic zinc finger, C2H2 type family protein, expressed| Length = 2999 Score = 32.2 bits (64), Expect = 2.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR 82 PP+LA R PPPPL H P R Sbjct: 87 PPRLAASPRPPPPPPLPPHGPPVPAR 164
>LOC_Os06g03420:12006.t00235:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 2109 Score = 32.2 bits (64), Expect = 2.7 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 / +2 Query: 480 TSMAPSTKISLTKQATELNPKYRLN 406 T M P+T I++T + T+L PK+ LN Sbjct: 20 TGMVPTTPITITMERTQLWPKFLLN 94
>LOC_Os05g30980:12005.t02696:unspliced-genomic ribonucleoprotein, putative, expressed| Length = 5810 Score = 32.2 bits (64), Expect = 2.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 / -2 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 LPP P + PPPP AA S P R R P Sbjct: 235 LPPPPPPRLPVPPPPPAAAAGSAGPCRRRRPP 140
>LOC_Os05g03200:12005.t00217:unspliced-genomic expressed protein| Length = 2997 Score = 32.2 bits (64), Expect = 2.7 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR 82 PP +R SPPPP A +S PP R Sbjct: 26 PPPRQHPARSSPPPPPAERSSSPPAR 103
>LOC_Os04g15520:12004.t01319:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1645 Score = 32.2 bits (64), Expect = 2.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 / -3 Query: 295 SWCKHRQPSPSHSPCIPKFQLLSSSQQTS 209 S C+HR+ +H PC+P+ Q SS T+ Sbjct: 1484 SQCRHRRGRGAHPPCLPRHQGRWSSSLTA 1398
>LOC_Os02g36780:12002.t03315:unspliced-genomic MTERF domain containing protein, putative, expressed| Length = 849 Score = 32.2 bits (64), Expect = 2.7 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +2 / +3 Query: 8 PQLAPVSRISPPPPLAAHASYPPTR*RSVPRKL 106 P AP PPPP A PP R R+ PR L Sbjct: 399 PGDAPPGAPLPPPPRGAPQEAPPARRRAAPRLL 497
>LOC_Os02g16300:12002.t01423:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 1525 Score = 32.2 bits (64), Expect = 2.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 P L P ++ SPPPP A H PP Sbjct: 229 PHHLLPSAQASPPPPAAHHLPPPP 158
>LOC_Os01g64660:12001.t05833:unspliced-genomic fructose-1,6-bisphosphatase, cytosolic, putative, expressed| Length = 3091 Score = 32.2 bits (64), Expect = 2.7 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 / -3 Query: 280 RQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETP 170 R PSP HSP +P+ L SS ++ R+ S +P Sbjct: 182 RDPSPHHSPQLPRRALFFSSAYSASRSSLRFASPHSP 72
>LOC_Os01g09730:12001.t00850:unspliced-genomic expressed protein| Length = 2373 Score = 32.2 bits (64), Expect = 2.7 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -2 / +2 Query: 280 RQPSPSHSPCIPKFQLLSSSQQTSHRTHRST 188 R SPS SPC P LSSS +S R + T Sbjct: 962 RATSPSPSPCTPPTTPLSSSSSSSSRERKLT 1054
>LOC_Os08g19374:12008.t04279:unspliced-genomic expressed protein| Length = 3121 Score = 30.4 bits (60), Expect(2) = 2.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAA 58 PP L+P+ SPPPPLA+ Sbjct: 463 PPLLSPLVSPSPPPPLAS 516 Score = 22.6 bits (43), Expect(2) = 2.7 Identities = 7/18 (38%), Positives = 9/18 (50%) Frame = +1 / +3 Query: 454 YLCTWCHGCSVMLFFHPF 507 Y C W H ++ F H F Sbjct: 870 Y*CDWTHCLAISSFTHTF 923
>LOC_Os01g58870:12001.t05281:unspliced-genomic plastidic phosphate translocator-like protein1, putative, expressed| Length = 1685 Score = 24.9 bits (48), Expect(2) = 2.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPP 49 PP +P S+ PPPP Sbjct: 104 PPPTSPPSQPDPPPP 148 Score = 24.4 bits (47), Expect(2) = 2.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 / +2 Query: 38 PPPPLAAHASYPPTR*RS 91 PPPPL S+ P+R R+ Sbjct: 143 PPPPLLPPRSHTPSRERA 196
>LOC_Os08g27400:12008.t02504:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1663 Score = 30.4 bits (60), Expect(2) = 2.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 / +1 Query: 32 ISPPPPLAAHASYPPTR*RSVP 97 + PPPP A HA+ P R R P Sbjct: 1201 VRPPPPRACHAAATPRRGRRAP 1266 Score = 21.7 bits (41), Expect(2) = 2.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPP 49 PP V+R S PPP Sbjct: 860 PPSSLAVARWSSPPP 904
>LOC_Os01g71180:12001.t06414:unspliced-genomic pentatricopeptide repeat protein PPR1106-17, putative| Length = 2751 Score = 25.4 bits (49), Expect(3) = 2.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHAS 67 PP+ AP R S PPL+ +S Sbjct: 44 PPRFAPQPRSSRSPPLSTPSS 106 Score = 23.5 bits (45), Expect(3) = 2.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 / +3 Query: 140 PVCVSRSRRWR 172 PVCVSR WR Sbjct: 2649 PVCVSRHVEWR 2681 Score = 21.7 bits (41), Expect(3) = 2.8 Identities = 5/10 (50%), Positives = 7/10 (70%) Frame = +3 / +3 Query: 96 QESWNCRQIW 125 + SW C Q+W Sbjct: 2076 EHSWACGQVW 2105
>LOC_Os07g40930:12007.t03752:unspliced-genomic WD-repeat protein 12, putative, expressed| Length = 3859 Score = 26.7 bits (52), Expect(3) = 2.9 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*R 88 PP P+ R +PPPP A+ P R R Sbjct: 25 PPPPPPLRRPTPPPPPWTPAAPPTPRAR 108 Score = 23.1 bits (44), Expect(3) = 2.9 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 / +3 Query: 250 CKDCGKVKAGGA 285 CK CG +AGG+ Sbjct: 555 CKSCGTEEAGGS 590 Score = 21.7 bits (41), Expect(3) = 2.9 Identities = 5/6 (83%), Positives = 5/6 (83%) Frame = +1 / +1 Query: 457 LCTWCH 474 LC WCH Sbjct: 2233 LCAWCH 2250
>LOC_Os09g20410:12009.t01775:unspliced-genomic hypothetical protein| Length = 952 Score = 26.7 bits (52), Expect(2) = 2.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPP 49 PP L P+ + PPPP Sbjct: 86 PPSLLPLPTLPPPPP 42 Score = 22.6 bits (43), Expect(2) = 2.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +2 / -3 Query: 38 PPPPLAAH 61 PPPPLA H Sbjct: 50 PPPPLALH 27
>LOC_Os11g32950:12011.t02891:unspliced-genomic conserved hypothetical protein| Length = 882 Score = 25.8 bits (50), Expect(2) = 2.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 / +3 Query: 38 PPPPLAAHASYPPTR*RSVPRKLELSA 118 PPPP PP R R +PR+ L A Sbjct: 276 PPPPPPPLPPPPPPRPRRLPRRRLLPA 356 Score = 23.5 bits (45), Expect(2) = 2.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / +3 Query: 2 LPPQLAPVSRISPPPP 49 LPP+L R PPPP Sbjct: 183 LPPRLPHRRRRPPPPP 230
>LOC_Os10g08879:12010.t00708:unspliced-genomic methylosome subunit pICln, putative, expressed| Length = 7934 Score = 26.3 bits (51), Expect(3) = 3.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +2 / -3 Query: 128 HVMVPVCVSRSRRWR 172 H ++PVC +S+RWR Sbjct: 4944 HDILPVCNFKSKRWR 4900 Score = 23.5 bits (45), Expect(3) = 3.0 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +1 / -3 Query: 223 KRKAVGIWGCKDCGKVKAGGAYTMNTASAVTVRSTIR 333 +RKA W DC + G Y T +RS +R Sbjct: 4590 RRKAETNWPVADCKLMNTGEGYWG*TQP*ARLRSRVR 4480 Score = 23.5 bits (45), Expect(3) = 3.0 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +3 / -1 Query: 462 YLVPWMFCYV 491 YLVP+ FC+V Sbjct: 872 YLVPFFFCFV 843
