ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | FLbaf60g22 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os12g12340:12012.t01103:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 7437 Score = 42.8 bits (87), Expect(2) = 0.009 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +2 / +3 Query: 1961 SVFLHSFLSVCSLYIGISKTSYIYGRREYII 2053 + F HSFLS + + SKTSYI GRREY++ Sbjct: 5349 TTFHHSFLSTFLITVSNSKTSYILGRREYLV 5441 Score = 26.7 bits (52), Expect(2) = 0.009 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 / +3 Query: 1252 TCPNLCQEVLGLTQPLARV 1308 TCP LCQE+ G +P+ ++ Sbjct: 1305 TCP*LCQEI*GC*EPMLQL 1361
>LOC_Os03g32270:12003.t02820:unspliced-genomic sigma factor sigB regulation protein rsbQ, putative, expressed| Length = 5317 Score = 36.3 bits (73), Expect(3) = 0.080 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 / +1 Query: 1973 HSFLSVCSLYIGISKTSYIYGRREYI 2050 HS L + + SKTSYI+GRREY+ Sbjct: 2260 HSLLPTFLITVSNSKTSYIWGRREYV 2337 Score = 26.3 bits (51), Expect(3) = 0.080 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 / +1 Query: 3199 GALNLTSTLNLKSILTIVKYWRAA*LFY 3282 G N+T + +K I+++ RAA LFY Sbjct: 5164 GCFNVTESFRIKLIMSVWPLPRAATLFY 5247 Score = 25.4 bits (49), Expect(3) = 0.080 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 / +1 Query: 12 PLAAAAGPFPPSHGKSPP 65 P + +A P PPS SPP Sbjct: 418 PASTSATPSPPSSAPSPP 471
>LOC_Os10g31460:12010.t02469:unspliced-genomic glycine-rich cell wall structural protein 2 precursor, putative,| expressed Length = 8917 Score = 39.6 bits (80), Expect = 0.16 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = +2 / -3 Query: 2000 YIGISKTSYIYGRREYIITFLLYN 2071 Y+ S TS IYGRREYII+FLL N Sbjct: 5843 YLKKSTTSNIYGRREYIISFLLNN 5772 Score = 35.4 bits (71), Expect = 2.8 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = -3 / +1 Query: 2070 LYNRNVIMYSLRP*I*DVLD 2011 L+NRN I+YSLRP*I DV+D Sbjct: 5773 LFNRNDIIYSLRP*IFDVVD 5832 Score = 35.0 bits (70), Expect = 3.8 Identities = 11/23 (47%), Positives = 18/23 (78%) Frame = +1 / -2 Query: 1996 SIYWNIQNILYLWTEGVHNYVSV 2064 +I+ + ++ YLWTEGV+N VS+ Sbjct: 5847 NIFEKVNDVKYLWTEGVYNIVSI 5779
>LOC_Os04g26834:12004.t02389:unspliced-genomic pepsin A, putative, expressed| Length = 9149 Score = 26.7 bits (52), Expect(3) = 0.16 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +2 / -1 Query: 1997 LYIGISKTSYIYGRREYIITF 2059 +Y+G ++ SYI R EY++ + Sbjct: 4805 MYVGNTRKSYIAKRMEYVVKY 4743 Score = 23.5 bits (45), Expect(3) = 0.16 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 / -2 Query: 1942 MNIDTF*RVSSFISVCM*SI 2001 MN+D + SF S+CM*+I Sbjct: 4849 MNLDIRMCLGSFTSICM*AI 4790 Score = 22.1 bits (42), Expect(3) = 0.16 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 / -1 Query: 1891 ILPPFTNIRCSN 1926 +LPPF N+R S+ Sbjct: 4910 LLPPFHNVRLSS 4875
>LOC_Os10g28590:12010.t02210:unspliced-genomic CAF1 family ribonuclease containing protein| Length = 3550 Score = 29.5 bits (58), Expect(2) = 0.19 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 / +2 Query: 175 WCSTPPTPPFTGGAEAGKT 119 WCSTPPT T A AG + Sbjct: 839 WCSTPPTTGCTSPAWAGSS 895 Score = 27.2 bits (53), Expect(2) = 0.19 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -2 / +2 Query: 223 SATIAPSPPWEIRKDDWCSTP 161 S T SP W WCSTP Sbjct: 689 SPTDCTSPAWAGSSTTWCSTP 751 Score = 29.5 bits (58), Expect(2) = 0.46 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 / +3 Query: 175 WCSTPPTPPFTGGAEAGKT 119 WCSTPPT T A AG + Sbjct: 1161 WCSTPPTTGCTSPAWAGSS 1217 Score = 25.8 bits (50), Expect(2) = 0.46 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -2 / +3 Query: 217 TIAPSPPWEIRKDDWCSTP 161 T SP W WCSTP Sbjct: 1023 TDCTSPAWAGSSTTWCSTP 1079 Score = 36.3 bits (73), Expect = 1.5 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 / +2 Query: 223 SATIAPSPPWEIRKDDWCSTPPTPPFTGGAEAGKT 119 + T SP W WCSTPPT T A AG + Sbjct: 359 TTTGCTSPAWAESSTTWCSTPPTTGCTSPAWAGSS 463
