| Clone Name | FLbaf51e24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | O26137:RL34_METTH 50S ribosomal protein L34e - Methanobacterium ... | 35 | 2.0 | 2 | P37173:TGFR2_HUMAN TGF-beta receptor type-2 precursor - Homo sap... | 33 | 5.8 | 3 | P13368:7LESS_DROME Protein sevenless - Drosophila melanogaster (... | 33 | 7.5 |
|---|
>O26137:RL34_METTH 50S ribosomal protein L34e - Methanobacterium thermoautotrophicum| Length = 88 Score = 35.0 bits (79), Expect = 2.0 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 294 VVHHTKRKTSWHLCHGCGRPAHKLLRTR 211 V H+ ++K S H+C GCG+P H + R R Sbjct: 24 VTHYRRKKPSKHVCAGCGKPLHGVPRGR 51
>P37173:TGFR2_HUMAN TGF-beta receptor type-2 precursor - Homo sapiens (Human)| Length = 567 Score = 33.5 bits (75), Expect = 5.8 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 1/65 (1%) Frame = -3 Query: 1341 SSTIAH*IQSTIAKP-ITNFSRGLLTFPQICYCCIVQFQSCPRTTSIQQPRSLVQPISES 1165 +STI +Q ++ I + G + FPQ+C C V+F +C S S+ I E Sbjct: 21 ASTIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITS-ICEK 79 Query: 1164 PRSQC 1150 P+ C Sbjct: 80 PQEVC 84
>P13368:7LESS_DROME Protein sevenless - Drosophila melanogaster (Fruit fly)| Length = 2554 Score = 33.1 bits (74), Expect = 7.5 Identities = 25/89 (28%), Positives = 38/89 (42%) Frame = +1 Query: 664 MVKTMLPWNIDSLYSSNALSVCFGIDLRQLSTMLHH*GARTTVHQDYPENHTRALDQSKV 843 +V+ + W+ + + ++ I R STM HH R E H +D+ V Sbjct: 155 VVEKVAIWHKHAAAAPPSIVEGIAISSRPQSTMAHHPDDRDRDRDPSEEQH--GVDERMV 212 Query: 844 LLRLLRSCTFFSLVESSLFMQSSHMGIFC 930 L R+ R C +VE LF+ GI C Sbjct: 213 LERVTRDCVQRCIVEEDLFL--DEFGIQC 239 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 553,138,503 Number of extensions: 12003015 Number of successful extensions: 27119 Number of sequences better than 10.0: 3 Number of HSP's gapped: 27108 Number of HSP's successfully gapped: 3 Length of query: 1070 Length of database: 100,686,439 Length adjustment: 124 Effective length of query: 946 Effective length of database: 66,673,859 Effective search space: 63073470614 Effective search space used: 63073470614 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)