| Clone Name | FLbaf55i03 |
|---|---|
| Clone Library Name | barley_pub |
>LOC_Os05g51754:12005.t04695:unspliced-genomic expressed protein| Length = 1904 Score = 71.6 bits (150), Expect(4) = 7e-26 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 / +3 Query: 332 LMEHGLLSPERAKQAYDRKLKRQQQIKSGTPIKAS 436 LMEHGLLSPERAK+AY++K KRQQQI+SGTPIK S Sbjct: 1125 LMEHGLLSPERAKKAYEKKQKRQQQIRSGTPIKPS 1229 Score = 59.7 bits (124), Expect(4) = 7e-26 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +2 / +3 Query: 257 EREPLRIFYESLSKQIPSSEMAQFW 331 +REPLRIFYESLSKQIPSSEMA+FW Sbjct: 612 QREPLRIFYESLSKQIPSSEMAEFW 686 Score = 27.6 bits (54), Expect(4) = 7e-26 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 / +2 Query: 218 VFSLTGQKFETPEE 259 V+SL GQKF+ PEE Sbjct: 497 VYSLPGQKFDPPEE 538 Score = 22.6 bits (43), Expect(4) = 7e-26 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +2 / +3 Query: 569 AKAKRRVDYS 598 +KAK+RVDYS Sbjct: 1287 SKAKKRVDYS 1316 Score = 64.3 bits (134), Expect(3) = 4e-17 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -2 / -2 Query: 429 LIGVPDLICCCRLSFLS*ACFALSGDSSPCSIN 331 LIGVPD ICCCR F S A FALSGD++PCSIN Sbjct: 1222 LIGVPDRICCCRFCFFSYAFFALSGDNNPCSIN 1124 Score = 43.7 bits (89), Expect(3) = 4e-17 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -2 / -2 Query: 330 QNWAISLDGICLESDS*KILRGSL 259 QN AISL+GICL+ DS* ILRGSL Sbjct: 685 QNSAISLEGICLDKDS*NILRGSL 614 Score = 24.4 bits (47), Expect(3) = 4e-17 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = -2 / -3 Query: 258 SSGVSNFWPVREKT 217 SSG SNFWP E T Sbjct: 537 SSGGSNFWPGSE*T 496 Score = 35.9 bits (72), Expect(2) = 6e-04 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +1 / +2 Query: 253 RGEGAPQDLLRIALQADPIQRDGPILV 333 R E A QD+LR+ +QAD +Q DG ILV Sbjct: 608 RPERASQDILRVLIQADTLQ*DG*ILV 688 Score = 31.3 bits (62), Expect(2) = 6e-04 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 / +1 Query: 327 SG*WSMGCYLRKEQSK 374 +G*W+ GCYL KEQ K Sbjct: 1120 TG*WNTGCYLPKEQRK 1167 Score = 29.9 bits (59), Expect(2) = 0.66 Identities = 15/25 (60%), Positives = 15/25 (60%) Frame = -3 / -3 Query: 332 TRIGPSRWMGSAWRAIRRRS*GAPS 258 TRI PS W SAW RR S* A S Sbjct: 687 TRIQPSHWRVSAWIRTRRIS*EALS 613 Score = 26.7 bits (52), Expect(2) = 0.66 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -1 / -1 Query: 379 VGLLCSFRR*QPMLH*P 329 V LCSF R*QP+ H P Sbjct: 1172 VCFLCSFGR*QPVFHQP 1122
>LOC_Os03g14580:12003.t01247:unspliced-genomic expressed protein| Length = 2597 Score = 47.8 bits (98), Expect = 1e-04 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = +2 / +3 Query: 257 EREPLRIFYESLSKQIPSSEMAQFW 331 +R+PLRIFYESL +Q+P+SEMA W Sbjct: 1341 QRDPLRIFYESLYEQVPTSEMAAIW 1415
>LOC_Os04g11050:12004.t00933:unspliced-genomic expressed protein| Length = 4452 Score = 35.9 bits (72), Expect = 0.44 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 / -2 Query: 86 RTWRRRTWLKQLPAQGSRRGKGRGNSDQ 3 R WRRR W +G+RR +GRG +D+ Sbjct: 2153 RAWRRRLWPSGG*GRGTRRERGRGRTDE 2070
>LOC_Os06g23330:12006.t02145:unspliced-genomic conserved hypothetical protein| Length = 465 Score = 30.4 bits (60), Expect(2) = 1.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 / +3 Query: 80 WRRRTWLKQLPAQGSRRGKGRGNSD 6 WRRR W +++ +G G G G D Sbjct: 93 WRRRRWWQRVRGEGGSGGGGGGGGD 167 Score = 23.1 bits (44), Expect(2) = 1.4 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = -3 / +1 Query: 581 SWPWRRNDPCC 549 SW WRR D C Sbjct: 28 SWRWRREDRRC 60
>LOC_Os10g42790:12010.t03503:unspliced-genomic choline-phosphate cytidylyltransferase B, putative, expressed| Length = 2837 Score = 33.1 bits (66), Expect = 3.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 / -3 Query: 821 Q*IASSDYIYLCMCCVFELRENIDITFV*AMP 916 +*I SS I LC+CC F R+++ ++ + P Sbjct: 2826 K*ITSSSIISLCLCCAFSQRQHLSLSTLQTKP 2731
>LOC_Os12g15550:12012.t01410:unspliced-genomic S-locus-specific glycoprotein S13 precursor, putative, expressed| Length = 1452 Score = 32.2 bits (64), Expect = 5.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 / +1 Query: 338 PLTRIGPSRWMGSAWRAIRRRS*GAPSPLVFR 243 P +IG +RW G+ W + RS PSP +R Sbjct: 565 PGMKIGKNRWTGAEWYLLSWRSPADPSPGSYR 660