>LOC_Os04g46050:12004.t04137:unspliced-genomic dolichyl-P-Man Man, putative, expressed| Length = 7553 Score = 32.7 bits (65), Expect(2) = 0.44 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +2 / +1 Query: 1997 LYIGISKTSYIYGRREYIITFLLY 2068 +Y+G ++ SYI RREY++ +L++ Sbjct: 6391 MYVGNTRKSYIVKRREYLLKYLMH 6462 Score = 22.6 bits (43), Expect(2) = 0.44 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 / +1 Query: 1816 YINEKLHIVEQDDLVHVCYHGD*YSILPPFTNIRCSN 1926 Y E+ +E+ + Y * +LPPF N+R S+ Sbjct: 6211 YSKEEKISIEEYQERNFTYLLK*VYLLPPFHNVRLSS 6321
>LOC_Os01g45850:12001.t04038:unspliced-genomic conserved hypothetical protein| Length = 456 Score = 27.6 bits (54), Expect(2) = 0.52 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -2 / -2 Query: 223 SATIAPSPPWEIRKDDWCSTPPTP 152 SA +AP PP EI S+PP P Sbjct: 170 SACLAPIPPDEILSSSSPSSPPDP 99 Score = 27.6 bits (54), Expect(2) = 0.52 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -2 / -3 Query: 175 WCSTPPTPPFTGGAEAGKTWP 113 W PP PP A A +WP Sbjct: 82 WRPPPPPPPHRQNAPASPSWP 20
>LOC_Os10g39200:12010.t03162:unspliced-genomic expressed protein| Length = 4982 Score = 37.7 bits (76), Expect = 0.57 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +3 / -2 Query: 96 GSYWCSGQVFPASAPPVNGGVGGVEHQSSLRISHGGDG 209 G + G P APPV+GG GGVE + I GG G Sbjct: 304 GGHVAGGGFHPRRAPPVSGGGGGVEGRRGGEIEPGGVG 191 Score = 36.3 bits (73), Expect = 1.5 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -2 / +3 Query: 208 PSPPWEIRKDDWCSTPPTPPFTGGAEAG 125 P+PP I STPP PP TGGA G Sbjct: 192 PTPPGSISPPRLPSTPPPPPETGGARRG 275
>LOC_Os10g33500:12010.t02651:unspliced-genomic hypothetical protein| Length = 9024 Score = 37.7 bits (76), Expect = 0.57 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = -2 / -3 Query: 241 RGRP*RSATIAPSPPWEIRKDDWCSTPPTPPFTGGAEAGKTWPEHQ 104 R P S ++P PP + +PP PP G G+TW Q Sbjct: 2998 RSDPLPSPLLSPPPPRPLPPSPPLPSPPPPPLLSGGRCGRTWASGQ 2861
>LOC_Os03g18560:12003.t01627:unspliced-genomic cp protein, putative, expressed| Length = 1096 Score = 37.7 bits (76), Expect = 0.57 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = -1 / -1 Query: 3494 ACAASQSTIHFCKFPFNLARPHPRPLHKRPSSSCTYLRSRTKR 3366 +C+ S S FC FPF+L H P S CT R R +R Sbjct: 502 SCSRSSSCSGFCIFPFSLFTSHFAPSPTLVDSDCTTTRRRRRR 374
>LOC_Os04g18010:12004.t01546:unspliced-genomic cleavage and polyadenylation specificity factor, 160 kDasubunit,| putative, expressed Length = 27480 Score = 28.6 bits (56), Expect(2) = 1.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 / +3 Query: 1997 LYIGISKTSYIYGRREYIITF 2059 +Y+G ++ SYI RREYI F Sbjct: 20433 IYVGNARKSYIVKRREYIEYF 20495 Score = 24.9 bits (48), Expect(2) = 1.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 / +3 Query: 1885 YSILPPFTNIRCSN 1926 Y +LPPF N+R S+ Sbjct: 20322 YMLLPPFHNVRLSS 20363
>LOC_Os01g11550:12001.t01025:unspliced-genomic mutant cincinnata, putative, expressed| Length = 2692 Score = 24.9 bits (48), Expect(3) = 1.3 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 / +3 Query: 104 LVLGPSFPGFCASC 145 L+L SF GFC SC Sbjct: 264 LLLVDSFDGFCVSC 305 Score = 22.1 bits (42), Expect(3) = 1.3 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +1 / +1 Query: 1 GRFTPWPPP 27 G PWPPP Sbjct: 205 GSVPPWPPP 231 Score = 22.1 bits (42), Expect(3) = 1.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 / +3 Query: 186 RISHGGDGAMV 218 R++HGGDG V Sbjct: 414 RVTHGGDGGGV 446
>LOC_Os06g14324:12006.t01307:unspliced-genomic calcium binding EF-hand protein, putative, expressed| Length = 7003 Score = 30.4 bits (60), Expect(2) = 1.4 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +1 / +1 Query: 13 PWPPPQAPSLPRTANR 60 P PPP +PSLP T+NR Sbjct: 3016 PPPPPLSPSLPLTSNR 3063 Score = 23.1 bits (44), Expect(2) = 1.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 / +1 Query: 111 SGQVFPASAPPVNGGVGG 164 S + A+ P +GGVGG Sbjct: 3055 SNRAMAAAVAPTSGGVGG 3108
