| Clone Name | FLbaf60g22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q9Y7U5:RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 - Sc... | 35 | 3.2 |
|---|
>Q9Y7U5:RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 - Schizosaccharomyces| pombe (Fission yeast) Length = 1275 Score = 34.7 bits (78), Expect = 3.2 Identities = 30/95 (31%), Positives = 43/95 (45%), Gaps = 8/95 (8%) Frame = -1 Query: 485 YQPLAKAPAVETGTSLLTDLSHPPVPSDL-SQSTP*MDAPPVDLRELY------CSPGAY 327 ++PL + P V G SL+ L PP+PS + S S+P L LY CSP Y Sbjct: 153 FRPLPETP-VSPGGSLVHPLPRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPY 211 Query: 326 RGQSPAQG-GDGPHILSVRSTHQFVIRSRKRPSIE 225 SP + P + + S+ +S PS+E Sbjct: 212 LPLSPTRSPARTPSPIRLYSSDALRPQSPLSPSVE 246 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 651,306,448 Number of extensions: 14119370 Number of successful extensions: 32723 Number of sequences better than 10.0: 1 Number of HSP's gapped: 32694 Number of HSP's successfully gapped: 1 Length of query: 1285 Length of database: 100,686,439 Length adjustment: 125 Effective length of query: 1160 Effective length of database: 66,399,564 Effective search space: 77023494240 Effective search space used: 77023494240 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)