| Clone Name | FLbaf55i03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Q5A449:RU2A_CANAL U2 small nuclear ribonucleoprotein A' - Candid... | 35 | 0.59 | 2 | P55824:FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase ... | 32 | 3.8 | 3 | Q4TUC0:RTBDN_CANFA Retbindin precursor - Canis familiaris (Dog) | 31 | 8.5 |
|---|
>Q5A449:RU2A_CANAL U2 small nuclear ribonucleoprotein A' - Candida albicans (Yeast)| Length = 233 Score = 34.7 bits (78), Expect = 0.59 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 4/55 (7%) Frame = +3 Query: 699 NGSVCLFLSG*HISYYMDQAIPSQIQITNSTLFYFSPYK----YNNELPLLTTYI 851 N CL LS +ISY D++ PS IT+ TLF + Y+ + ++ P L T I Sbjct: 64 NNLQCLLLSNNNISYIDDESFPSDNHITSITLFNNNIYQFQKSFKDKFPKLETLI 118
>P55824:FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF - Drosophila| melanogaster (Fruit fly) Length = 2778 Score = 32.0 bits (71), Expect = 3.8 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 260 REPLRIFYESLSKQIPSSEMAQFWLMEHGLLSP 358 R P+ +Y++LS I SS + + W H LLSP Sbjct: 2165 RGPVMEWYDALSHHIRSSALVRKWFANHALLSP 2197
>Q4TUC0:RTBDN_CANFA Retbindin precursor - Canis familiaris (Dog)| Length = 223 Score = 30.8 bits (68), Expect = 8.5 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 92 YPRTWRRRTWLKQLPAQGSRRGKGRG 15 +PR+ R RTW+ P GS G G G Sbjct: 197 FPRSRRSRTWILDAPGSGSGSGSGSG 222 Database: uniprot_sprot.fasta.out Posted date: Jul 19, 2007 5:58 PM Number of letters in database: 100,686,439 Number of sequences in database: 274,295 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 274295 Number of Hits to DB: 115,725,131 Number of extensions: 1883304 Number of successful extensions: 5545 Number of sequences better than 10.0: 3 Number of HSP's gapped: 5545 Number of HSP's successfully gapped: 3 Length of query: 319 Length of database: 100,686,439 Length adjustment: 113 Effective length of query: 206 Effective length of database: 69,691,104 Effective search space: 14356367424 Effective search space used: 14356367424 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)