>LOC_Os10g42430:12010.t03468:unspliced-genomic transcription factor MYC7E, putative, expressed| Length = 2754 Score = 30.9 bits (61), Expect(2) = 1.5 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 / -1 Query: 220 ATIAPSPPWEIRKDDWCSTPPTPPFTGGAEAGKTWP 113 A+ A SPP CS PP P G + TWP Sbjct: 1683 ASAAASPPPAAAPPRGCSPPPAPTPPGPSGPTPTWP 1576 Score = 22.6 bits (43), Expect(2) = 1.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 / -1 Query: 129 PGKLGPSTSNSRERVKRTA 73 PG+ PST+ S +RTA Sbjct: 1578 PGRPSPSTAASSAPTRRTA 1522 Score = 34.1 bits (68), Expect = 7.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 / +1 Query: 13 PWPPPQAPSLPRTANRRRNFGG 78 PW PP AP+ P T RRR G Sbjct: 1456 PWRPPPAPATPTTTRRRRRTRG 1521
>LOC_Os02g13190:12002.t01116:unspliced-genomic expressed protein| Length = 1688 Score = 29.5 bits (58), Expect(2) = 1.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 / +2 Query: 16 WPPPQAPSLPRTANRRRNFGG 78 WPPP PS R RR GG Sbjct: 53 WPPPPPPSCSRHRRRRAR*GG 115 Score = 24.0 bits (46), Expect(2) = 1.6 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 / +2 Query: 185 TNFPWWRRCDGS 220 TN P WRRC S Sbjct: 242 TNAPPWRRCSSS 277
>LOC_Os05g49040:12005.t04647:unspliced-genomic expressed protein| Length = 1824 Score = 29.9 bits (59), Expect(2) = 1.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 / -2 Query: 3689 LMWWMLVFLGDGWMW 3733 ++WW V LGDG W Sbjct: 104 ILWWTFVLLGDGMEW 60 Score = 29.5 bits (58), Expect(2) = 1.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 / -1 Query: 1 GRFTPWPPPQAPSLPRTANR 60 GR TPWP P P TA+R Sbjct: 1527 GRRTPWPTPPR*GAPSTASR 1468
>LOC_Os01g16290:12001.t01478:unspliced-genomic DNA gyrase subunit B, putative, expressed| Length = 11847 Score = 28.1 bits (55), Expect(2) = 1.9 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 / +1 Query: 1867 CYHGD*YSILPPFTNIR 1917 C H Y +LPPFTNIR Sbjct: 2158 C*HILMYQVLPPFTNIR 2208 Score = 24.9 bits (48), Expect(2) = 1.9 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = +1 / +3 Query: 2011 IQNILYLWTEG 2043 IQN LYLW EG Sbjct: 2259 IQNPLYLWMEG 2291 Score = 29.5 bits (58), Expect(2) = 2.5 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 / -3 Query: 2042 PSVHKYKMFWIFQYI 1998 PS+HKYK F IF Y+ Sbjct: 2290 PSIHKYKGFCIFVYV 2246 Score = 23.1 bits (44), Expect(2) = 2.5 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -1 / -2 Query: 1916 LIFVNGGSILY 1884 LIFVNGGS Y Sbjct: 2207 LIFVNGGSTWY 2175
>LOC_Os08g19850:12008.t01803:unspliced-genomic threonyl-tRNA synthetase, mitochondrial precursor, putative,| expressed Length = 9599 Score = 27.6 bits (54), Expect(2) = 1.9 Identities = 9/9 (100%), Positives = 9/9 (100%) Frame = +1 / -1 Query: 2023 LYLWTEGVH 2049 LYLWTEGVH Sbjct: 6341 LYLWTEGVH 6315 Score = 25.4 bits (49), Expect(2) = 1.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +3 / -1 Query: 1893 TTSVHKYKMF*L 1928 TTSVHKYK F*+ Sbjct: 6497 TTSVHKYKHF*V 6462
>LOC_Os01g18320:12001.t01627:unspliced-genomic protoporphyrinogen oxidase, chloroplast precursor, putative,| expressed Length = 3641 Score = 28.1 bits (55), Expect(2) = 2.0 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +1 / +3 Query: 13 PWPPPQAPSLPRTANRRRNFGGAFDALT 96 PWPPP P R + GG DA T Sbjct: 81 PWPPPPPPRQRRRSAFATPRGGPADAAT 164 Score = 24.9 bits (48), Expect(2) = 2.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +3 / +2 Query: 144 VNGGVGGVEHQSSLRISHGGDGAMVADLYGRP 239 V GG+ G+ +L HG +V + RP Sbjct: 242 VGGGISGLCTAQALATKHGVGDVLVTEARARP 337
>LOC_Os10g40510:12010.t03290:unspliced-genomic cortical cell-delineating protein precursor, putative, expressed| Length = 815 Score = 35.4 bits (71), Expect = 2.8 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 / +2 Query: 1465 GHHKINGLNILFFYYCKFSLCLALQWIITIQLLPILSFVYF 1587 G ++ LN L F C F LCL LQ +I+ P+ S Y+ Sbjct: 566 GWFTVSSLNSLNFGNCLFCLCLCLQSLISSGKKPLASMYYY 688
>LOC_Os10g04000:12010.t00289:unspliced-genomic mitogen-activated protein kinase kinase kinase 1, putative| Length = 1581 Score = 35.4 bits (71), Expect = 2.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 / -2 Query: 241 RGRP*RSATIAPSPPWEIRKDDWCSTPPTPP 149 R P + T A PP ++ WCS PP PP Sbjct: 323 RRPPFLATTSASDPPGAYSRNSWCSPPPQPP 231
