| Clone Name | FLbaf56n15 |
|---|---|
| Clone Library Name | barley_pub |
>Q9HSM6:MUTL_HALSA DNA mismatch repair protein mutL - Halobacterium salinarium| (Halobacterium halobium) Length = 659 Score = 33.5 bits (75), Expect = 1.0 Identities = 20/67 (29%), Positives = 35/67 (52%), Gaps = 6/67 (8%) Frame = +2 Query: 59 AAMEQQAKASEIDGTVAQRGAPR------ELDTAHKHRVGDHDIVSAGGGMKKLQEEEDK 220 AA+E + + +D + + GAPR + + + +H D D +AGGG Q + + Sbjct: 319 AAVEAGVRDALLDAGLVRAGAPRGASKPGDAEISPEHSPTDRDAGAAGGGDAAGQSDGNG 378 Query: 221 EKTAAEG 241 ++TAA G Sbjct: 379 QRTAASG 385
>Q5B1T9:ATG2_EMENI Autophagy-related protein 2 - Emericella nidulans (Aspergillus| nidulans) Length = 2102 Score = 30.8 bits (68), Expect = 6.5 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 140 PCLTRGARHAGQPCRRSRLPSPAAPW 63 P TRG R AG P R P+P+ PW Sbjct: 950 PRRTRGVRFAGSPQSPVRSPTPSVPW 975
>Q5H8A4:PIGG_HUMAN GPI ethanolamine phosphate transferase 2 - Homo sapiens (Human)| Length = 983 Score = 30.8 bits (68), Expect = 6.5 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = +1 Query: 310 LS*SSFMYRVLCRLHLVSRLILQVSTMSRSYDLWLWSTLKLPLVLMGQHSRLTAS 474 LS + F Y ++C + + + ++L S Y L++WS L+ G H +TA+ Sbjct: 916 LSHACFCYALICSIPVFTYIVLVTSLR---YHLFIWSVFSPKLLYEGMHLLITAA 967
>Q92WJ0:FBPC1_RHIME Fe(3+) ions import ATP-binding protein fbpC 1 - Rhizobium meliloti| (Sinorhizobium meliloti) Length = 353 Score = 30.8 bits (68), Expect = 6.5 Identities = 19/74 (25%), Positives = 32/74 (43%), Gaps = 10/74 (13%) Frame = +2 Query: 95 DGTVAQRGAPREL----------DTAHKHRVGDHDIVSAGGGMKKLQEEEDKEKTAAEGV 244 DG +AQ G PREL D + V D++ G ++ E + + G+ Sbjct: 214 DGNIAQEGPPRELYETPASAFIADFMGEANVVACDVIDVDGHEATIRVERLTHRVSGRGM 273 Query: 245 KPLPHKQVPQPSDV 286 +P P K +P+ + Sbjct: 274 RPGPAKLAVRPNAI 287
>Q00961:NMDE3_RAT Glutamate [NMDA] receptor subunit epsilon-3 precursor - Rattus| norvegicus (Rat) Length = 1237 Score = 30.4 bits (67), Expect = 8.5 Identities = 15/29 (51%), Positives = 21/29 (72%) Frame = -1 Query: 103 RAVDLACLRLLLHGCTRPVSTLWHASGVC 17 RA+DLA L+LL G T+ + T+W SG+C Sbjct: 771 RAIDLALLQLLGDGETQKLETVW-LSGIC 798 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 131,558,168 Number of extensions: 2765409 Number of successful extensions: 6835 Number of sequences better than 10.0: 5 Number of HSP's gapped: 6825 Number of HSP's successfully gapped: 5 Length of query: 267 Length of database: 100,686,439 Length adjustment: 111 Effective length of query: 156 Effective length of database: 70,239,694 Effective search space: 10957392264 Effective search space used: 10957392264 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)