>LOC_Os12g43950:12012.t04061:unspliced-genomic BEL1-related homeotic protein 30, putative, expressed| Length = 5253 Score = 30.9 bits (61), Expect(2) = 3.2 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 / -1 Query: 229 SSSQQTSHRTHRSTLSAETPPSS 161 SSS + HR S+LS+ +PPSS Sbjct: 330 SSSSKREHRAQSSSLSSSSPPSS 262 Score = 22.6 bits (43), Expect(2) = 3.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 / -2 Query: 402 KIPDDSLGQNTSNNLCFSLF 343 K PD+++ QN CF F Sbjct: 1742 KQPDNTINQNQMTAQCFLFF 1683
>LOC_Os06g37224:12006.t03417:unspliced-genomic ent-kaurene oxidase, putative, expressed| Length = 9880 Score = 24.4 bits (47), Expect(2) = 3.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAA 58 PP L + PPPP AA Sbjct: 6310 PPLLVTTAAAGPPPPPAA 6363 Score = 24.4 bits (47), Expect(2) = 3.3 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 / +1 Query: 35 SPPPPLAAHASYPPTR*RSVPRK 103 S PPP H PP R R P + Sbjct: 6424 STPPPSGHHHLLPPDRRRMPPSR 6492
>LOC_Os09g39860:12009.t03450:unspliced-genomic protein kinase, putative, expressed| Length = 2175 Score = 25.8 bits (50), Expect(3) = 3.4 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +2 / -1 Query: 113 SANMVHVMVPVCVSRSRR 166 S+N + P+CVSR+RR Sbjct: 891 SSNSANCAAPMCVSRARR 838 Score = 22.1 bits (42), Expect(3) = 3.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPP 49 PP +P +PPPP Sbjct: 1049 PPSSSPARWPAPPPP 1005 Score = 21.7 bits (41), Expect(3) = 3.4 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = +1 / -2 Query: 244 WGCKDCG 264 WGC+ CG Sbjct: 698 WGCEGCG 678
>LOC_Os03g04270:12003.t00307:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 2941 Score = 28.1 bits (55), Expect(2) = 3.5 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 / +1 Query: 38 PPPPLAAHASYPPTR*RSVP 97 PPPP AA A PPT S P Sbjct: 190 PPPPAAASAPAPPTPSPSSP 249 Score = 24.4 bits (47), Expect(2) = 3.5 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPP 49 PPQ P + PPPP Sbjct: 2 PPQKPPSLSLPPPPP 46
>LOC_Os01g13180:12001.t01181:unspliced-genomic expressed protein| Length = 1388 Score = 23.5 bits (45), Expect(3) = 3.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 / +1 Query: 306 RGHCQEHYPSLEG 344 RGH EH P +EG Sbjct: 253 RGHFVEHLPHVEG 291 Score = 23.1 bits (44), Expect(3) = 3.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 / +1 Query: 38 PPPPLAAHASYP 73 PPPP H S P Sbjct: 106 PPPPFCPHLSVP 141 Score = 21.7 bits (41), Expect(3) = 3.6 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 / +1 Query: 2 LPPQLAPVSRISPPPP 49 LPP +R PPPP Sbjct: 64 LPPSPPSKTRRPPPPP 111
>LOC_Os10g40660:12010.t03308:unspliced-genomic cys2/His2 zinc-finger transcription factor, putative, expressed| Length = 1692 Score = 31.8 bits (63), Expect = 3.7 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = -2 / +3 Query: 280 RQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS*SAYA 146 R P+PS S C +++ SSS + + + S TPP+S*S+ A Sbjct: 1284 RAPAPSISTCRRQWRTTSSSPPCTTPSSPARDSDHTPPTS*SSMA 1418
>LOC_Os10g28570:12010.t02208:unspliced-genomic expressed protein| Length = 3389 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/56 (23%), Positives = 25/56 (44%) Frame = +2 / -2 Query: 8 PQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSRRWRC 175 P P R PP + + PP R + R ++ N+ H + P+ ++ ++C Sbjct: 328 PP*CPRRRRPPPSRVGRRSLLPPPRRPDLSRTNTITPNLSHTVPPIYCKSTQEYKC 161
>LOC_Os10g26390:12010.t02051:unspliced-genomic oxidoreductase, putative, expressed| Length = 1550 Score = 31.8 bits (63), Expect = 3.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 / +1 Query: 2 LPPQLAPVSRISPPPP 49 LPPQL P S PPPP Sbjct: 31 LPPQLGPASNTFPPPP 78
>LOC_Os10g01984:12010.t00094:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 15035 Score = 31.8 bits (63), Expect = 3.7 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSANM 124 P LA VSR SPPPPL P R + + +S ++ Sbjct: 4206 PSSLAIVSRSSPPPPLTPPPHLPGESRRCLSLSISISLSL 4325
>LOC_Os09g32670:12009.t02881:unspliced-genomic protein capI, putative, expressed| Length = 2030 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -2 / +2 Query: 289 CKHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPS 164 C+ R+ S PC P+++ SSS+ T+ R R+ + P+ Sbjct: 200 CRRRRTCCSAPPCSPRWRSCSSSRSTTRRCCRAPSRSPPAPA 325
>LOC_Os09g27850:12009.t02463:unspliced-genomic expressed protein| Length = 1606 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP+ +P I PPPP PP R SVP Sbjct: 94 PPRRSPRRPIPPPPPPPPPPRRPPRRGASVP 2
>LOC_Os08g23754:12008.t04282:unspliced-genomic expressed protein| Length = 5360 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 / -3 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPT 79 LPP LAP ++ P PPL+ PPT Sbjct: 2955 LPPPLAPPTQGLPRPPLSCRLLPPPT 2878
>LOC_Os08g19220:12008.t01743:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7346 Score = 31.8 bits (63), Expect = 3.7 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 / +1 Query: 17 APVSRISPPPPLAAHASYPPTR*RSVPRKLELSANMVH 130 AP R +P PP HA+ PP R R P +A H Sbjct: 2713 APPRRRAPTPPPRPHAAGPPRRRRGTPPPHPHAAGPAH 2826
>LOC_Os08g08120:12008.t00698:unspliced-genomic transcription factor/ zinc ion binding protein, putative, expressed| Length = 2232 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPR 100 PP AP PPPP H PP R PR Sbjct: 496 PPPTAPPGSPPPPPPPRLHHPRPPPPRRPPPR 401
>LOC_Os08g03010:12008.t00195:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6634 Score = 31.8 bits (63), Expect = 3.7 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 / +3 Query: 480 TSMAPSTKISLTKQATELNPKYRLN 406 T M P+T I++T + T+L PK+ LN Sbjct: 2232 TGMVPTTPITITMERTQLWPKFFLN 2306
>LOC_Os07g32510:12007.t02933:unspliced-genomic expressed protein| Length = 2134 Score = 31.8 bits (63), Expect = 3.7 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PP L P + PPPP AA + PP Sbjct: 83 PPPLLPAATPPPPPPPAAAVAAPP 12
>LOC_Os06g42070:12006.t03898:unspliced-genomic conserved hypothetical protein| Length = 2101 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = +1 / +3 Query: 1 AAAAARPRLPDFAATAARRPRFLP 72 AAA+ PRLP AA+ RRP LP Sbjct: 480 AAASPPPRLPADAASPCRRPTLLP 551
>LOC_Os06g32490:12006.t02947:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 6533 Score = 31.8 bits (63), Expect = 3.7 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -3 / +1 Query: 474 MAPSTKISLTKQATELNPKYRLN 406 MAP+T I++T + T+L PK+ LN Sbjct: 2218 MAPTTPITITMERTQLWPKFLLN 2286
>LOC_Os06g03250:12006.t00218:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 11100 Score = 31.8 bits (63), Expect = 3.7 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = -3 / +2 Query: 474 MAPSTKISLTKQATELNPKYRLN 406 MAP+T I++T + T+L PK+ LN Sbjct: 6704 MAPTTPITITMERTQLWPKFLLN 6772
>LOC_Os05g47790:12005.t04214:unspliced-genomic expressed protein| Length = 4616 Score = 31.8 bits (63), Expect = 3.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +2 / -2 Query: 23 VSRISPPPPLAAHASYPP 76 ++R+ PPPPLAA A PP Sbjct: 1054 IARLLPPPPLAAVAELPP 1001
>LOC_Os05g37340:12005.t03277:unspliced-genomic expressed protein| Length = 3174 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP+ AP S +P PP+AA + PP + P Sbjct: 288 PPRHAPPSGAAPSPPVAAPPAPPPAAAAATP 196