>LOC_Os03g58570:12003.t05111:unspliced-genomic sec12-like protein 1, putative, expressed| Length = 3863 Score = 35.4 bits (71), Expect = 2.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +1 / +1 Query: 2788 VLCKYFILCFFYPKSVRRAVS 2850 VLCKY +CFF+P SV VS Sbjct: 3550 VLCKYLPICFFFPCSVANVVS 3612
>LOC_Os08g08880:12008.t00774:unspliced-genomic hypothetical protein| Length = 2356 Score = 29.5 bits (58), Expect(2) = 2.8 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 / -1 Query: 2045 YIITFLLYN*NLTICCRCLMILHCD 2119 YI T + +*+L C +CL +LHC+ Sbjct: 1996 YIHTHI*IH*HLNECRQCLKVLHCE 1922 Score = 23.1 bits (44), Expect(2) = 2.8 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 / -2 Query: 1891 ILPPFTNIRCSN 1926 ILPPF N+R S+ Sbjct: 2082 ILPPFHNVRLSS 2047
>LOC_Os10g25620:12010.t01979:unspliced-genomic no apical meristem protein, expressed| Length = 2159 Score = 27.6 bits (54), Expect(2) = 2.8 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 / -3 Query: 9 HPLAAAAGPFPPSHGKSPP*LRRCV*RAHGSYWC 110 HP A A P + ++ P RRC RA G C Sbjct: 1896 HPPAMPAAPVGDTDARAAPGRRRCSRRAPGGCSC 1795 Score = 24.9 bits (48), Expect(2) = 2.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 / -1 Query: 161 RRGAPVILTNFPWWRR 208 RR PV++ + WWRR Sbjct: 1778 RRREPVVVVDGWWWRR 1731
>LOC_Os02g41470:12002.t03733:unspliced-genomic lysyl-tRNA synthetase, putative, expressed| Length = 11939 Score = 27.2 bits (53), Expect(2) = 3.3 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 / +3 Query: 1997 LYIGISKTSYIYGRREYI 2050 +Y+G ++ SYI RREY+ Sbjct: 876 MYVGNARKSYIVKRREYL 929 Score = 24.9 bits (48), Expect(2) = 3.3 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +1 / +1 Query: 1882 *YSILPPFTNIRCSN 1926 *Y +LPPF N+R S+ Sbjct: 754 *YLLLPPFHNVRLSS 798
>LOC_Os03g62070:12003.t05434:unspliced-genomic IAA-amino acid hydrolase ILR1 precursor, putative, expressed| Length = 4326 Score = 29.9 bits (59), Expect(2) = 3.6 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 / -2 Query: 1997 LYIGISKTSYIYGRREYIITFLLY 2068 +Y+G ++ SYI RREY + F ++ Sbjct: 521 IYVGNTRKSYIVKRREYHLNFSIF 450 Score = 22.1 bits (42), Expect(2) = 3.6 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 / -2 Query: 1891 ILPPFTNIRCSN 1926 +LPPF N+R S+ Sbjct: 626 LLPPFHNVRLSS 591
>LOC_Os10g25010:12010.t01924:unspliced-genomic caltractin, putative, expressed| Length = 3201 Score = 35.0 bits (70), Expect = 3.8 Identities = 16/63 (25%), Positives = 26/63 (41%) Frame = -3 / -2 Query: 3723 PSPRKTNIHHIRHNTQVNVLKMGTSTTKSYHTTEQDLQTSSRNLALLQAISIRRPCYSKQ 3544 P PR + +HHI+ Q+ + K+ + + + R L LL I + S Sbjct: 1844 PRPRSSPVHHIQIQIQIQITHNNDHNNKNKNKNNKKKKKKERTLTLLSLSMILKALLSSS 1665 Query: 3543 FAS 3535 AS Sbjct: 1664 LAS 1656
>LOC_Os06g47120:12006.t04398:unspliced-genomic expressed protein| Length = 2279 Score = 35.0 bits (70), Expect = 3.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -2 / +2 Query: 3760 ERSSRKPHNPHPPITKKD*HPPHQA*HTGKCPENGHQH 3647 E S R PH P P + H P++ H + P+ H+H Sbjct: 956 ESSRRVPHPPRPRPARMQNHHPNRRRHRWRAPDEPHRH 1069
>LOC_Os06g09960:12006.t00874:unspliced-genomic expressed protein| Length = 1366 Score = 35.0 bits (70), Expect = 3.8 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -2 / -1 Query: 223 SATIAPSPPWEIRKDDWCSTPPTPPFTGGAEAGKTWPE 110 SA +APSP I PP+P F A G+ WP+ Sbjct: 301 SAPVAPSPAPPITSSRTFPPPPSPTFPQRAAHGERWPD 188
>LOC_Os03g24650:12003.t02159:unspliced-genomic terpene synthase 8, putative| Length = 1610 Score = 35.0 bits (70), Expect = 3.8 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 / +1 Query: 211 APSPPWEIRKDDWCSTPPTPPFTGGAEAGKTW 116 +PSPPW ++ TPP TG A TW Sbjct: 1234 SPSPPWSAPAGSSPASSTTPPPTGSGRAAGTW 1329
>LOC_Os02g54640:12002.t05043:unspliced-genomic glutamate receptor 2.9 precursor, putative, expressed| Length = 6890 Score = 35.0 bits (70), Expect = 3.8 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -3 / -2 Query: 2355 INKFSMRNIRSMIFKTHFPTMYHIIIYTPSIRKYLS 2248 ++K R++ I H T+ +I+YTPS+ KYL+ Sbjct: 1420 VDK*QWRSLNKHISYRHVSTLTKLIVYTPSVSKYLT 1313