>LOC_Os07g29190:12007.t02609:unspliced-genomic expressed protein| Length = 1646 Score = 32.2 bits (64), Expect = 5.6 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = -3 / -2 Query: 359 PEIAAHAPLTRIGPSRWMGSAWRAIRRRS*GAPSP 255 P A A TR S W AWRA RRR PSP Sbjct: 1126 PPPAWTASRTRHRSSSWRRGAWRARRRRRGRRPSP 1022
>LOC_Os03g37920:12003.t03243:unspliced-genomic transposon protein, putative, unclassified, expressed| Length = 3176 Score = 32.2 bits (64), Expect = 5.6 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -3 / +2 Query: 110 SRLLLYYPRTWRRRTWLKQLPAQGSRRGKG 21 SR++ P TW+ RTW+ A G R +G Sbjct: 308 SRVVFTCPSTWQGRTWISITCAHGCRNRRG 397
>LOC_Os12g37400:12012.t03420:unspliced-genomic PROLIFERA protein, putative, expressed| Length = 5329 Score = 31.8 bits (63), Expect = 7.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -3 / -3 Query: 329 RIGPSRWMGSAWRAIRRRS 273 R G W GS WRA+RRR+ Sbjct: 290 RAGRRSWRGSPWRALRRRT 234
>LOC_Os11g24890:12011.t02109:unspliced-genomic hypothetical protein| Length = 1936 Score = 31.8 bits (63), Expect = 7.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 / +2 Query: 792 LFYFSPYKYNNELPLLTTYICVCV 863 +FYF KYN P+L +Y CV + Sbjct: 506 IFYFFVLKYNQCWPILQSYFCVTI 577
>LOC_Os08g37340:12008.t03471:unspliced-genomic hypothetical protein| Length = 348 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -3 / +3 Query: 110 SRLLLYYPRTWRRRTWLKQLPAQGSRRGKG 21 SR++ P TW RTW+ A G R +G Sbjct: 96 SRVVFTCPSTWHGRTWISITCAHGRRNHRG 185
>LOC_Os01g55974:12001.t05006:unspliced-genomic deoxycytidylate deaminase, putative, expressed| Length = 5946 Score = 31.8 bits (63), Expect = 7.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 / -3 Query: 60 QPCPPSPGSRVVKEEA 107 QPCPP P +R +EEA Sbjct: 4393 QPCPPPPAARAAREEA 4346
>LOC_Os01g16090:12001.t01459:unspliced-genomic RNA binding protein, putative, expressed| Length = 2819 Score = 31.8 bits (63), Expect = 7.7 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 / +1 Query: 107 RLLLYYPRTWRRRTWLKQLPAQGSRRGKGRG 15 RL + R WRR W ++ + +R G+GRG Sbjct: 316 RLAVARKRRWRRSRWRRRWRSTRTRMGRGRG 408
>LOC_Os11g11340:12011.t01022:unspliced-genomic CIP111, putative, expressed| Length = 6256 Score = 31.8 bits (63), Expect = 7.8 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 / +1 Query: 748 WIKQYRLRFRSLTQLFFTFHPTSTTMNC 831 WI+ + +R + + +FT HP+ +T C Sbjct: 2836 WIRHFSMRMMTSSPTYFTVHPSMSTSMC 2919
>LOC_Os03g08270:12003.t00685:unspliced-genomic ataxin-2 C-terminal region family protein, expressed| Length = 6992 Score = 31.8 bits (63), Expect = 7.8 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 / +1 Query: 317 MAQFWLMEHGLLSPERAKQAYDRKLKRQQQIK 412 +AQF+++ G +SP R AY + + R++ IK Sbjct: 2167 LAQFYMIGIGRISPARLSSAYHQYVHRRENIK 2262
>LOC_Os06g01810:12006.t00077:unspliced-genomic expressed protein| Length = 2746 Score = 30.4 bits (60), Expect(2) = 9.6 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 / -1 Query: 107 RLLLYYPRTWRRRTWLKQLPAQGSRRGKGR 18 RLL TWRRR+W ++ S RG+ R Sbjct: 199 RLLPTSTTTWRRRSWRRRGSRSRSGRGRSR 110 Score = 22.6 bits (43), Expect(2) = 9.6 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -3 / -3 Query: 344 HAPLTRIGPSRWMGSAWRAIR 282 H+P P W+GS W ++ Sbjct: 1271 HSPYP**LPFHWLGSCWGGLK 1209 Database: tigr.seq.out Posted date: Jul 20, 2007 8:58 AM Number of letters in database: 166,841,660 Number of sequences in database: 56,278 Lambda K H 0.318 0.134 0.401 Matrix: BLOSUM62 Number of Sequences: 56278 Number of Hits to DB: 275,723,287 Number of extensions: 3474448 Number of successful extensions: 19820 Number of sequences better than 10.0: 16 Length of query: 319 Length of database: 55,613,886 Length adjustment: 50 Effective length of query: 269 Effective length of database: 52,799,986 Effective search space: 14203196234 Effective search space used: 14203196234 Neighboring words threshold: 13 Window for multiple hits: 40 X1: 16 ( 7.3 bits)