>LOC_Os05g08930:12005.t00770:unspliced-genomic expressed protein| Length = 2641 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 / +1 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSANM 124 LP +A + +PPPPL H P + RS P + S+++ Sbjct: 235 LPSPIASPTEPTPPPPLPGHPPPPASSLRSSPPREPSSSSL 357
>LOC_Os04g54310:12004.t04903:unspliced-genomic conserved hypothetical protein| Length = 1526 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP+ +P+S PPPP AS P R R P Sbjct: 217 PPRPSPLSSSPPPPPRRQAASCPARRRRRWP 125
>LOC_Os04g54280:12004.t04901:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4105 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP+ +P+S PPPP AS P R R P Sbjct: 217 PPRPSPLSSSPPPPPQKQAASCPERRRRRWP 125
>LOC_Os04g54240:12004.t04897:unspliced-genomic wound induced protein, putative, expressed| Length = 835 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP+ +P+S PPPP AS P R R P Sbjct: 319 PPRPSPLSSSPPPPPQKLAASCPARRRRRWP 227
>LOC_Os04g54200:12004.t04893:unspliced-genomic diacylglycerol kinase, putative, expressed| Length = 4781 Score = 31.8 bits (63), Expect = 3.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 / +1 Query: 436 CLFSQGYLCTWCHGCSVMLFFHPFV 510 C F++ + WC C V+L FH F+ Sbjct: 856 CSFNEQFRSFWC*YCHVLLIFHYFI 930
>LOC_Os04g12420:12004.t01066:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5344 Score = 31.8 bits (63), Expect = 3.7 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -2 / +2 Query: 256 PCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS*SAYADW 140 PCI + S+QTSH++ R + TP S + +DW Sbjct: 3716 PCISLV*RMPPSKQTSHKSKRPRDRSPTPSSHDDSDSDW 3832
>LOC_Os03g53070:12003.t04630:unspliced-genomic prenylated Rab receptor 2, putative, expressed| Length = 1331 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPR 100 PP P S PPPP A +PP PR Sbjct: 199 PPPPPPPSPRRPPPPCTAPTPHPPREQEGTPR 294
>LOC_Os03g46540:12003.t04022:unspliced-genomic hypothetical protein| Length = 3456 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 / +2 Query: 2 LPPQLAPVSRISPPPPLAAHASYP 73 LPP L P PPPPLA+ A+ P Sbjct: 1142 LPPGLPPRPPARPPPPLASGAAAP 1213
>LOC_Os03g11770:12003.t00978:unspliced-genomic expressed protein| Length = 3922 Score = 31.8 bits (63), Expect = 3.7 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 / -3 Query: 2 LPPQLAPVSRISPPPPLAAHAS 67 L P L P + +SPPPPL+A ++ Sbjct: 3644 LEPWLRPANELSPPPPLSASSA 3579
>LOC_Os03g05440:12003.t00416:unspliced-genomic expressed protein| Length = 2734 Score = 31.8 bits (63), Expect = 3.7 Identities = 16/46 (34%), Positives = 21/46 (45%) Frame = +2 / -2 Query: 35 SPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSRRWR 172 SP PP A + PP R R+ P +++ P C R RR R Sbjct: 2205 SPRPPAAPAPAAPPARRRTAPLATPATSSGTPRTPPGCARRCRRRR 2068
>LOC_Os02g28820:12002.t02576:unspliced-genomic expressed protein| Length = 1379 Score = 31.8 bits (63), Expect = 3.7 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPR 100 P +A S + PPPPL H + P R R + R Sbjct: 37 PRSVAMASALHPPPPLHLHHHHHPRRRRKILR 132
>LOC_Os01g16330:12001.t01482:unspliced-genomic UBA/TS-N domain, putative, expressed| Length = 5184 Score = 31.8 bits (63), Expect = 3.7 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 / +1 Query: 2 LPPQLAPVSRISPPPPLAAHASYPP 76 LPP AP +R PPP + H S+ P Sbjct: 61 LPPSRAPPARPPPPPSSSPHLSHGP 135
>LOC_Os01g13480:12001.t01210:unspliced-genomic electron transporter/ thiol-disulfide exchange intermediate,| putative, expressed Length = 1532 Score = 31.8 bits (63), Expect = 3.7 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +2 / -2 Query: 17 APVSRISPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVP 142 AP P P LAA AS R + R L LSA+ H P Sbjct: 1144 APPQPSQPRPSLAAQASPRALAQRIISRSLPLSASSAHASAP 1019
>LOC_Os02g39210:12002.t03559:unspliced-genomic conserved hypothetical protein| Length = 1074 Score = 25.4 bits (49), Expect(2) = 3.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 / +3 Query: 229 SSSQQTSHRTHRSTLSAETPP 167 S S ++ R HR + S E PP Sbjct: 969 SGSGRSDERAHRQSASGEAPP 1031 Score = 23.5 bits (45), Expect(2) = 3.9 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 / +3 Query: 286 KHRQPSPSHSPCIPKFQLLSSSQQT 212 +HR+ P HS P+ + S QT Sbjct: 807 RHREQQPKHSKPSPRRRRRSCGHQT 881
>LOC_Os03g46660:12003.t04034:unspliced-genomic glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed| Length = 2992 Score = 24.0 bits (46), Expect(3) = 4.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPP 49 PP+ +P R S PPP Sbjct: 800 PPRSSPPCRTSAPPP 844 Score = 23.1 bits (44), Expect(3) = 4.3 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 / +1 Query: 256 DCGKVKAGGA 285 DCG ++AGGA Sbjct: 1609 DCGAIQAGGA 1638 Score = 23.1 bits (44), Expect(3) = 4.3 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = +3 / +3 Query: 276 WRCLHHEHCQRGHCQEHYPSLEG 344 WR L +H R H P+L G Sbjct: 1632 WRVLRAQHGARPRRLRHEPALPG 1700
>LOC_Os07g36700:12007.t03339:unspliced-genomic CSLF1 - cellulose synthase-like family F; beta1,3;1,4 glucan| synthase Length = 2674 Score = 28.6 bits (56), Expect(2) = 4.3 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 / +2 Query: 26 SRISPPPPLAAHASYPPTR*RSVPRKLELS 115 SR SPP P A+YP + S P L S Sbjct: 374 SRTSPPSPTGTPATYPASTSSSPPSTLSTS 463 Score = 23.5 bits (45), Expect(2) = 4.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 / +3 Query: 140 PVCVSRSRRWRC 175 P RSRRWRC Sbjct: 1593 PTKNGRSRRWRC 1628
>LOC_Os06g37820:12006.t03477:unspliced-genomic Leucine Rich Repeat family protein| Length = 10581 Score = 25.8 bits (50), Expect(2) = 4.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 / +3 Query: 41 PPPLAAHASYPPTR*RSVP 97 PPP AA S PPT S P Sbjct: 5289 PPPPAARCSTPPTARCSAP 5345 Score = 22.6 bits (43), Expect(2) = 4.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPP 49 PP+ + +S PPPP Sbjct: 5163 PPRPSSLSAAEPPPP 5207
>LOC_Os03g33530:12003.t02943:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 8095 Score = 24.9 bits (48), Expect(2) = 4.4 Identities = 6/10 (60%), Positives = 6/10 (60%) Frame = -2 / -2 Query: 304 WQCSWCKHRQ 275 W C WC H Q Sbjct: 2241 WSCDWCIHYQ 2212 Score = 23.5 bits (45), Expect(2) = 4.4 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -3 / -1 Query: 426 NPKYRLNCKIPDDSLGQNTSNNL 358 +PK L+C++P S +N ++L Sbjct: 2308 SPKTMLSCEVPFGSRDENIDSSL 2240
>LOC_Os01g37750:12001.t03314:unspliced-genomic glutathione S-transferase GSTU6, putative, expressed| Length = 1035 Score = 28.1 bits (55), Expect(2) = 4.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 / -1 Query: 246 GMQGLWEGEGWRCLHHEHCQRG 311 G +G W G GWR C+RG Sbjct: 303 GGRGPWRGRGWRRGGGRSCRRG 238 Score = 22.6 bits (43), Expect(2) = 4.5 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP+ + SPP P A + PPT Sbjct: 804 PPR*GVRAAASPPWPPPARRTAPPT 730