>LOC_Os03g52290:12003.t04555:unspliced-genomic conserved hypothetical protein| Length = 696 Score = 29.5 bits (58), Expect(2) = 4.1 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 / +2 Query: 283 RMCGPSPPCAGDCP 324 R CGPSPP CP Sbjct: 509 RSCGPSPPAPAGCP 550 Score = 22.6 bits (43), Expect(2) = 4.1 Identities = 7/22 (31%), Positives = 10/22 (45%) Frame = +2 / +1 Query: 152 RSWRRGAPVILTNFPWWRRCDG 217 R W G +L + W C+G Sbjct: 382 RQWNNGGGALLESAKWLVYCNG 447
>LOC_Os12g39660:12012.t03645:unspliced-genomic calcium-transporting ATPase 2, plasma membrane-type, putative,| expressed Length = 5719 Score = 27.2 bits (53), Expect(2) = 4.7 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 / +2 Query: 1732 NNSYMASYLSRHNMCRLLLV*KC 1664 N SY ASY +H + LLLV C Sbjct: 5543 NVSYFASYCKKHFVLALLLVQLC 5611 Score = 24.4 bits (47), Expect(2) = 4.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 / +3 Query: 1686 GYCLFKNVYRGLVCGLLN 1633 G+CL+ N +CGL+N Sbjct: 5625 GWCLYWNSVTRKLCGLMN 5678
>LOC_Os06g39880:12006.t03685:unspliced-genomic cytochrome P450 72A1, putative, expressed| Length = 2535 Score = 27.2 bits (53), Expect(2) = 5.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 / +3 Query: 119 SFPGFCASCEWRSWRRGA 172 S P + C WR+W R A Sbjct: 1308 SMPAWTGRCRWRTWWRSA 1361 Score = 24.4 bits (47), Expect(2) = 5.0 Identities = 6/11 (54%), Positives = 6/11 (54%) Frame = +1 / +3 Query: 289 CGPSPPCAGDC 321 C P PPC C Sbjct: 1401 CSPGPPCCSPC 1433
>LOC_Os10g38440:12010.t03086:unspliced-genomic hypothetical protein| Length = 1718 Score = 34.5 bits (69), Expect = 5.3 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 / -2 Query: 3443 LARPHPRPLHKRPSSSCTYLRSRTKRHHASCWLAYN 3336 L RP P P H RP SS R+R +R A+ L ++ Sbjct: 1036 LPRPSPLPAHHRPPSSTCVARNRDERESAARSLCFS 929
>LOC_Os09g09950:12009.t00787:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 5185 Score = 34.5 bits (69), Expect = 5.3 Identities = 12/43 (27%), Positives = 26/43 (60%) Frame = -3 / +2 Query: 2202 FYLFLGQVFSDGWSIKHVEICLNELIILSQCKIIRHLQHIVKF 2074 FYL LG+ + D + ++ IC N LI++ + + ++ +++ F Sbjct: 4556 FYLLLGKKYIDIYIYIYILICRNRLIVMCKVTVCMNIIYVIMF 4684
>LOC_Os08g27540:12008.t02517:unspliced-genomic expressed protein| Length = 3332 Score = 34.5 bits (69), Expect = 5.3 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -2 / +2 Query: 3757 RSSRKPHNPHPPITKKD*HPPHQA*HTGKCPENGHQHHKKLP 3632 +++ +P PHP + +++ P + *H G H+ H++LP Sbjct: 731 QAAHRPRPPHP*LRRRNPPPAAEP*HRGPSSPPLHRRHRRLP 856
>LOC_Os08g09410:12008.t00826:unspliced-genomic F-box domain containing protein| Length = 1755 Score = 34.5 bits (69), Expect = 5.3 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 / -3 Query: 3733 PHPPITKKD*HPPHQA*HTGKCPENGHQHHKKLPH 3629 PHPP+ + PH + H P H HH PH Sbjct: 1225 PHPPLPLQHHSCPHPSPHPLPSPPPHHHHHYSRPH 1121
>LOC_Os01g66150:12001.t05976:unspliced-genomic expressed protein| Length = 2365 Score = 34.5 bits (69), Expect = 5.3 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 / -3 Query: 235 RP*RSATIAPSPPWEIRKDDWCSTPPTPPFTGGAEAGKTWP 113 RP AT AP PP +R PP PP A WP Sbjct: 647 RPSAGATTAPPPPQPLRPSSPRPRPPPPPPLPPPPAAARWP 525
>LOC_Os01g31870:12001.t02768:unspliced-genomic metal transporter Nramp6, putative, expressed| Length = 11027 Score = 34.5 bits (69), Expect = 5.3 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = +1 / +1 Query: 2788 VLCKYFILCFFYP 2826 +LCKYF+LCFF+P Sbjct: 1525 LLCKYFLLCFFFP 1563
>LOC_Os09g31434:12009.t02786:unspliced-genomic expressed protein| Length = 744 Score = 28.6 bits (56), Expect(2) = 5.5 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +2 / -3 Query: 113 GPSFPGFCASCEWRSWRRGAPVILTNFPWWRRC 211 G P WR R AP + P WRRC Sbjct: 442 GAGAPPRVGGAPWRPTRAPAPAPRGSHPRWRRC 344 Score = 23.1 bits (44), Expect(2) = 5.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 / -2 Query: 16 WPPPQAPSLPRTANRRR 66 W PP+A S +A RRR Sbjct: 485 WQPPRARSSTYSAARRR 435
