| Clone Name | FLbaf51b18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q6CYJ9:GLMS_ERWCT Glucosamine--fructose-6-phosphate aminotransfe... | 31 | 1.9 |
|---|
>Q6CYJ9:GLMS_ERWCT Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] -| Erwinia carotovora subsp. atroseptica (Pectobacterium atrosepticum) Length = 610 Score = 31.2 bits (69), Expect = 1.9 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 2 GHISAVANQ*TRKLGRSWQLEQREEEESVVDHVAGDEGVGLH 127 G ++ + + R +S QL REE ES V + AGD+G H Sbjct: 211 GDVAEITRRDVRVFDKSGQLATREEIESKVSYDAGDKGAYRH 252 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 58,802,045 Number of extensions: 968162 Number of successful extensions: 2351 Number of sequences better than 10.0: 1 Number of HSP's gapped: 2351 Number of HSP's successfully gapped: 1 Length of query: 162 Length of database: 100,686,439 Length adjustment: 104 Effective length of query: 58 Effective length of database: 72,159,759 Effective search space: 4185266022 Effective search space used: 4185266022 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)