>LOC_Os01g13770:12001.t01237:unspliced-genomic triose phosphate/phosphate translocator, chloroplast precursor,| putative, expressed Length = 4261 Score = 25.4 bits (49), Expect(2) = 4.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 / +1 Query: 8 PQLAPVSRISPPPP 49 P+LA ++I PPPP Sbjct: 127 PELASATQIPPPPP 168 Score = 23.1 bits (44), Expect(2) = 4.7 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 / +1 Query: 38 PPPPLAAHASYPP 76 PPPP AA PP Sbjct: 160 PPPPNAARLPLPP 198
>LOC_Os04g45940:12004.t04126:unspliced-genomic expressed protein| Length = 1081 Score = 27.2 bits (53), Expect(2) = 4.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAA 58 PP +R+ PPPP+AA Sbjct: 69 PPTPPTAARVRPPPPVAA 122 Score = 23.5 bits (45), Expect(2) = 4.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 / +3 Query: 41 PPPLAAHASYPPTR*RSVP 97 PPPL S PP + R +P Sbjct: 579 PPPLPPAPSSPPPKKRRLP 635
>LOC_Os05g49150:12005.t04348:unspliced-genomic eukaryotic translation initiation factor 3 subunit 7, putative,| expressed Length = 2142 Score = 27.6 bits (54), Expect(2) = 4.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 / +2 Query: 2 LPPQLAPVSRISPPPPLAA 58 LPP P ++PPPP +A Sbjct: 20 LPPLSLPTQTLAPPPPASA 76 Score = 24.0 bits (46), Expect(2) = 4.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 / +1 Query: 35 SPPPPLAAHASYPPTR*RSVP 97 SPPPP ++ PP+ S P Sbjct: 295 SPPPPATPSSTSPPSTTPSPP 357
>LOC_Os03g55640:12003.t04825:unspliced-genomic peptidase/ serine-type peptidase, putative, expressed| Length = 3009 Score = 26.3 bits (51), Expect(2) = 4.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 / +3 Query: 468 VPWMFCYVILPPFCCL 515 VP FC +LP CCL Sbjct: 1509 VPPQFCRYVLPFICCL 1556 Score = 25.8 bits (50), Expect(2) = 4.8 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 / +3 Query: 2 LPPQLAPVSRISPPPP 49 LPP L P + PPPP Sbjct: 54 LPPSLLPPNSPPPPPP 101
>LOC_Os11g07460:12011.t00637:unspliced-genomic TCP family transcription factor containing protein, expressed| Length = 3080 Score = 30.4 bits (60), Expect(2) = 4.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSV 94 PP +P + PPPP AH +P + R++ Sbjct: 1491 PPLSSPTTPPEPPPPAPAHHHHPEQQQRAL 1402 Score = 21.7 bits (41), Expect(2) = 4.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 / -1 Query: 283 AYTMNTASAVTVRSTIRRLREQTEA 357 +Y + ASA + IRR R +T A Sbjct: 1112 SYHAHAASAPPLTGAIRRRRRRTAA 1038
>LOC_Os12g42150:12012.t03889:unspliced-genomic nucleotide binding protein, putative, expressed| Length = 2188 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 / +2 Query: 8 PQLAPVSRISPPPPLAAHASYPPTR 82 P S SPPPP +A +S PP R Sbjct: 239 PTTPSASTTSPPPPTSARSSTPPRR 313
>LOC_Os12g27760:12012.t02487:unspliced-genomic F-box domain containing protein| Length = 1236 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = -2 / +2 Query: 307 RWQCSWCKHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS 161 RW SW P+PS S P S++ + + ++ SA SS Sbjct: 41 RWTSSWRSRSAPTPSRSSAAPPHASTSAASSPARASAATSASATRTASS 187
>LOC_Os12g05900:12012.t00476:unspliced-genomic rac GTPase activating protein 1, putative, expressed| Length = 5037 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 / -1 Query: 274 PSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS 161 P P S P SS+ ++ H S+ S+++PPSS Sbjct: 843 PPPPSSALHPSSDFRSSASSSAKNDHSSSSSSDSPPSS 730
>LOC_Os11g43049:12011.t03835:unspliced-genomic protein binding protein, putative| Length = 1740 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRK 103 PP SR PPPP +A PP+ R PR+ Sbjct: 1516 PPSRRRPSRRPPPPPTSAATPPPPSPPRRRPRR 1418
>LOC_Os11g42989:12011.t03829:unspliced-genomic protein binding protein, putative, expressed| Length = 2012 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRK 103 PP SR PPPP +A PP+ R PR+ Sbjct: 1516 PPSRRRPSRRPPPPPTSAATPPPPSPPRRRPRR 1418
>LOC_Os11g20239:12011.t01793:unspliced-genomic expressed protein| Length = 20374 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRK 103 PP+L P R+ PP ++P R R+ PR+ Sbjct: 12320 PPRLPPHGRVPPPSARLVRLTHPHRRARAGPRR 12222
>LOC_Os11g02070:12011.t00102:unspliced-genomic TD and POZ domain-containing protein 2, putative, expressed| Length = 1916 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 / -1 Query: 17 APVSRISPPPPLAAHASYPPTR*RSVPRKL 106 AP S +PPPP +A PP + PRKL Sbjct: 1613 APRSSSAPPPPASAARCPPPPPPPAAPRKL 1524
>LOC_Os11g02054:12011.t00100:unspliced-genomic expressed protein| Length = 6937 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +2 / +1 Query: 17 APVSRISPPPPLAAHASYPPTR*RSVPRKL 106 AP S +PPPP +A PP + PRKL Sbjct: 6637 APRSSSAPPPPASAARCPPPPPPPAAPRKL 6726
>LOC_Os11g01530:12011.t00052:unspliced-genomic ferritin-1, chloroplast precursor, putative, expressed| Length = 2965 Score = 31.3 bits (62), Expect = 5.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 / +1 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR*RSVPR 100 LPP++AP + + P LAA AS P + VPR Sbjct: 283 LPPRVAPAAAAAAPTYLAAAASTPASVWLPVPR 381
>LOC_Os09g20770:12009.t01811:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4834 Score = 31.3 bits (62), Expect = 5.1 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 / -3 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSANMVH 130 LPP V PPPP+ AH P R R + + +A+ H Sbjct: 1466 LPPSSPCVGDEMPPPPMPAHRPPPAPRLRRLAAQRRAAASPGH 1338
>LOC_Os08g31860:12008.t02931:unspliced-genomic expressed protein| Length = 1418 Score = 31.3 bits (62), Expect = 5.1 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 / -3 Query: 2 LPPQLAPVSRISPPPPLAAHASYPP 76 LPP + ++PPPP ++ A++PP Sbjct: 1068 LPPAPPDIVFLTPPPPTSSSATHPP 994
>LOC_Os08g05830:12008.t00475:unspliced-genomic transaldolase, putative, expressed| Length = 3955 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 / +3 Query: 35 SPPPPLAAHASYPPTR*RSVPRKLEL 112 SPPPP+A S PPT +P L++ Sbjct: 54 SPPPPMALSISTPPTSSSLLPASLQV 131
>LOC_Os07g43190:12007.t03966:unspliced-genomic conserved hypothetical protein| Length = 411 Score = 31.3 bits (62), Expect = 5.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP P ++ SPPPP + PPT Sbjct: 247 PPSRTPPTKPSPPPPATPSSPPPPT 173
>LOC_Os07g41680:12007.t03823:unspliced-genomic dehydrodolichyl diphosphate synthase 6, putative, expressed| Length = 3017 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -2 / -1 Query: 319 *Q*PRWQCSWCKHRQPSPSHSPCIPKFQLLSSS 221 *Q +W C CK R+P P C P L S Sbjct: 2456 *QSQKWSCMACKQRRPVPCFQQC*PSVSQLLPS 2358
>LOC_Os06g22650:12006.t02079:unspliced-genomic VHS and GAT domain protein, putative, expressed| Length = 8117 Score = 31.3 bits (62), Expect = 5.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 / +2 Query: 442 FSQGYLCTWCHGCS 483 F + CTWCHGCS Sbjct: 4049 FDRNPECTWCHGCS 4090
>LOC_Os06g04270:12006.t00316:unspliced-genomic transketolase, chloroplast precursor, putative, expressed| Length = 3597 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 / -3 Query: 17 APVSRISPPPPLAAHASYPPTR*R 88 +P SR +PP P A AS PP R R Sbjct: 349 SPTSRAAPPSPPAPRASRPPPRAR 278
>LOC_Os05g28930:12005.t02541:unspliced-genomic integral membrane protein DUF6 containing protein| Length = 6084 Score = 31.3 bits (62), Expect = 5.1 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +2 / -3 Query: 8 PQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSAN 121 P P +PPPP AA PP R R PR+ L ++ Sbjct: 127 PPPRPPPPPAPPPPAAALLPPPPARPRRPPRRRPLPSS 14