>LOC_Os06g04610:12006.t00351:unspliced-genomic ribosome-binding factor A, chloroplast precursor, putative, expressed| Length = 5664 Score = 28.1 bits (55), Expect(3) = 5.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 / +1 Query: 2069 CTTET*LCTPSVHKYKMFWIFQYIDYIQ 1986 CT TP +HKYKM+++ D+ Q Sbjct: 5554 CTYFFNYVTPCIHKYKMYFVSLVQDFDQ 5637 Score = 27.2 bits (53), Expect(3) = 5.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 / +2 Query: 2453 CFLITCISTLFLCLFLHI 2400 C+L +C+S L LCL L + Sbjct: 902 CYLTSCVSILHLCLNLKL 955 Score = 25.8 bits (50), Expect(3) = 5.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 / +2 Query: 3679 TGKCPENGHQHHK 3641 T K PEN H+HH+ Sbjct: 68 TAKPPENHHRHHR 106
>LOC_Os08g04400:12008.t00335:unspliced-genomic CRR2, putative| Length = 2558 Score = 31.3 bits (62), Expect(2) = 6.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 / +1 Query: 3647 VLVPIFRTFTCVLCLMWWMLVFL 3715 VL+ +F C++C MW+ML+ L Sbjct: 2350 VLLHVFVICDCIICQMWYMLLML 2418 Score = 26.7 bits (52), Expect(2) = 6.0 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +1 / +2 Query: 10 TPWPPPQAPSLPRTANRRR 66 +P PPP P PR RRR Sbjct: 62 SPRPPPPPPPPPRRRRRRR 118
>LOC_Os09g20120:12009.t01746:unspliced-genomic transposon protein, putative, CACTA, En/Spm sub-class| Length = 6454 Score = 26.7 bits (52), Expect(2) = 6.3 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +1 / +3 Query: 2281 YDMIHCGKMSFEYHTSNVPH*KFIYCSVNF*NLRVSYVLMICKN 2412 +D+ + G + + Y + V H +Y NF* + ++L+IC N Sbjct: 3105 HDVNYFGCIDYPYKSIVVWHMLIMYNY*NF*QF*IMHMLVICDN 3236 Score = 24.4 bits (47), Expect(2) = 6.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 / +1 Query: 2440 VIRKHRNFVNCIWFTKLRIISTNVVKS 2520 +IR +NF +C+W + I N KS Sbjct: 3232 IIRIFKNFKSCMWHLHMLIRIFNNFKS 3312
>LOC_Os06g04169:12006.t00307:unspliced-genomic catalytic/ hydrolase, putative, expressed| Length = 6329 Score = 27.2 bits (53), Expect(2) = 6.3 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 / -1 Query: 1951 DTF*RVSSFISVCM*SIYWNI 2013 DTF* S +VC S+YWNI Sbjct: 1808 DTF*YNESEQTVCPDSLYWNI 1746 Score = 24.0 bits (46), Expect(2) = 6.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +2 / -1 Query: 2012 SKTSYIYGRREYIITFLLYN* 2074 ++ YI RREYI+ LY+* Sbjct: 1739 TQNPYIIRRREYIVRKYLYS* 1677
>LOC_Os04g31780:12004.t02859:unspliced-genomic hypothetical protein| Length = 739 Score = 29.0 bits (57), Expect(2) = 6.4 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 / -1 Query: 3431 HPRPLHKRPSSSCTYLRSRTKRHH 3360 H RPL +RPSSS ++L S +H Sbjct: 478 HVRPLCQRPSSSISFLSSHFFSNH 407 Score = 27.2 bits (53), Expect(2) = 6.4 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -3 / -2 Query: 285 PISQINSPVCHQISKEAVHRGQLPSHRLHH 196 P + S + + HRG+ P HR HH Sbjct: 273 PFLRSTSSASATVETTSQHRGRQPPHRHHH 184
>LOC_Os12g40860:12012.t03764:unspliced-genomic Leucine Rich Repeat family protein, expressed| Length = 4588 Score = 26.7 bits (52), Expect(2) = 6.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 / -1 Query: 113 RAPVTPVSASNAPPKLRRRFA 51 R P SA++APP+ RRR A Sbjct: 166 RRSAAPSSAASAPPRRRRRRA 104 Score = 24.4 bits (47), Expect(2) = 6.4 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -2 / -1 Query: 235 RP*RSATIAPSPPWEIRKDDWCSTPPTP 152 RP R PSPP R+ PP+P Sbjct: 280 RPPRPTPAPPSPPPPTRRSPPPPPPPSP 197
>LOC_Os08g43160:12008.t04041:unspliced-genomic TCP family transcription factor containing protein, expressed| Length = 1959 Score = 26.3 bits (51), Expect(2) = 6.9 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = -1 / -2 Query: 323 GQSPAQGGDGPHILSVRSTHQFVIRSRKRPSIEVSYHRTV 204 G PA GDG H S R+ RPS+ V R + Sbjct: 656 GHEPAVHGDGAHRHSRRAPPTTTTSRTDRPSLRVLLPRAL 537 Score = 24.9 bits (48), Expect(2) = 6.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 / -1 Query: 211 APSPPWEIRKDDW 173 AP+PPW + DW Sbjct: 510 APAPPWGWMRRDW 472
>LOC_Os04g22070:12004.t01938:unspliced-genomic hypothetical protein| Length = 1756 Score = 26.3 bits (51), Expect(2) = 6.9 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 / -1 Query: 3227 FKVLVRFNAPHLHLRQNSVT 3168 F L F+APH+HL +S++ Sbjct: 775 FNFLFFFSAPHIHLSSDSLS 716 Score = 24.9 bits (48), Expect(2) = 6.9 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -1 / -2 Query: 3452 PFNLARPHPRPLHKRPSSSCTYLRSRTKRHHASCW 3348 PF+ P + + SS LR + + H CW Sbjct: 981 PFSAFSSSPSTVSENGSSLAAKLRGLSMKMHPFCW 877
>LOC_Os06g41090:12006.t03804:unspliced-genomic anthranilate phosphoribosyltransferase-like protein, putative,| expressed Length = 2657 Score = 34.1 bits (68), Expect = 7.2 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +1 / -2 Query: 10 TPWPPPQAPSLPRTANRRRNFG 75 +P PPP A + PRTA RRR G Sbjct: 925 SPGPPPSATAAPRTARRRRTPG 860
>LOC_Os06g08350:12006.t00716:unspliced-genomic expressed protein| Length = 1537 Score = 34.1 bits (68), Expect = 7.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 / -1 Query: 241 RGRP*RSATIAPSPPWEIRKDDWCSTPPTPP 149 R R R + P PPW R CS P TPP Sbjct: 1021 RERSRRRRSSPPPPPWPSRPPSPCSRPTTPP 929
>LOC_Os04g01874:12004.t00084:unspliced-genomic protein kinase domain containing protein, expressed| Length = 7798 Score = 34.1 bits (68), Expect = 7.2 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +2 / +2 Query: 1961 SVFLHSFLSVCSLYIGISKTSYIYGRREYIIT 2056 + F H FL + + SKTSYI GRRE + T Sbjct: 6479 TTFHHPFLPTFLITVSNSKTSYIIGRRE*LFT 6574
>LOC_Os02g13710:12002.t01167:unspliced-genomic transcriptional factor TINY, putative, expressed| Length = 1091 Score = 34.1 bits (68), Expect = 7.2 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +1 / +2 Query: 10 TPWPPPQAPSLPRTANRRRNFGGA 81 T W PP + S PR+ RRRN GA Sbjct: 533 TSWTPPSSCSAPRSRTRRRNTRGA 604
>LOC_Os06g01320:12006.t00033:unspliced-genomic SNF2 family N-terminal domain containing protein, expressed| Length = 13566 Score = 28.1 bits (55), Expect(2) = 7.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 / +1 Query: 1873 HGD*YSILPPFTNIRCSN 1926 H D Y +LPPF N+R S+ Sbjct: 8398 HFDPYMLLPPFHNVRLSS 8451 Score = 22.6 bits (43), Expect(2) = 7.8 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 / +1 Query: 1997 LYIGISKTSYIYGRREY 2047 +Y+G ++ SYI REY Sbjct: 8521 MYVGNTRKSYIVKWREY 8571
>LOC_Os05g31254:12005.t02721:unspliced-genomic N-acetyltransferase, putative, expressed| Length = 12494 Score = 26.7 bits (52), Expect(2) = 7.9 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 / +3 Query: 2004 LEYPKHLIFMDGGST*LRFCCT 2069 ++ PKHL+ +GG+ LRF T Sbjct: 11682 IQNPKHLVM*NGGNIYLRFIMT 11747 Score = 24.0 bits (46), Expect(2) = 7.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 / +3 Query: 1891 ILPPFTNIRCSNFFVNRMNIDTF 1959 I+PP IRC F+ R++ +F Sbjct: 11562 IIPPLHIIRCFGLFILRLDSLSF 11630
>LOC_Os09g19940:12009.t01728:unspliced-genomic nucleic acid binding protein, putative, expressed| Length = 5562 Score = 27.6 bits (54), Expect(2) = 8.5 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +2 / -2 Query: 1997 LYIGISKTSYIYGRREY 2047 +Y+G S+ SYI RREY Sbjct: 2108 MYVGNSRKSYIVKRREY 2058 Score = 23.1 bits (44), Expect(2) = 8.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 / -2 Query: 1891 ILPPFTNIRCSN 1926 ILPPF N+R S+ Sbjct: 2213 ILPPFHNVRLSS 2178
>LOC_Os03g14120:12003.t01204:unspliced-genomic dihydrodipicolinate reductase, putative, expressed| Length = 5254 Score = 28.6 bits (56), Expect(2) = 8.5 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 / +2 Query: 2275 YSLHPEILVLKIDVCRIILVINTPILFI 2192 Y HP +LVL I LVIN +L+I Sbjct: 2795 YCWHPTLLVLAFKYLTISLVINILLLYI 2878 Score = 22.1 bits (42), Expect(2) = 8.5 Identities = 7/25 (28%), Positives = 12/25 (48%) Frame = -3 / +3 Query: 2202 FYLFLGQVFSDGWSIKHVEICLNEL 2128 +Y Q+F W + +CL+ L Sbjct: 2865 YYSIFAQIFMVPWFLSKKSLCLSML 2939
>LOC_Os10g29090:12010.t02255:unspliced-genomic conserved hypothetical protein| Length = 4979 Score = 25.4 bits (49), Expect(2) = 8.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 / -2 Query: 10 TPWPPPQAPSLPRTANRRR 66 +PWP + LP A+RRR Sbjct: 340 SPWPCRRRRPLPEAASRRR 284 Score = 25.4 bits (49), Expect(2) = 8.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 / -3 Query: 72 RRCV*RAHGSYWCSGQVFPASAPP 143 RRC + CSG+V P APP Sbjct: 228 RRCSHPFESNPRCSGEVSPLFAPP 157