>LOC_Os05g24150:12005.t02072:unspliced-genomic tetratricopeptide-like helical, putative, expressed| Length = 3528 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +2 / +3 Query: 44 PPLAAHASYPPTR*RSVPRKL 106 PP HA +PP R RSVPR + Sbjct: 444 PPGLLHAPFPPPRRRSVPRPI 506
>LOC_Os05g06920:12005.t00582:unspliced-genomic guanosine-3,5-bis 3-pyrophosphohydrolase, putative, expressed| Length = 2739 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -2 / +1 Query: 310 PRWQCSWCKHRQPSPSHSPCIPKFQLLSSSQQTSHR 203 PRW+CS C R +PS P+ S S ++ R Sbjct: 754 PRWRCSRCSRRWRTPSAPARSPRSSRTSPSGASTRR 861
>LOC_Os05g05660:12005.t00456:unspliced-genomic PWWP domain containing protein, expressed| Length = 7963 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLEL 112 PP+ + PPPPL H Y P ++P L L Sbjct: 6841 PPRPPVTQPLPPPPPLHQHQPYQPRHTDALPLPLPL 6948
>LOC_Os05g05354:12005.t00425:unspliced-genomic expressed protein| Length = 10206 Score = 31.3 bits (62), Expect = 5.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 / +2 Query: 439 LFSQGYLCTWCHGCSVMLFFHPF 507 L++ G+LC+ H V LFF+PF Sbjct: 9890 LYAAGHLCSVFHFLGVRLFFYPF 9958
>LOC_Os04g44380:12004.t03978:unspliced-genomic hypothetical protein| Length = 1133 Score = 31.3 bits (62), Expect = 5.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 / +1 Query: 328 *CS*Q*PRWQCSWCKHRQPSPSHSP 254 *C PRW+ SW + R+ P H+P Sbjct: 631 *CQPPRPRWRWSWAR*RKAHPRHAP 705
>LOC_Os04g41210:12004.t03682:unspliced-genomic hypothetical protein| Length = 397 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR 82 PP P R PPP + S+PPTR Sbjct: 169 PPPARPPRRPRPPPSARSAQSHPPTR 92
>LOC_Os04g35700:12004.t03240:unspliced-genomic mitogen-activated kinase kinase kinase alpha, putative, expressed| Length = 6086 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 / +3 Query: 29 RISPPPPLAAHASYPPTR 82 +ISPPPPL AS PP R Sbjct: 12 KISPPPPLRLKASPPPRR 65
>LOC_Os04g31690:12004.t02850:unspliced-genomic expressed protein| Length = 3704 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +2 / +1 Query: 377 CPSESSGILQFRRYFGFSSVACLVKDIFVLGAMDVLLCYSSTLL 508 C ES L + R G + CLV + ++L + CY +L Sbjct: 2092 CDMESRICLPYERILGAGELQCLVCNYYILKQFSLAFCYLPLVL 2223
>LOC_Os04g29224:12004.t02616:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 7210 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 / +2 Query: 38 PPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVC 148 PP P + P R R + R L+LS VH+ P+C Sbjct: 3065 PPSPPPPRTLHRPPRRRPLHRCLDLSTAAVHLRRPLC 3175
>LOC_Os03g61620:12003.t05392:unspliced-genomic expressed protein| Length = 5045 Score = 31.3 bits (62), Expect = 5.1 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -3 / +2 Query: 411 LNCKIPDDSLGQNTSNNLCFSLFPQATDSAPDSDRAGSVHGVST 280 + K+ + G TSN+ CFS F +A + SD A S+ +T Sbjct: 4106 IGTKVFSSTEGATTSNSACFSKFLEADAFSEYSDTASSITVTTT 4237
>LOC_Os03g38640:12003.t03306:unspliced-genomic expressed protein| Length = 1279 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 P + AP+S PPPP AA PP++ + P Sbjct: 254 PSRTAPLSPPPPPPPRAAAERRPPSQAGAAP 162
>LOC_Os03g17634:12003.t01536:unspliced-genomic expressed protein| Length = 24778 Score = 31.3 bits (62), Expect = 5.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 / -1 Query: 166 SS*SAYADWHHNVYHIC 116 SS S++A WHH + HIC Sbjct: 8158 SSTSSFAQWHHRLGHIC 8108
>LOC_Os02g37810:12002.t03419:unspliced-genomic hypothetical protein| Length = 1505 Score = 31.3 bits (62), Expect = 5.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP +PV+ +SPPPP A + P+ Sbjct: 131 PPVASPVTPLSPPPPCLARSPPSPS 57
>LOC_Os02g30270:12002.t02720:unspliced-genomic hypothetical protein| Length = 3610 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/48 (25%), Positives = 23/48 (47%) Frame = +2 / -3 Query: 32 ISPPPPLAAHASYPPTR*RSVPRKLELSANMVHVMVPVCVSRSRRWRC 175 ++ P P + + PP R ++ P +L + + + +SR RW C Sbjct: 347 VAAPLPQSTTVTLPPPRAQAPPPTADLWPCIADTLATIVLSRHHRWLC 204
>LOC_Os02g18830:12002.t01676:unspliced-genomic ribosome biogenesis protein NEP1, putative, expressed| Length = 3308 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR 82 PP P S PPPP AA A PP R Sbjct: 243 PPPRPPPSPPPPPPPPAAAAPPPPLR 166
>LOC_Os01g66520:12001.t06013:unspliced-genomic serine/threonine-protein kinase RIO2, putative, expressed| Length = 4232 Score = 31.3 bits (62), Expect = 5.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = +2 / -1 Query: 38 PPPPLAAHASYPPTR*RSVPRK 103 PPPP AA A+ PP R R P K Sbjct: 164 PPPPAAAAAAVPPRRRRPSPWK 99
>LOC_Os01g42900:12001.t03807:unspliced-genomic ATPase, coupled to transmembrane movement of substances, putative,| expressed Length = 1992 Score = 31.3 bits (62), Expect = 5.1 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -2 / +2 Query: 292 WCKHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS 161 W PSP+ SP P+ SS S R +PP+S Sbjct: 1313 WASSPSPSPTSSPPPPRASRCSSRSGASWSARRPAARTASPPTS 1444
>LOC_Os01g42080:12001.t03728:unspliced-genomic expressed protein| Length = 6113 Score = 31.3 bits (62), Expect = 5.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = +2 / +3 Query: 2 LPPQLAPVSRISPPPP 49 LP QLA +S ISPPPP Sbjct: 1482 LPSQLAAMSAISPPPP 1529
>LOC_Os06g02560:12006.t00149:unspliced-genomic growth-regulating factor, putative, expressed| Length = 3258 Score = 26.3 bits (51), Expect(2) = 5.1 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = +3 / +2 Query: 264 EGEGWRCLHHEHCQRGHCQEH 326 +G+ WRC H +C+ H Sbjct: 971 DGKKWRCSKEAHPDSKYCERH 1033 Score = 25.8 bits (50), Expect(2) = 5.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +2 / +1 Query: 38 PPPPLAAHASYPPT 79 PPPPL A PPT Sbjct: 61 PPPPLMAATKNPPT 102
>LOC_Os12g41940:12012.t03870:unspliced-genomic DNA binding protein, putative, expressed| Length = 3424 Score = 28.6 bits (56), Expect(2) = 5.3 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +2 / -2 Query: 29 RISPPPPLAAHASYPPTR*RS 91 R PPPP A A+ PP R RS Sbjct: 1398 RPPPPPPAAVAAASPPCRTRS 1336 Score = 23.5 bits (45), Expect(2) = 5.3 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 / -3 Query: 243 LGMQGLWEGEGWRCLHHEHCQR 308 +G Q L GWR H HC + Sbjct: 1043 MGSQQLHPQLGWRHHSHLHCNK 978
>LOC_Os06g24540:12006.t02265:unspliced-genomic expressed protein| Length = 3430 Score = 28.6 bits (56), Expect(2) = 5.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 / +2 Query: 29 RISPPPPLAAHASYPPTR 82 R++PP P +A S PPTR Sbjct: 881 RLAPPAPASAALSLPPTR 934 Score = 23.5 bits (45), Expect(2) = 5.4 Identities = 8/19 (42%), Positives = 8/19 (42%) Frame = +1 / +3 Query: 205 CGKFAVKRKAVGIWGCKDC 261 CG R A G W C C Sbjct: 2631 CGAEVQDRAATGYWRCNIC 2687
>LOC_Os07g22480:12007.t01952:unspliced-genomic retrotransposon, putative, centromere-specific| Length = 5098 Score = 29.0 bits (57), Expect(2) = 5.6 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 / +1 Query: 354 SISCY*CFVLVNHLGFCSLDDTLDSVPLPV* 446 SIS Y C + N S DD+L P+PV* Sbjct: 3460 SISAYKCSLYANEPLQLSFDDSLHHTPIPV* 3552 Score = 23.5 bits (45), Expect(2) = 5.6 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 / +2 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR 82 +PP A V R+ P LA ++ P+R Sbjct: 1904 VPPVAAVVGRMPSPLDLAGRSALMPSR 1984
>LOC_Os02g47590:12002.t04343:unspliced-genomic ornithine carbamoyltransferase, chloroplast precursor, putative,| expressed Length = 2996 Score = 26.3 bits (51), Expect(3) = 5.7 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 / +2 Query: 456 SLYLVPWMFCYVILP 500 S+ + PW+FC + LP Sbjct: 1391 SMIIRPWLFCLICLP 1435 Score = 21.7 bits (41), Expect(3) = 5.7 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 11 QLAPVSRISPPPP 49 +LAP R PPPP Sbjct: 27 RLAPRRRPPPPPP 65 Score = 21.7 bits (41), Expect(3) = 5.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 / +3 Query: 29 RISPPPPLAAHASYPPTR*RSVP 97 R PP P S PP R R+ P Sbjct: 186 RSPPPRPPRDAGSLPPQRCRAPP 254
>LOC_Os05g12150:12005.t01045:unspliced-genomic endoglucanase 1 precursor, putative, expressed| Length = 2698 Score = 29.9 bits (59), Expect(2) = 5.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PP +P + SPP P AA ++ PP Sbjct: 1451 PPSSSPSTPTSPPSPAAAPSTAPP 1522 Score = 21.7 bits (41), Expect(2) = 5.8 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = +1 / +1 Query: 247 GCKDCGKVKAGGAYT 291 GC+ CG+ A G+ T Sbjct: 2368 GCRRCGRGGASGSCT 2412
>LOC_Os03g19960:12003.t01758:unspliced-genomic pre-mRNA-splicing factor ATP-dependent RNA helicase, putative,| expressed Length = 3806 Score = 27.6 bits (54), Expect(2) = 5.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +2 / +2 Query: 413 RYFGFSSVACLVKDIFVLGAMDVLLC 490 +YF F + CL+ D + LG + VL C Sbjct: 434 KYFRFVVIGCLLGDRYWLGFVCVLRC 511 Score = 24.4 bits (47), Expect(2) = 5.8 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 / +1 Query: 17 APVSRISPPPPLAAHASYPPTR 82 +P S +PPPP A PTR Sbjct: 154 SPPSSAAPPPPTARPPPPRPTR 219
>LOC_Os11g03070:12011.t00198:unspliced-genomic ATCHX15, putative, expressed| Length = 2750 Score = 27.2 bits (53), Expect(2) = 5.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 / -3 Query: 17 APVSRISPPPPLAAHASYPPTR*RSVP 97 AP +R +PP P +A P+R R+ P Sbjct: 2379 APATRSTPPSPPSARTPRAPSRRRTGP 2299 Score = 24.4 bits (47), Expect(2) = 5.9 Identities = 7/26 (26%), Positives = 15/26 (57%) Frame = +3 / -2 Query: 87 EAYQESWNCRQIWYTLWCQSA*ADQE 164 +A++ NC +W W +++* D + Sbjct: 1720 KAWEMCLNCISVWLRPWTEAS*EDDD 1643
>LOC_Os06g37510:12006.t03446:unspliced-genomic senescence-associated protein 5, putative, expressed| Length = 2613 Score = 25.8 bits (50), Expect(3) = 6.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP + S SP P A AS PPT Sbjct: 216 PPSSSSPSPASPAPTGTAGASSPPT 290 Score = 21.7 bits (41), Expect(3) = 6.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 / +1 Query: 397 DFAV*TILWIQFRC 438 DF + LW+ FRC Sbjct: 1276 DFLNISFLWLAFRC 1317 Score = 21.7 bits (41), Expect(3) = 6.0 Identities = 7/26 (26%), Positives = 13/26 (50%) Frame = +3 / +1 Query: 453 ISLYLVPWMFCYVILPPFCCLEKKKK 530 +S ++ + CY + PFC + K Sbjct: 1669 VSFQILECLHCYSSVVPFCSFTVQPK 1746
>LOC_Os02g15560:12002.t01349:unspliced-genomic transposon protein, putative, Mutator sub-class| Length = 5606 Score = 30.4 bits (60), Expect(2) = 6.1 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +2 / -2 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLEL 112 LP L P SPPPPLA PP S P L L Sbjct: 3082 LPLPLPPPVAPSPPPPLALPLPLPPPVAPSPPPPLAL 2972 Score = 22.1 bits (42), Expect(2) = 6.1 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 / -3 Query: 276 WRCLHHEHCQRGHCQEHYPSLE 341 + CL E Q HC E P L+ Sbjct: 93 YNCLLREDLQ*NHCTEVPPLLD 28
>LOC_Os01g68320:12001.t06187:unspliced-genomic ATP-dependent RNA helicase dbp2, putative, expressed| Length = 4899 Score = 24.4 bits (47), Expect(2) = 6.2 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 / -1 Query: 2 LPPQLAPVSRISPPPP 49 LPP L P R P PP Sbjct: 1137 LPPPLPPPPRYPPAPP 1090 Score = 23.5 bits (45), Expect(2) = 6.2 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / -1 Query: 38 PPPPLAAHASYPPTR*RSVP 97 PPPP PP R +S P Sbjct: 1065 PPPPAPPPRPLPPKREKSPP 1006
>LOC_Os10g26950:12010.t02103:unspliced-genomic retrotransposon protein, putative, Ty1-copia subclass| Length = 3638 Score = 25.8 bits (50), Expect(2) = 6.3 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 / -2 Query: 38 PPPPLAAHASYPPTR*RSVPRKLE 109 PPPP+ PP+R +P LE Sbjct: 823 PPPPVQPPTPLPPSRALPLPPPLE 752 Score = 22.1 bits (42), Expect(2) = 6.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +2 / -2 Query: 2 LPPQLAPVSRISPPPPLA 55 LPP P PPPPL+ Sbjct: 958 LPPPPFPPPVQPPPPPLS 905
>LOC_Os08g06240:12008.t00514:unspliced-genomic dnajc2 protein, putative, expressed| Length = 3556 Score = 24.9 bits (48), Expect(2) = 6.4 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +2 / +3 Query: 26 SRISPPPPLAAHASYPPTR*RSVPRKLELSANM 124 SRI PPPP A A R PR ++ + + Sbjct: 405 SRIPPPPPAAVGARARARTRRLRPRSPQIRSRL 503 Score = 23.1 bits (44), Expect(2) = 6.4 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPP 46 PP +P SR PPP Sbjct: 300 PPSSSPPSRPPPPP 341
>LOC_Os06g08180:12006.t00700:unspliced-genomic expressed protein| Length = 3496 Score = 24.0 bits (46), Expect(2) = 6.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 / +1 Query: 5 PPQLAPVSRISPPPP 49 PP +P R SPP P Sbjct: 115 PPPTSPTPRSSPPAP 159 Score = 24.0 bits (46), Expect(2) = 6.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 / +1 Query: 35 SPPPPLAAHASYPPTR*RSVPR 100 +PPPP A+ + R RS PR Sbjct: 190 APPPPAASPRAARRRRRRSTPR 255
>LOC_Os11g38980:12011.t03441:unspliced-genomic kelch motif family protein, expressed| Length = 2626 Score = 24.0 bits (46), Expect(2) = 6.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 / +3 Query: 38 PPPPLAAHASYPP 76 PPPPL+ S PP Sbjct: 12 PPPPLSLSLSSPP 50 Score = 24.0 bits (46), Expect(2) = 6.5 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +2 / +3 Query: 86 RSVPRKLELSANMVHVMVPVCVSRSRRW 169 R +L LS ++ ++P+C +R R W Sbjct: 123 REKKTELSLSPSLSLSLLPICGARRRWW 206
>LOC_Os04g46660:12004.t04195:unspliced-genomic cyclin-dependent protein kinase, putative, expressed| Length = 1284 Score = 24.4 bits (47), Expect(2) = 6.9 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = -2 / +2 Query: 31 PGDGGELRRQ 2 PG+GGELRR+ Sbjct: 914 PGEGGELRRR 943 Score = 23.5 bits (45), Expect(2) = 6.9 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 / +1 Query: 289 CKHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS*SAYA 146 C +P+PS P SSS+ + RT S A PP +*+ ++ Sbjct: 700 CASCRPTPSGCSPQPSSSPPSSSRTGTTRTRTSPRWAG*PPRN*ARWS 843
>LOC_Os06g50910:12006.t04775:unspliced-genomic serine/threonine-protein kinase ATR, putative, expressed| Length = 18672 Score = 28.6 bits (56), Expect(2) = 6.9 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 / +2 Query: 418 LWIQFRCLFSQGYLCTW 468 L++ F CLF GYLC++ Sbjct: 4232 LYLHFCCLFLSGYLCSF 4282 Score = 25.4 bits (49), Expect(2) = 6.9 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +3 / +1 Query: 282 CLHHEHCQRGHCQEHYP 332 C + +HC C +HYP Sbjct: 1501 CCNGDHC*DSSCGKHYP 1551