>LOC_Os12g01590:12012.t00058:unspliced-genomic expressed protein| Length = 3839 Score = 28.1 bits (55), Expect(2) = 8.7 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +2 / +2 Query: 1997 LYIGISKTSYIYGRREYI 2050 +Y+G ++ SYI RREYI Sbjct: 1760 MYVGNARKSYIVKRREYI 1813 Score = 22.6 bits (43), Expect(2) = 8.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 / +2 Query: 1891 ILPPFTNIRCSN 1926 +LPPF N+R S+ Sbjct: 1655 VLPPFHNVRLSS 1690
>LOC_Os11g32870:12011.t02883:unspliced-genomic hypothetical protein| Length = 3727 Score = 28.1 bits (55), Expect(2) = 8.8 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +2 / -3 Query: 1997 LYIGISKTSYIYGRREYIITF 2059 +Y+G ++ SYI RREY+ F Sbjct: 1265 MYVGNARKSYIVKRREYMSEF 1203 Score = 22.6 bits (43), Expect(2) = 8.8 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +1 / -3 Query: 1891 ILPPFTNIRCSNFFVNRMNID 1953 +LPPF N+R S+ ++++ Sbjct: 1370 LLPPFHNVRLSSISYIHLDVN 1308
>LOC_Os12g09290:12012.t00808:unspliced-genomic pseudouridylate synthase, putative, expressed| Length = 11974 Score = 33.6 bits (67), Expect = 10.0 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = +1 / +3 Query: 10 TPWPPPQAPSLPRTANRRR 66 TP PPP APS P T RRR Sbjct: 78 TPPPPPSAPSTPPTPTRRR 134
>LOC_Os11g28410:12011.t02454:unspliced-genomic retrotransposon protein, putative, unclassified| Length = 10449 Score = 33.6 bits (67), Expect = 10.0 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +2 / -3 Query: 2009 ISKTSYIYGRREYIITFLLYN 2071 +SK YI GRREYII F L N Sbjct: 3664 LSKIPYILGRREYIILFFLPN 3602
>LOC_Os08g44880:12008.t04210:unspliced-genomic hypothetical protein| Length = 273 Score = 33.6 bits (67), Expect = 10.0 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -3 / -3 Query: 474 CQGSSSGDRHVSPYRSESPTGTFRSVAVNAIDGCAS 367 C+G G RH S RS SPTGT R D +S Sbjct: 112 CRGGGGGCRHRSGSRSGSPTGTPRPRRSTVADAASS 5
>LOC_Os08g17080:12008.t01579:unspliced-genomic conserved hypothetical protein| Length = 2340 Score = 33.6 bits (67), Expect = 10.0 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 / -1 Query: 2368 F*NLRVSYVLMICKNRHRNKVEMHVIRKHRNFVNCIWFTK 2487 F N+ +S M+C+N N ++ HV++ H F+ F K Sbjct: 1956 FINVFLSQKCMVCQNGWNNSLQHHVLQHHPCFIKLATFAK 1837
>LOC_Os04g27930:12004.t02495:unspliced-genomic hypothetical protein| Length = 654 Score = 33.6 bits (67), Expect = 10.0 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 / -1 Query: 485 YQPLAKAPAVETGTSLLTDLSHPPVPSDLSQSTP*MDAPPV 363 Y P A A A G LL+ P +P L ++TP PP+ Sbjct: 483 YSPTADARAPSAGALLLSSYRPPRLPQPLRRATPPPPLPPI 361
>LOC_Os04g25740:12004.t02281:unspliced-genomic expressed protein| Length = 2441 Score = 33.6 bits (67), Expect = 10.0 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = +1 / +3 Query: 2008 NIQNILYLWTEGVHN 2052 N +NILYLWTE VHN Sbjct: 1410 NFKNILYLWTE*VHN 1454
>LOC_Os01g54440:12001.t04861:unspliced-genomic expressed protein| Length = 1686 Score = 33.6 bits (67), Expect = 10.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 / -3 Query: 211 APSPPWEIRKDDWCSTPPTPPFTGGAEAGKTWPE 110 A SP W S+PP PP G G TW E Sbjct: 829 AHSPQRHCSAASWNSSPPMPPSAGPLACGGTWRE 728
>LOC_Os01g10790:12001.t00952:unspliced-genomic WD-repeat protein 53, putative, expressed| Length = 4161 Score = 33.6 bits (67), Expect = 10.0 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -1 / +1 Query: 2459 FLCFLITCISTLFLCLFLHIIRTY 2388 F+CFL + LFLC FLHI+ Y Sbjct: 3136 FICFLRVSPTMLFLCNFLHILPFY 3207 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 1,583,504,538 Number of extensions: 27370895 Number of successful extensions: 128877 Number of sequences better than 10.0: 68 Length of query: 1285 Length of database: 55,613,886 Length adjustment: 53 Effective length of query: 1232 Effective length of database: 52,631,152 Effective search space: 64841579264 Effective search space used: 64841579264 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)