>LOC_Os02g08050:12002.t00701:unspliced-genomic hypothetical protein| Length = 1458 Score = 23.1 bits (44), Expect(3) = 6.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +2 / +3 Query: 416 YFGFSSVACLVKDIFVLGAMDVLLC 490 YFG V L K+ V+ + ++LC Sbjct: 1029 YFGTKGVLLLSKEEAVIWYVSIILC 1103 Score = 22.6 bits (43), Expect(3) = 6.9 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 / +3 Query: 38 PPPPLAAHASYPPTR*RSVP 97 PPPP PP R R +P Sbjct: 603 PPPPRPPPRPPPPARRRVLP 662 Score = 21.7 bits (41), Expect(3) = 6.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPL 52 PP A S PPPP+ Sbjct: 531 PPAAAVSSPAPPPPPV 578
>LOC_Os01g15020:12001.t01356:unspliced-genomic lissencephaly type-1-like homology motif, putative, expressed| Length = 9358 Score = 27.2 bits (53), Expect(2) = 7.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 / +1 Query: 393 LGFCSLDDTLDSVPLPV*SRISLYLVPWMFCYVILP 500 LGF S+ T D+V + * LY+V F ++ P Sbjct: 9037 LGFLSITGTSDAVVIFA*MLFKLYIVFPSFMFIFFP 9144 Score = 25.8 bits (50), Expect(2) = 7.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 / +3 Query: 271 KAGGAYTMNTASAVTVRSTIRRLRE 345 KAGG Y TA V +R TI L + Sbjct: 3006 KAGGTYPPLTAHTVCLRFTISSLHD 3080
>LOC_Os12g36960:12012.t03376:unspliced-genomic conserved hypothetical protein| Length = 507 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PP AP SPPPP + A PP Sbjct: 80 PPTAAPRRCRSPPPPASGRACVPP 9
>LOC_Os12g07060:12012.t00591:unspliced-genomic chaperone protein dnaJ, putative, expressed| Length = 7567 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 / +1 Query: 17 APVSRISPPPPLAAHASYPP 76 +P SR+SPPPPL + PP Sbjct: 34 SPPSRVSPPPPLPPWRAPPP 93
>LOC_Os11g09740:12011.t00866:unspliced-genomic hypothetical protein| Length = 1557 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 / -3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRK 103 P +L P + PPPP HA R +S+PR+ Sbjct: 439 PHRLPPAAPDRPPPPRQIHAGRGHLRRQSLPRR 341
>LOC_Os11g03270:12011.t00218:unspliced-genomic nucleoside-triphosphatase, putative| Length = 6059 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 / +2 Query: 264 EGEGWRCLHHEHCQRGHCQEHY 329 EGE WR LH GHC Y Sbjct: 3461 EGEAWRVLHRSSVAIGHCH*GY 3526
>LOC_Os11g01330:12011.t00033:unspliced-genomic expressed protein| Length = 5208 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 / +1 Query: 528 FFFFPGNKRVEE*HNRTSMAPSTKISLTKQATELNPK 418 FF+FP KRV H R + P+ T + + NP+ Sbjct: 28 FFYFPKRKRVRRLHPRKATRPTHLPPCTFRYSHFNPR 138
>LOC_Os10g37960:12010.t03051:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 4353 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 / +2 Query: 274 PSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSA 179 PSP PC P L SS+ + R H ++L+A Sbjct: 248 PSPPLPPCSPLHPLASSAAASPRRRHLASLAA 343
>LOC_Os10g10560:12010.t00862:unspliced-genomic pectinesterase inhibitor domain containing protein| Length = 657 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 / -2 Query: 26 SRISPPPPLAAHASYPPTR*RSV 94 +R +PPP LAA +S PP R RS+ Sbjct: 320 TRAAPPPLLAAASSEPPPRWRSM 252
>LOC_Os09g24320:12009.t02115:unspliced-genomic 2-oxo acid dehydrogenases acyltransferase family protein, expressed| Length = 2730 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP P R PPPP + S PP+ S P Sbjct: 332 PPPRGPPWRRGPPPPPSRRRSSPPSSSSSAP 240
>LOC_Os09g18490:12009.t01634:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 3753 Score = 30.9 bits (61), Expect = 7.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP AP PPPP + P TR R VP Sbjct: 1904 PPPPAPSPPAPPPPPPPCPPAPPKTRSRQVP 1996
>LOC_Os08g36920:12008.t03431:unspliced-genomic AP2 domain containing protein, expressed| Length = 1114 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PP+ P R PPPP H + PP Sbjct: 408 PPRRQPPPRRPPPPPSPRHRTTPP 337
>LOC_Os08g31814:12008.t04363:unspliced-genomic OsAPRL4 - Oryza sativa adenosine 5'-phosphosulfate reductase-like,| expressed Length = 2171 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PPQ +R SPPPP + A PP Sbjct: 80 PPQATGSARGSPPPPPSCRARRPP 151
>LOC_Os08g27530:12008.t02516:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 3523 Score = 30.9 bits (61), Expect = 7.0 Identities = 18/54 (33%), Positives = 23/54 (42%) Frame = -2 / -3 Query: 298 CSWCKHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS*SAYADWH 137 CS SP S L SSS S R S ++ TPPS+ ++ WH Sbjct: 413 CSTPFPSDSSPMSSSISNS*SLPSSSYDRSTRIGASAYTSATPPSTIQSFMYWH 252
>LOC_Os08g15149:12008.t01388:unspliced-genomic oxidoreductase, 2OG-Fe oxygenase family protein, expressed| Length = 8460 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 / -3 Query: 20 PVSRISPPPPLAAHASYPPT 79 P +R+ PPPP AA PPT Sbjct: 5821 PAARLHPPPPPAARRRPPPT 5762
>LOC_Os07g45260:12007.t04165:unspliced-genomic transferase, transferring glycosyl groups, putative, expressed| Length = 1919 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP L+P+ +PPPP + S PP+ +P Sbjct: 33 PPPLSPLPSQTPPPPPWSRPSPPPSTTSPLP 125
>LOC_Os07g38600:12007.t04616:unspliced-genomic REX1 DNA Repair family protein, expressed| Length = 1636 Score = 30.9 bits (61), Expect = 7.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 / +2 Query: 23 VSRISPPPPLAAHASYPPTR*RSVPRK 103 +SR PPPPL A S P RSV R+ Sbjct: 65 LSRAPPPPPLQAPCSSPVCSYRSVQRR 145
>LOC_Os07g37580:12007.t03427:unspliced-genomic D-erythro-sphingosine kinase/ diacylglycerol kinase, putative,| expressed Length = 5664 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 / -3 Query: 20 PVSRISPPPPLAAHASYPP 76 P S PPPP+ HAS PP Sbjct: 322 PASPPPPPPPVGRHASSPP 266
>LOC_Os07g36920:12007.t03361:unspliced-genomic F-box domain containing protein, expressed| Length = 2471 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 / +2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPT 79 PP AP S S P P ++ AS PPT Sbjct: 218 PPPPAPASAASSPSPPSSAASAPPT 292
>LOC_Os07g32900:12007.t02971:unspliced-genomic rf1 protein, mitochondrial precursor, putative, expressed| Length = 4827 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 PP AP +R++P PP A+ PP R+ P Sbjct: 432 PPPRAPPARLAPAPPHHPPAAPPPLPLRASP 524
>LOC_Os07g30200:12007.t02710:unspliced-genomic asparaginyl-tRNA synthetase, putative, expressed| Length = 6458 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 / +1 Query: 35 SPPPPLAAHASYPPTR*RSVPR 100 SPPPP AS PP R R PR Sbjct: 208 SPPPPRGGAASAPPRRPRRRPR 273
>LOC_Os07g16170:12007.t01479:unspliced-genomic hypothetical protein| Length = 1399 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +2 / +3 Query: 2 LPPQLAPVSRISPPPP 49 LPPQL P R PPPP Sbjct: 441 LPPQLTPTCRRLPPPP 488
>LOC_Os07g07620:12007.t00640:unspliced-genomic pentatricopeptide repeat protein PPR868-14, putative, expressed| Length = 2734 Score = 30.9 bits (61), Expect = 7.0 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 / +3 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRKLELSAN 121 PP P+ PPPP A S PP R R R L +A+ Sbjct: 69 PPTSRPLPPPPPPPPPAHGPSPPPPRTRLHTRALAAAAS 185
>LOC_Os07g03260:12007.t00216:unspliced-genomic CSLC10 - cellulose synthase-like family C| Length = 2721 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = +2 / +2 Query: 35 SPPPPLAAHASYPPTR*RSVPR 100 SPP P A AS PP RS PR Sbjct: 398 SPPTPTAVDASSPPPSTRSTPR 463
>LOC_Os06g42210:12006.t03912:unspliced-genomic hypothetical protein| Length = 902 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 / -3 Query: 2 LPPQLAPVSRISPPPP 49 LPPQLAP + +PPPP Sbjct: 651 LPPQLAPTACGAPPPP 604
>LOC_Os06g15180:12006.t01392:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 1258 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 / -2 Query: 2 LPPQLAPVSRISPPPPLAAHASYPP 76 LPP P+S PPPP + A PP Sbjct: 225 LPPLFGPLSAQFPPPPSSPAARAPP 151
>LOC_Os06g06120:12006.t00498:unspliced-genomic expressed protein| Length = 3840 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +2 / +2 Query: 428 SSVACLVKDIFVLGAMDVLLCYSSTLLL 511 S ++ ++ D FVL ++DVL CY S L+L Sbjct: 740 SILSPILVDFFVLFSLDVLQCYYSLLML 823
>LOC_Os05g51520:12005.t04651:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class, expressed| Length = 1701 Score = 30.9 bits (61), Expect = 7.0 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -2 / -2 Query: 304 WQCSWCKHRQPSPSH 260 W C+WC R P P H Sbjct: 884 WGCAWCTWRPPPPGH 840
>LOC_Os05g43870:12005.t03876:unspliced-genomic expressed protein| Length = 2371 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PP+ AP SR + PPP A PP Sbjct: 1240 PPRAAPASRRAGPPPSPASPPAPP 1169
>LOC_Os05g24820:12005.t02139:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 747 Score = 30.9 bits (61), Expect = 7.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 / -1 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR*RSVP 97 L +L PV +PPP H PP R RS P Sbjct: 198 LASRLRPVHPRAPPPTAPRHRRPPPVRRRSPP 103
>LOC_Os05g23250:12005.t01983:unspliced-genomic Leucine Rich Repeat family protein| Length = 7571 Score = 30.9 bits (61), Expect = 7.0 Identities = 14/47 (29%), Positives = 18/47 (38%) Frame = -2 / +2 Query: 310 PRWQCSWCKHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETP 170 PRW W P SPC P+ L ++ + R SA P Sbjct: 38 PRWTDGWRSSAPPLAPVSPCNPRLLRLQHHRRPGGTSSRRCFSAAGP 178
>LOC_Os05g03040:12005.t00201:unspliced-genomic floral homeotic protein APETALA2, putative, expressed| Length = 4290 Score = 30.9 bits (61), Expect = 7.0 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = -2 / +2 Query: 310 PRWQCSWCKHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLS 182 P W H P+P H+ +P F SSS +S S S Sbjct: 3725 PSWAWKQVSHHHPAPPHTLPLPFFSSSSSSPSSSSAAASSGFS 3853
>LOC_Os04g59590:12004.t05415:unspliced-genomic ankyrin-like protein, putative, expressed| Length = 4177 Score = 30.9 bits (61), Expect = 7.0 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = -2 / +2 Query: 277 QPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPS 164 + P + PC+ Q + + + T H HR + PP+ Sbjct: 908 EAGPDYIPCLDNLQAIRNLRTTKHYEHRERHCPQHPPT 1021
>LOC_Os04g40750:12004.t03636:unspliced-genomic expressed protein| Length = 992 Score = 30.9 bits (61), Expect = 7.0 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +2 / -3 Query: 2 LPPQLAPVSRISPPPP 49 LPPQLAP + +PPPP Sbjct: 651 LPPQLAPTACGAPPPP 604
>LOC_Os03g54160:12003.t04730:unspliced-genomic MADS-box transcription factor 14, putative, expressed| Length = 10424 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 / -1 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR 82 LPP L P PPP L S PPT+ Sbjct: 308 LPPVLPPPPPPPPPPSLPLSLSLPPTK 228
>LOC_Os03g50280:12003.t04370:unspliced-genomic expressed protein| Length = 2131 Score = 30.9 bits (61), Expect = 7.0 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 / -2 Query: 5 PPQLAPVSRISPPPPLAAHASYPPTR*RSVPRK 103 PP P R PPPP AA S R PR+ Sbjct: 423 PPSSGPAPRTPPPPPSAASPSPSAPPPRPPPRR 325
>LOC_Os03g39129:12003.t03352:unspliced-genomic expressed protein| Length = 5098 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 / -1 Query: 2 LPPQLAPVSRISPPPPLAAHASYPPTR 82 LPPQ P+ ++ PP PL PP R Sbjct: 550 LPPQSPPLPQLLPPQPLPPPPLSPPRR 470
>LOC_Os03g37800:12003.t03233:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 500 Score = 30.9 bits (61), Expect = 7.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 / -2 Query: 29 RISPPPPLAAHASYPPT 79 R P PP+A HA +PPT Sbjct: 247 RARPSPPMARHAGWPPT 197
>LOC_Os03g06510:12003.t00518:unspliced-genomic viral A-type inclusion protein repeat containing protein, expressed| Length = 12160 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 / +2 Query: 377 CPSESSGILQFRRYFGFSSVACLVKDIFVLGAMD 478 CP S GI+ + F +C+ KDI+ LGA + Sbjct: 3104 CPVHSWGIVSVQELI*FMRHSCIPKDIWQLGAWE 3205
>LOC_Os02g58180:12002.t005566:unspliced-genomic expressed protein| Length = 1886 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 / -1 Query: 5 PPQLAPVSRISPPPPLAAHASYPP 76 PP AP SPPPPL A PP Sbjct: 1490 PPAPAPPRPPSPPPPLPPSAPTPP 1419
>LOC_Os02g57820:12002.t05353:unspliced-genomic DNA binding protein, putative, expressed| Length = 4314 Score = 30.9 bits (61), Expect = 7.0 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -2 / -1 Query: 286 KHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS 161 K R SH+ I + SSS+ T+ S +S TPPSS Sbjct: 1794 KRRGTKASHA*SIEVSDVDSSSKSDFRSTYTSIISTHTPPSS 1669
>LOC_Os02g56700:12002.t05242:unspliced-genomic dihydroflavonol-4-reductase, putative, expressed| Length = 2475 Score = 30.9 bits (61), Expect = 7.0 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = +2 / -2 Query: 20 PVSRISPPPPLAAHASYPPTR*RSVP 97 P SR +PPP AA AS PP S P Sbjct: 1094 PPSRTAPPPRAAADASTPPPSPSSPP 1017
>LOC_Os01g63080:12001.t05678:unspliced-genomic retrotransposon protein, putative, Ty3-gypsy subclass| Length = 7911 Score = 30.9 bits (61), Expect = 7.0 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 / +1 Query: 480 TSMAPSTKISLTKQATELNPKYRLN 406 T MAP I++T + T+L PK+ LN Sbjct: 3508 TGMAPIVTITITMKGTQLLPKFLLN 3582
>LOC_Os01g62990:12001.t05670:unspliced-genomic pollen-specific kinase partner protein, putative, expressed| Length = 4133 Score = 30.9 bits (61), Expect = 7.0 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -2 / +3 Query: 298 CSWCKHRQPSPSHSPCIPKFQLLSSSQQTSHRTHRSTLSAETPPSS 161 C C HR+ P + C P L+ + QT+ + + L+ + P S Sbjct: 1677 CENCSHRKEKPVN*TCFPYLNLVLNCNQTNVMSWKDMLT*QQMPIS 1814 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 229,408,769 Number of extensions: 4142467 Number of successful extensions: 42120 Number of sequences better than 10.0: 335 Length of query: 176 Length of database: 55,613,886 Length adjustment: 48 Effective length of query: 128 Effective length of database: 52,912,542 Effective search space: 6772805376 Effective search space used: 6772805376 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
